Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	255189
Gene name	Phospholipase A2 group IVF
Gene symbol	PLA2G4F
Synonyms (NCBI Gene)	PLA2G4FZ
Chromosome	15
Chromosome location	15q15.1

32 Show/Hide all (32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048985	hsa-miR-92a-3p	CLASH	23622248
MIRT047586	hsa-miR-10a-5p	CLASH	23622248
MIRT047465	hsa-miR-10b-5p	CLASH	23622248
MIRT046020	hsa-miR-125b-5p	CLASH	23622248
MIRT045727	hsa-miR-125a-5p	CLASH	23622248
MIRT044179	hsa-miR-99b-5p	CLASH	23622248
MIRT043622	hsa-miR-326	CLASH	23622248
MIRT043457	hsa-miR-331-3p	CLASH	23622248
MIRT052654	hsa-miR-2116-3p	CLASH	23622248
MIRT1238789	hsa-miR-1207-5p	CLIP-seq
MIRT1238790	hsa-miR-1224-5p	CLIP-seq
MIRT1238791	hsa-miR-296-5p	CLIP-seq
MIRT1238792	hsa-miR-3921	CLIP-seq
MIRT1238793	hsa-miR-3939	CLIP-seq
MIRT1238794	hsa-miR-4270	CLIP-seq
MIRT1238795	hsa-miR-4441	CLIP-seq
MIRT1238796	hsa-miR-4649-3p	CLIP-seq
MIRT1238797	hsa-miR-4653-5p	CLIP-seq
MIRT1238798	hsa-miR-4736	CLIP-seq
MIRT1238799	hsa-miR-4751	CLIP-seq
MIRT1238800	hsa-miR-4763-3p	CLIP-seq
MIRT1238801	hsa-miR-555	CLIP-seq
MIRT1238802	hsa-miR-582-3p	CLIP-seq
MIRT1238803	hsa-miR-635	CLIP-seq
MIRT1238790	hsa-miR-1224-5p	CLIP-seq
MIRT1238791	hsa-miR-296-5p	CLIP-seq
MIRT1238792	hsa-miR-3921	CLIP-seq
MIRT1238796	hsa-miR-4649-3p	CLIP-seq
MIRT1238797	hsa-miR-4653-5p	CLIP-seq
MIRT1238799	hsa-miR-4751	CLIP-seq
MIRT1238803	hsa-miR-635	CLIP-seq
MIRT1238796	hsa-miR-4649-3p	CLIP-seq

33 Show/Hide all (33)

GO ID	Ontology	Definition	Evidence
GO:0001516	Process	Prostaglandin biosynthetic process	IEA
GO:0004620	Function	Phospholipase activity	IEA
GO:0004622	Function	Phosphatidylcholine lysophospholipase activity	IEA
GO:0004623	Function	Phospholipase A2 activity	IEA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005544	Function	Calcium-dependent phospholipid binding	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006650	Process	Glycerophospholipid metabolic process	IEA
GO:0008970	Function	Phospholipase A1 activity	IEA
GO:0008970	Function	Phospholipase A1 activity	TAS
GO:0009395	Process	Phospholipid catabolic process	IEA
GO:0015908	Process	Fatty acid transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031982	Component	Vesicle	IBA
GO:0031982	Component	Vesicle	IEA
GO:0032587	Component	Ruffle membrane	IBA
GO:0032587	Component	Ruffle membrane	IEA
GO:0036148	Process	Phosphatidylglycerol acyl-chain remodeling	TAS
GO:0046475	Process	Glycerophospholipid catabolic process	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IBA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IEA
GO:0050482	Process	Arachidonate secretion	IEA
GO:0071236	Process	Cellular response to antibiotic	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q68DD2

Protein name

Cytosolic phospholipase A2 zeta (cPLA2-zeta) (EC 3.1.1.4) (Phospholipase A2 group IVF)

Protein function

Has calcium-dependent phospholipase and lysophospholipase activities with a potential role in membrane lipid remodeling and biosynthesis of lipid mediators (PubMed:29158256). Preferentially hydrolyzes the ester bond of the fatty acyl group attac

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00168	C2	44 → 147	C2 domain	Domain
PF01735	PLA2_B	357 → 588	Lysophospholipase catalytic domain	Family
PF18695	cPLA2_C2	182 → 304	Cytosolic phospholipases A2 C2-domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in myocardium (at protein level). {ECO:0000269|PubMed:29158256}.

Sequence

MLWALWPRWLADKMLPLLGAVLLQKREKRGPLWRHWRRETYPYYDLQVKVLRATNIRGTD
LLSKADCYVQLWLPTASPSPAQTRIVANCSDPEWNETFHYQIHGAVKNVLELTLYDKDIL
GSDQLSLLLFDLRSLKCGQPHKHTFPLNHQDSQELQVEFVLEKSQVPASEVITNGVLVAH
PCLRIQGTLRGDGTAPREEYGSRQLQLAVPGAYEKPQLLPLQPPTEPGLPPTFTFHVNPV
LSSRLHVELMELLAAVQSGPSAELEAQTSKLGEGGILLSSLPLGQEEQCSVALGEGQEVA
LSMKVEMSSGDLDLRLGFDLSDGEQEFLDRRKQVVSKALQQVLGLSEALDSGQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGLLDTVTYLSGVSGSTWCISTLYRDPAWSQVALQGPIE
RAQVHVCSSKMGALSTERLQYYTQELGVRERSGHSVSLIDLWGLLVEYLLYQEENPAKLS
DQQEAVRQGQNPYPIYTSVNVRTNLSGEDFAEWCEFTPYEVGFPKYGAYVPTELFGSELF
MGRLLQLQPEPRICYLQGMWGSAFATSLDEIFLKTAGSGLSFLEWYRGSVNITDDCQKPQ
LHNPSRLRTRLLTPQGPFSQAVLDIFTSRFTSAQSFNFTRGLCLHKDYVAGREFVAWKDT
HPDAFPNQLTPMRDCLYLVDGGFAINSPFPLALLPQRAVDLILSFDYSLEAPFEVLKMTE
KYCLDRGIPFPSIEVGPEDMEEARECYLFAKAEDPRSPIVLHFPLVNRTFRTHLAPGVER
QTAEEKAFGDFVINRPDTPYGMMNFTYEPQDFYRLVALSRYNVLNNVETLKCALQLALDR
HQARERAGA

Sequence length

849

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glycerophospholipid metabolism	Acyl chain remodelling of PC
Ether lipid metabolism	Acyl chain remodelling of PS
Arachidonic acid metabolism	Acyl chain remodelling of PE
Linoleic acid metabolism	Acyl chain remodelling of PI
alpha-Linolenic acid metabolism	Acyl chain remodelling of PG
Metabolic pathways	Hydrolysis of LPC
MAPK signaling pathway
Ras signaling pathway
Phospholipase D signaling pathway
Necroptosis
Vascular smooth muscle contraction
VEGF signaling pathway
Platelet activation
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Glutamatergic synapse
Serotonergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Ovarian steroidogenesis
Oxytocin signaling pathway
Choline metabolism in cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHAGAS CARDIOMYOPATHY	—	GWAS catalog	24324551	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Degenerative polyarthritis	Arthritis	BEFREE	29968759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	29968759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
PLA2G4D	[]	28	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]
PLA2G4E	[]	27	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]
PLA2G4B	[]	27	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]
JMJD7-PLA2G4B	[]	27	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]
PLA2G4C	[]	26	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]

PLA2G4F (phospholipase A2 group IVF)

Bookmark This Gene