Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	8605
Gene name	Phospholipase A2 group IVC
Gene symbol	PLA2G4C
Synonyms (NCBI Gene)	CPLA2-gamma
Chromosome	19
Chromosome location	19q13.33
Summary	This gene encodes a protein which is a member of the phospholipase A2 enzyme family which hydrolyzes glycerophospholipids to produce free fatty acids and lysophospholipids, both of which serve as precursors in the production of signaling molecules. The en

35 Show/Hide all (35)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021740	hsa-miR-132-3p	Microarray	17612493
MIRT022128	hsa-miR-124-3p	Microarray	18668037
MIRT025081	hsa-miR-181a-5p	Microarray	17612493
MIRT1238709	hsa-miR-1197	CLIP-seq
MIRT1238710	hsa-miR-1258	CLIP-seq
MIRT1238711	hsa-miR-128	CLIP-seq
MIRT1238712	hsa-miR-27a	CLIP-seq
MIRT1238713	hsa-miR-27b	CLIP-seq
MIRT1238714	hsa-miR-3117-3p	CLIP-seq
MIRT1238715	hsa-miR-4680-5p	CLIP-seq
MIRT1238716	hsa-miR-4698	CLIP-seq
MIRT1238717	hsa-miR-4761-5p	CLIP-seq
MIRT1238709	hsa-miR-1197	CLIP-seq
MIRT1238710	hsa-miR-1258	CLIP-seq
MIRT1238711	hsa-miR-128	CLIP-seq
MIRT2594891	hsa-miR-1291	CLIP-seq
MIRT2594892	hsa-miR-146b-3p	CLIP-seq
MIRT1238712	hsa-miR-27a	CLIP-seq
MIRT1238713	hsa-miR-27b	CLIP-seq
MIRT1238714	hsa-miR-3117-3p	CLIP-seq
MIRT2594893	hsa-miR-3179	CLIP-seq
MIRT2594894	hsa-miR-3185	CLIP-seq
MIRT2594895	hsa-miR-328	CLIP-seq
MIRT2594896	hsa-miR-3922-5p	CLIP-seq
MIRT2594897	hsa-miR-4299	CLIP-seq
MIRT2594898	hsa-miR-4474-3p	CLIP-seq
MIRT2594899	hsa-miR-4476	CLIP-seq
MIRT2594900	hsa-miR-4493	CLIP-seq
MIRT1238715	hsa-miR-4680-5p	CLIP-seq
MIRT1238716	hsa-miR-4698	CLIP-seq
MIRT2594901	hsa-miR-4753-5p	CLIP-seq
MIRT1238717	hsa-miR-4761-5p	CLIP-seq
MIRT2594902	hsa-miR-4773	CLIP-seq
MIRT2594903	hsa-miR-509-3p	CLIP-seq
MIRT2594904	hsa-miR-644	CLIP-seq

50 Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004620	Function	Phospholipase activity	IEA
GO:0004622	Function	Phosphatidylcholine lysophospholipase activity	IDA	15944408, 19501189
GO:0004622	Function	Phosphatidylcholine lysophospholipase activity	IEA
GO:0004622	Function	Phosphatidylcholine lysophospholipase activity	TAS
GO:0004623	Function	Phospholipase A2 activity	IEA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005543	Function	Phospholipid binding	NAS	10085124
GO:0005544	Function	Calcium-dependent phospholipid binding	IBA
GO:0005635	Component	Nuclear envelope	IBA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	15944408, 19501189
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005811	Component	Lipid droplet	IDA	28336330
GO:0005811	Component	Lipid droplet	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS	10085124
GO:0005886	Component	Plasma membrane	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	TAS	10085124
GO:0006650	Process	Glycerophospholipid metabolic process	IEA
GO:0006663	Process	Platelet activating factor biosynthetic process	IDA	19501189
GO:0006954	Process	Inflammatory response	NAS	10085124
GO:0007567	Process	Parturition	NAS	10085124
GO:0008374	Function	O-acyltransferase activity	IDA	15944408, 19501189
GO:0008970	Function	Phospholipase A1 activity	TAS
GO:0009395	Process	Phospholipid catabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	10085124
GO:0016740	Function	Transferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019369	Process	Arachidonate metabolic process	NAS	10085124
GO:0031966	Component	Mitochondrial membrane	IDA	15944408, 19501189
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0035556	Process	Intracellular signal transduction	NAS	10085124
GO:0036151	Process	Phosphatidylcholine acyl-chain remodeling	IDA	19501189
GO:0036151	Process	Phosphatidylcholine acyl-chain remodeling	TAS
GO:0036152	Process	Phosphatidylethanolamine acyl-chain remodeling	IDA	19501189
GO:0036152	Process	Phosphatidylethanolamine acyl-chain remodeling	TAS
GO:0046475	Process	Glycerophospholipid catabolic process	IBA
GO:0046475	Process	Glycerophospholipid catabolic process	IDA	10085124
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IBA
GO:0047499	Function	Calcium-independent phospholipase A2 activity	IDA	10085124
GO:0140042	Process	Lipid droplet formation	IMP	28336330

MIM	HGNC	e!Ensembl
603602	9037	ENSG00000105499

Q9UP65

Protein name

Cytosolic phospholipase A2 gamma (cPLA2-gamma) (EC 3.1.1.4) (Cytosolic lysophospholipase) (EC 3.1.1.5) (Cytosolic lysophospholipid O-acyltransferase) (EC 2.3.1.-) (Phospholipase A2 group IVC)

Protein function

Calcium-independent phospholipase, lysophospholipase and O-acyltransferase involved in phospholipid remodeling with implications in endoplasmic reticulum membrane homeostasis and lipid droplet biogenesis (PubMed:10085124, PubMed:10358058, PubMed

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01735	PLA2_B	44 → 246	Lysophospholipase catalytic domain	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in heart and skeletal muscle. {ECO:0000269|PubMed:10085124, ECO:0000269|PubMed:9705332}.

Sequence

MGSSEVSIIPGLQKEEKAAVERRRLHVLKALKKLRIEADEAPVVAVLGSGGGLRAHIACL
GVLSEMKEQGLLDAVTYLAGVSGSTWAISSLYTNDGDMEALEADLKHRFTRQEWDLAKSL
QKTIQAARSENYSLTDFWAYMVISKQTRELPESHLSNMKKPVEEGTLPYPIFAAIDNDLQ
PSWQEARAPETWFEFTPHHAGFSALGAFVSITHFGSKFKKGRLVRTHPERDLTFLRGLWG
SALGNTEVIREYIFDQLRNLTLKGLWRRAVANAKSIGHLIFARLLRLQESSQGEHPPPED
EGGEPEHTWLTEMLENWTRTSLEKQEQPHEDPERKGSLSNLMDFVKKTGICASKWEWGTT
HNFLYKHGGIRDKIMSSRKHLHLVDAGLAINTPFPLVLPPTREVHLILSFDFSAGDPFET
IRATTDYCRRHKIPFPQVEEAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIE
AWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKDSARSCCL
A

Sequence length

541

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glycerophospholipid metabolism	Acyl chain remodelling of PC
Ether lipid metabolism	Acyl chain remodelling of PE
Arachidonic acid metabolism	Acyl chain remodelling of PI
Linoleic acid metabolism	Hydrolysis of LPC
alpha-Linolenic acid metabolism	Hydrolysis of LPE
Metabolic pathways
MAPK signaling pathway
Ras signaling pathway
Phospholipase D signaling pathway
Necroptosis
Vascular smooth muscle contraction
VEGF signaling pathway
Platelet activation
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Glutamatergic synapse
Serotonergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Ovarian steroidogenesis
Oxytocin signaling pathway
Choline metabolism in cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (21)
Anaplastic Oligodendroglioma	Anaplastic Oligodendroglioma	BEFREE	16550607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27127201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	31344532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27127201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	27611910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26364726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	37958793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31344532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26364726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28336330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11958371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	11958371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26364726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11958371, 17667543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	37770949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16882668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	27611910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15999343, 26160611, 28651698		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15999343		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	16550607		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
PLA2G4E	[]	26	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]
PLA2G4F	[]	26	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]
PLA2G4D	[]	26	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]
PLA2G4B	[]	25	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]
JMJD7-PLA2G4B	[]	25	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]

PLA2G4C (phospholipase A2 group IVC)

Bookmark This Gene