PLA2G12B (phospholipase A2 group XIIB)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 84647
Gene name Phospholipase A2 group XIIB
Gene symbol PLA2G12B
Synonyms (NCBI Gene)
FKSG71GXIIBGXIIIsPLA2PLA2G13sPLA2-GXIIB
Chromosome 10
Chromosome location 10q22.1
Summary The protein encoded by this gene belongs to the phospholipase A2 (PLA2) group of enzymes, which function in glycolipid hydrolysis with the release of free fatty acids and lysophospholipids. This family member has altered phospholipid-binding properties an
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2070173 hsa-miR-4530 CLIP-seq
MIRT2070174 hsa-miR-4640-5p CLIP-seq
MIRT2070175 hsa-miR-4726-5p CLIP-seq
MIRT2070176 hsa-miR-922 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004623 Function Phospholipase A2 activity IEA
GO:0005509 Function Calcium ion binding IEA
GO:0005576 Component Extracellular region IEA
GO:0006644 Process Phospholipid metabolic process IEA
GO:0016042 Process Lipid catabolic process IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
611653 18555 ENSG00000138308
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BX93
Protein name Group XIIB secretory phospholipase A2-like protein (Group XIII secretory phospholipase A2-like protein) (GXIII sPLA2-like) (sPLA2-GXIIB) (GXIIB)
Protein function Not known; does not seem to have catalytic activity.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06951 PLA2G12 11 → 195 Group XII secretory phospholipase A2 precursor (PLA2G12) Domain
Tissue specificity TISSUE SPECIFICITY: Strong expression in liver, small intestine and kidney. {ECO:0000269|PubMed:14516201}.
Sequence 
MKLASGFLVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGK
NGVCQYRCRYGKAPMPRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCYD
TCGANKYRCDAKFRWCLHSICSDLKRSLGFVSKVEAACDSLVDTVFNTVWTLGCRPFMNS
QRAACICAEEEKEEL
Sequence length 195
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Vascular smooth muscle contraction
Pancreatic secretion
Fat digestion and absorption
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
FAMILIAL LIPOPROTEIN LIPASE DEFICIENCY — GWAS catalog 39024449
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Idiopathic Membranous Glomerulonephritis Membranous Glomerulonephritis BEFREE 31160422
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
PLA2G2C 9 shared pathwaysGlycerophospholipid metabolism, Ether lipid metabolism, Arachidonic acid metabolism, Linoleic acid metabolism, alpha-Linolenic acid metabolism, Ras signaling pathway, Vascular smooth muscle contraction, Pancreatic secretion, Fat digestion and absorption Related via 9 shared pathways including Glycerophospholipid metabolism, Ether lipid metabolism. PLA2G3 9 shared pathwaysGlycerophospholipid metabolism, Ether lipid metabolism, Arachidonic acid metabolism, Linoleic acid metabolism, alpha-Linolenic acid metabolism, Ras signaling pathway, Vascular smooth muscle contraction, Pancreatic secretion, Fat digestion and absorption Related via 9 shared pathways including Glycerophospholipid metabolism, Ether lipid metabolism. PLA2G2D 9 shared pathwaysGlycerophospholipid metabolism, Ether lipid metabolism, Arachidonic acid metabolism, Linoleic acid metabolism, alpha-Linolenic acid metabolism, Ras signaling pathway, Vascular smooth muscle contraction, Pancreatic secretion, Fat digestion and absorption Related via 9 shared pathways including Glycerophospholipid metabolism, Ether lipid metabolism. PLA2G2E 9 shared pathwaysGlycerophospholipid metabolism, Ether lipid metabolism, Arachidonic acid metabolism, Linoleic acid metabolism, alpha-Linolenic acid metabolism, Ras signaling pathway, Vascular smooth muscle contraction, Pancreatic secretion, Fat digestion and absorption Related via 9 shared pathways including Glycerophospholipid metabolism, Ether lipid metabolism. PLA2G1B 9 shared pathwaysGlycerophospholipid metabolism, Ether lipid metabolism, Arachidonic acid metabolism, Linoleic acid metabolism, alpha-Linolenic acid metabolism, Ras signaling pathway, Vascular smooth muscle contraction, Pancreatic secretion, Fat digestion and absorption Related via 9 shared pathways including Glycerophospholipid metabolism, Ether lipid metabolism.
Major depressive disorder Linked via 1 of 5 related genesPLA2G2C Hypothyroidism Linked via 1 of 5 related genesPLA2G3 Crohn disease Linked via 1 of 5 related genesPLA2G2D Inflammatory bowel disease Linked via 1 of 5 related genesPLA2G2D Obesity Linked via 1 of 5 related genesPLA2G2D