Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	100137049
Gene name	Phospholipase A2 group IVB
Gene symbol	PLA2G4B
Synonyms (NCBI Gene)	HsT16992cPLA2-beta
Chromosome	15
Chromosome location	15q15.1
Summary	This gene encodes a member of the cytosolic phospholipase A2 protein family. Phospholipase A2 enzymes hydrolyze the sn-2 bond of phospholipids, releasing lysophospholipids and fatty acids. This enzyme may be associated with mitochondria and early endosome

10 Show/Hide all (10)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004685	hsa-miR-338-3p	ImmunoblotImmunocytochemistryLuciferase reporter assayMicroarrayqRT-PCR	18991333
MIRT1238706	hsa-miR-4300	CLIP-seq
MIRT1238707	hsa-miR-4687-5p	CLIP-seq
MIRT1238708	hsa-miR-920	CLIP-seq
MIRT2070243	hsa-miR-214	CLIP-seq
MIRT2070244	hsa-miR-3619-5p	CLIP-seq
MIRT2070245	hsa-miR-4291	CLIP-seq
MIRT2070246	hsa-miR-512-5p	CLIP-seq
MIRT2070247	hsa-miR-761	CLIP-seq
MIRT2070248	hsa-miR-922	CLIP-seq

45 Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004620	Function	Phospholipase activity	IEA
GO:0004622	Function	Phosphatidylcholine lysophospholipase activity	IDA	16617059
GO:0004622	Function	Phosphatidylcholine lysophospholipase activity	IEA
GO:0004622	Function	Phosphatidylcholine lysophospholipase activity	NAS	10358058
GO:0004623	Function	Phospholipase A2 activity	IEA
GO:0004623	Function	Phospholipase A2 activity	TAS
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	NAS	10085124
GO:0005544	Function	Calcium-dependent phospholipid binding	IBA
GO:0005544	Function	Calcium-dependent phospholipid binding	NAS	10085124
GO:0005576	Component	Extracellular region	TAS	10085124
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	16617059
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	10358058, 16617059
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006650	Process	Glycerophospholipid metabolic process	IEA
GO:0006954	Process	Inflammatory response	NAS	10085124
GO:0007567	Process	Parturition	NAS	10085124
GO:0008970	Function	Phospholipase A1 activity	IDA	10358058
GO:0008970	Function	Phospholipase A1 activity	IEA
GO:0008970	Function	Phospholipase A1 activity	TAS
GO:0009395	Process	Phospholipid catabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019369	Process	Arachidonate metabolic process	NAS	10085124
GO:0019722	Process	Calcium-mediated signaling	NAS	10085124
GO:0031901	Component	Early endosome membrane	IDA	16617059
GO:0031901	Component	Early endosome membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0036148	Process	Phosphatidylglycerol acyl-chain remodeling	TAS
GO:0036151	Process	Phosphatidylcholine acyl-chain remodeling	IDA	10358058, 16617059
GO:0036152	Process	Phosphatidylethanolamine acyl-chain remodeling	IDA	16617059
GO:0046475	Process	Glycerophospholipid catabolic process	IBA
GO:0046475	Process	Glycerophospholipid catabolic process	IDA	10085124
GO:0046872	Function	Metal ion binding	IEA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IBA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IDA	10085124, 10358058, 16617059

MIM	HGNC	e!Ensembl
606088	9036	ENSG00000243708

P0C869

Protein name

Cytosolic phospholipase A2 beta (cPLA2-beta) (EC 3.1.1.4) (Lysophospholipase A1 group IVB) (EC 3.1.1.5) (Phospholipase A2 group IVB)

Protein function

Calcium-dependent phospholipase A1 and A2 and lysophospholipase that may play a role in membrane phospholipid remodeling. ; [Isoform 3]: Calcium-de

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00168	C2	10 → 114	C2 domain	Domain
PF01735	PLA2_B	297 → 532	Lysophospholipase catalytic domain	Family
PF18695	cPLA2_C2	151 → 243	Cytosolic phospholipases A2 C2-domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed at higher level in brain, heart, liver, cerebellum and pancreas. {ECO:0000269|PubMed:10085124, ECO:0000269|PubMed:10358058, ECO:0000269|PubMed:16617059}.

Sequence

MAVAEVSRTCLLTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVW
NQSFHFRIHRQLKNVMELKVFDQDLVTGDDPVLSVLFDAGTLRAGEFRRESFSLSPQGEG
RLEVEFRLQSLADRGEWLVSNGVLVARELSCLHVQLEETGDQKSSEHRVQLVVPGSCEGP
QEASVGTGTFRFHCPACWEQELSIRLQDAPEEQLKAPLSALPSGQVVRLVFPTSQEPLMR
VELKKEAGLRELAVRLGFGPCAEEQAFLSRRKQVVAAALRQALQLDGDLQEDEIPVVAIM
ATGGGIRAMTSLYGQLAGLKELGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPTE
LLKTQVTKNKLGVLAPSQLQRYRQELAERARLGYPSCFTNLWALINEALLHDEPHDHKLS
DQREALSHGQNPLPIYCALNTKGQSLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEF
FMGQLMKRLPESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWVRNQANLDKEQVPL
LKIEEPPSTAGRIAEFFTDLLTWRPLAQATHNFLRGLHFHKDYFQHPHFSTWKATTLDGL
PNQLTPSEPHLCLLDVGYLINTSCLPLLQPTRDVDLILSLDYNLHGAFQQLQLLGRFCQE
QGIPFPPISPSPEEQLQPRECHTFSDPTCPGAPAVLHFPLVSDSFREYSAPGVRRTPEEA
AAGEVNLSSSDSPYHYTKVTYSQEDVDKLLHLTHYNVCNNQEQLLEALRQAVQRRRQRRP
H

Sequence length

781

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glycerophospholipid metabolism	Acyl chain remodelling of PC
Ether lipid metabolism	Acyl chain remodelling of PS
Arachidonic acid metabolism	Acyl chain remodelling of PE
Linoleic acid metabolism	Acyl chain remodelling of PG
alpha-Linolenic acid metabolism	Hydrolysis of LPC
Metabolic pathways	Synthesis of PA
MAPK signaling pathway	XBP1(S) activates chaperone genes
Ras signaling pathway
Phospholipase D signaling pathway
Necroptosis
Vascular smooth muscle contraction
VEGF signaling pathway
Platelet activation
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Glutamatergic synapse
Serotonergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Ovarian steroidogenesis
Oxytocin signaling pathway
Choline metabolism in cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLA2G4B-related disorder	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Metabolic Syndrome	Metabolic syndrome	Pubtator	36518097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15999343		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15999343		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28030848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28030848		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
JMJD7-PLA2G4B	[]	29	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]
PLA2G4D	[]	28	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]
PLA2G4F	[]	27	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]
PLA2G4E	[]	26	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]
PLA2G4C	[]	25	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]

PLA2G4B (phospholipase A2 group IVB)

Bookmark This Gene