Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	26279
Gene name	Phospholipase A2 group IID
Gene symbol	PLA2G2D
Synonyms (NCBI Gene)	PLA2IIDSPLASHsPLA2-IIDsPLA2S
Chromosome	1
Chromosome location	1p36.12
Summary	This gene encodes a secreted member of the phospholipase A2 family, and is found in a cluster of related family members on chromosome 1. Phospholipase A2 family members hydrolyze the sn-2 fatty acid ester bond of glycerophospholipids to produce lysophosph

238 Show/Hide all (238)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051311	hsa-miR-15a-5p	CLASH	23622248
MIRT455396	hsa-miR-3120-3p	PAR-CLIP	23592263
MIRT455395	hsa-miR-548p	PAR-CLIP	23592263
MIRT455394	hsa-miR-183-5p	PAR-CLIP	23592263
MIRT455393	hsa-miR-4461	PAR-CLIP	23592263
MIRT455392	hsa-miR-545-3p	PAR-CLIP	23592263
MIRT455391	hsa-miR-4328	PAR-CLIP	23592263
MIRT455390	hsa-miR-1253	PAR-CLIP	23592263
MIRT455389	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT455388	hsa-miR-1468-3p	PAR-CLIP	23592263
MIRT455387	hsa-miR-34a-5p	PAR-CLIP	23592263
MIRT455386	hsa-miR-34c-5p	PAR-CLIP	23592263
MIRT455385	hsa-miR-449a	PAR-CLIP	23592263
MIRT455384	hsa-miR-449b-5p	PAR-CLIP	23592263
MIRT455383	hsa-miR-548au-3p	PAR-CLIP	23592263
MIRT455382	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT455381	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT455380	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT455379	hsa-miR-580-3p	PAR-CLIP	23592263
MIRT455378	hsa-miR-6509-5p	PAR-CLIP	23592263
MIRT455396	hsa-miR-3120-3p	PAR-CLIP	23592263
MIRT455395	hsa-miR-548p	PAR-CLIP	23592263
MIRT455394	hsa-miR-183-5p	PAR-CLIP	23592263
MIRT455393	hsa-miR-4461	PAR-CLIP	23592263
MIRT455392	hsa-miR-545-3p	PAR-CLIP	23592263
MIRT455391	hsa-miR-4328	PAR-CLIP	23592263
MIRT455390	hsa-miR-1253	PAR-CLIP	23592263
MIRT455389	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT455388	hsa-miR-1468-3p	PAR-CLIP	23592263
MIRT455387	hsa-miR-34a-5p	PAR-CLIP	23592263
MIRT455386	hsa-miR-34c-5p	PAR-CLIP	23592263
MIRT455385	hsa-miR-449a	PAR-CLIP	23592263
MIRT455384	hsa-miR-449b-5p	PAR-CLIP	23592263
MIRT455383	hsa-miR-548au-3p	PAR-CLIP	23592263
MIRT455382	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT455381	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT455380	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT455379	hsa-miR-580-3p	PAR-CLIP	23592263
MIRT455378	hsa-miR-6509-5p	PAR-CLIP	23592263
MIRT1238586	hsa-miR-1197	CLIP-seq
MIRT1238587	hsa-miR-122	CLIP-seq
MIRT1238588	hsa-miR-125a-5p	CLIP-seq
MIRT1238589	hsa-miR-125b	CLIP-seq
MIRT1238590	hsa-miR-1267	CLIP-seq
MIRT1238591	hsa-miR-1285	CLIP-seq
MIRT1238592	hsa-miR-1289	CLIP-seq
MIRT1238593	hsa-miR-1825	CLIP-seq
MIRT1238594	hsa-miR-1909	CLIP-seq
MIRT1238595	hsa-miR-2054	CLIP-seq
MIRT1238596	hsa-miR-2355-5p	CLIP-seq
MIRT1238597	hsa-miR-23a	CLIP-seq
MIRT1238598	hsa-miR-23b	CLIP-seq
MIRT1238599	hsa-miR-23c	CLIP-seq
MIRT1238600	hsa-miR-27a	CLIP-seq
MIRT1238601	hsa-miR-27b	CLIP-seq
MIRT1238602	hsa-miR-2909	CLIP-seq
MIRT1238603	hsa-miR-3135b	CLIP-seq
MIRT1238604	hsa-miR-3148	CLIP-seq
MIRT1238605	hsa-miR-3150b-3p	CLIP-seq
MIRT1238606	hsa-miR-3156-3p	CLIP-seq
MIRT1238607	hsa-miR-3173-3p	CLIP-seq
MIRT1238608	hsa-miR-3187-5p	CLIP-seq
MIRT1238609	hsa-miR-3620	CLIP-seq
MIRT1238610	hsa-miR-3652	CLIP-seq
MIRT1238611	hsa-miR-3689d	CLIP-seq
MIRT1238612	hsa-miR-378g	CLIP-seq
MIRT1238613	hsa-miR-382	CLIP-seq
MIRT1238614	hsa-miR-3915	CLIP-seq
MIRT1238615	hsa-miR-3928	CLIP-seq
MIRT1238616	hsa-miR-3943	CLIP-seq
MIRT1238617	hsa-miR-3974	CLIP-seq
MIRT1238618	hsa-miR-425	CLIP-seq
MIRT1238619	hsa-miR-4265	CLIP-seq
MIRT1238620	hsa-miR-4271	CLIP-seq
MIRT1238621	hsa-miR-4278	CLIP-seq
MIRT1238622	hsa-miR-4289	CLIP-seq
MIRT1238623	hsa-miR-4296	CLIP-seq
MIRT1238624	hsa-miR-4300	CLIP-seq
MIRT1238625	hsa-miR-4301	CLIP-seq
MIRT1238626	hsa-miR-4319	CLIP-seq
MIRT1238627	hsa-miR-432	CLIP-seq
MIRT1238628	hsa-miR-4322	CLIP-seq
MIRT1238629	hsa-miR-4323	CLIP-seq
MIRT1238630	hsa-miR-4423-5p	CLIP-seq
MIRT1238631	hsa-miR-4430	CLIP-seq
MIRT1238632	hsa-miR-4436b-3p	CLIP-seq
MIRT1238633	hsa-miR-4443	CLIP-seq
MIRT1238634	hsa-miR-4450	CLIP-seq
MIRT1238635	hsa-miR-4453	CLIP-seq
MIRT1238636	hsa-miR-4476	CLIP-seq
MIRT1238637	hsa-miR-4486	CLIP-seq
MIRT1238638	hsa-miR-4496	CLIP-seq
MIRT1238639	hsa-miR-4533	CLIP-seq
MIRT1238640	hsa-miR-4538	CLIP-seq
MIRT1238641	hsa-miR-4648	CLIP-seq
MIRT1238642	hsa-miR-4654	CLIP-seq
MIRT1238643	hsa-miR-4685-5p	CLIP-seq
MIRT1238644	hsa-miR-4689	CLIP-seq
MIRT1238645	hsa-miR-4695-5p	CLIP-seq
MIRT1238646	hsa-miR-4710	CLIP-seq
MIRT1238647	hsa-miR-4712-3p	CLIP-seq
MIRT1238648	hsa-miR-4717-3p	CLIP-seq
MIRT1238649	hsa-miR-4725-3p	CLIP-seq
MIRT1238650	hsa-miR-4747-5p	CLIP-seq
MIRT1238651	hsa-miR-4760-3p	CLIP-seq
MIRT1238652	hsa-miR-4769-5p	CLIP-seq
MIRT1238653	hsa-miR-4779	CLIP-seq
MIRT1238654	hsa-miR-4784	CLIP-seq
MIRT1238655	hsa-miR-491-5p	CLIP-seq
MIRT1238656	hsa-miR-493	CLIP-seq
MIRT1238657	hsa-miR-515-3p	CLIP-seq
MIRT1238658	hsa-miR-519e	CLIP-seq
MIRT1238659	hsa-miR-532-3p	CLIP-seq
MIRT1238660	hsa-miR-544b	CLIP-seq
MIRT1238661	hsa-miR-545	CLIP-seq
MIRT1238662	hsa-miR-580	CLIP-seq
MIRT1238663	hsa-miR-612	CLIP-seq
MIRT1238664	hsa-miR-765	CLIP-seq
MIRT1238665	hsa-miR-920	CLIP-seq
MIRT1238587	hsa-miR-122	CLIP-seq
MIRT2070209	hsa-miR-1254	CLIP-seq
MIRT1238591	hsa-miR-1285	CLIP-seq
MIRT2070210	hsa-miR-208a	CLIP-seq
MIRT2070211	hsa-miR-208b	CLIP-seq
MIRT2070212	hsa-miR-3116	CLIP-seq
MIRT1238603	hsa-miR-3135b	CLIP-seq
MIRT1238608	hsa-miR-3187-5p	CLIP-seq
MIRT2070213	hsa-miR-3617	CLIP-seq
MIRT2070214	hsa-miR-3622b-5p	CLIP-seq
MIRT1238610	hsa-miR-3652	CLIP-seq
MIRT2070215	hsa-miR-3658	CLIP-seq
MIRT1238612	hsa-miR-378g	CLIP-seq
MIRT1238631	hsa-miR-4430	CLIP-seq
MIRT2070216	hsa-miR-4437	CLIP-seq
MIRT1238637	hsa-miR-4486	CLIP-seq
MIRT2070217	hsa-miR-4674	CLIP-seq
MIRT2070218	hsa-miR-4726-3p	CLIP-seq
MIRT2070219	hsa-miR-4757-5p	CLIP-seq
MIRT2070220	hsa-miR-499-5p	CLIP-seq
MIRT1238663	hsa-miR-612	CLIP-seq
MIRT2070221	hsa-miR-641	CLIP-seq
MIRT2070222	hsa-miR-661	CLIP-seq
MIRT1238587	hsa-miR-122	CLIP-seq
MIRT2070209	hsa-miR-1254	CLIP-seq
MIRT1238590	hsa-miR-1267	CLIP-seq
MIRT1238594	hsa-miR-1909	CLIP-seq
MIRT2297482	hsa-miR-1915	CLIP-seq
MIRT2297483	hsa-miR-1976	CLIP-seq
MIRT2297484	hsa-miR-214	CLIP-seq
MIRT1238600	hsa-miR-27a	CLIP-seq
MIRT1238601	hsa-miR-27b	CLIP-seq
MIRT2070212	hsa-miR-3116	CLIP-seq
MIRT1238603	hsa-miR-3135b	CLIP-seq
MIRT2297485	hsa-miR-3140-5p	CLIP-seq
MIRT1238606	hsa-miR-3156-3p	CLIP-seq
MIRT2297486	hsa-miR-34a	CLIP-seq
MIRT2297487	hsa-miR-3619-5p	CLIP-seq
MIRT1238610	hsa-miR-3652	CLIP-seq
MIRT2297488	hsa-miR-3664-5p	CLIP-seq
MIRT2297489	hsa-miR-3665	CLIP-seq
MIRT2297490	hsa-miR-3691-3p	CLIP-seq
MIRT2297491	hsa-miR-3910	CLIP-seq
MIRT1238617	hsa-miR-3974	CLIP-seq
MIRT2297492	hsa-miR-4269	CLIP-seq
MIRT2297493	hsa-miR-4279	CLIP-seq
MIRT1238625	hsa-miR-4301	CLIP-seq
MIRT1238630	hsa-miR-4423-5p	CLIP-seq
MIRT2297494	hsa-miR-4427	CLIP-seq
MIRT1238631	hsa-miR-4430	CLIP-seq
MIRT2297495	hsa-miR-4434	CLIP-seq
MIRT1238632	hsa-miR-4436b-3p	CLIP-seq
MIRT2297496	hsa-miR-4438	CLIP-seq
MIRT2297497	hsa-miR-449b	CLIP-seq
MIRT2297498	hsa-miR-4516	CLIP-seq
MIRT2297499	hsa-miR-4530	CLIP-seq
MIRT1238643	hsa-miR-4685-5p	CLIP-seq
MIRT1238648	hsa-miR-4717-3p	CLIP-seq
MIRT2297500	hsa-miR-4722-3p	CLIP-seq
MIRT2297501	hsa-miR-4723-5p	CLIP-seq
MIRT2070218	hsa-miR-4726-3p	CLIP-seq
MIRT1238656	hsa-miR-493	CLIP-seq
MIRT2297502	hsa-miR-5095	CLIP-seq
MIRT1238659	hsa-miR-532-3p	CLIP-seq
MIRT1238661	hsa-miR-545	CLIP-seq
MIRT1238662	hsa-miR-580	CLIP-seq
MIRT2297503	hsa-miR-625	CLIP-seq
MIRT2070222	hsa-miR-661	CLIP-seq
MIRT2297504	hsa-miR-761	CLIP-seq
MIRT1238587	hsa-miR-122	CLIP-seq
MIRT1238603	hsa-miR-3135b	CLIP-seq
MIRT1238610	hsa-miR-3652	CLIP-seq
MIRT1238630	hsa-miR-4423-5p	CLIP-seq
MIRT1238631	hsa-miR-4430	CLIP-seq
MIRT2297501	hsa-miR-4723-5p	CLIP-seq
MIRT2070209	hsa-miR-1254	CLIP-seq
MIRT2297483	hsa-miR-1976	CLIP-seq
MIRT2070212	hsa-miR-3116	CLIP-seq
MIRT2297485	hsa-miR-3140-5p	CLIP-seq
MIRT2297492	hsa-miR-4269	CLIP-seq
MIRT2297494	hsa-miR-4427	CLIP-seq
MIRT2297496	hsa-miR-4438	CLIP-seq
MIRT2297500	hsa-miR-4722-3p	CLIP-seq
MIRT2456595	hsa-miR-4794	CLIP-seq
MIRT2297502	hsa-miR-5095	CLIP-seq
MIRT2070222	hsa-miR-661	CLIP-seq
MIRT2070209	hsa-miR-1254	CLIP-seq
MIRT2297483	hsa-miR-1976	CLIP-seq
MIRT2070212	hsa-miR-3116	CLIP-seq
MIRT2297485	hsa-miR-3140-5p	CLIP-seq
MIRT2594852	hsa-miR-3149	CLIP-seq
MIRT2594853	hsa-miR-411	CLIP-seq
MIRT2297492	hsa-miR-4269	CLIP-seq
MIRT2297494	hsa-miR-4427	CLIP-seq
MIRT2297496	hsa-miR-4438	CLIP-seq
MIRT2297500	hsa-miR-4722-3p	CLIP-seq
MIRT2594854	hsa-miR-4735-5p	CLIP-seq
MIRT2594855	hsa-miR-4775	CLIP-seq
MIRT2594856	hsa-miR-4776-3p	CLIP-seq
MIRT2456595	hsa-miR-4794	CLIP-seq
MIRT2297502	hsa-miR-5095	CLIP-seq
MIRT2594857	hsa-miR-590-3p	CLIP-seq
MIRT2070222	hsa-miR-661	CLIP-seq
MIRT2070209	hsa-miR-1254	CLIP-seq
MIRT2297483	hsa-miR-1976	CLIP-seq
MIRT2070212	hsa-miR-3116	CLIP-seq
MIRT2297485	hsa-miR-3140-5p	CLIP-seq
MIRT2594852	hsa-miR-3149	CLIP-seq
MIRT2594853	hsa-miR-411	CLIP-seq
MIRT2297494	hsa-miR-4427	CLIP-seq
MIRT2297496	hsa-miR-4438	CLIP-seq
MIRT2297500	hsa-miR-4722-3p	CLIP-seq
MIRT2594854	hsa-miR-4735-5p	CLIP-seq
MIRT2594855	hsa-miR-4775	CLIP-seq
MIRT2594856	hsa-miR-4776-3p	CLIP-seq
MIRT2456595	hsa-miR-4794	CLIP-seq
MIRT2297502	hsa-miR-5095	CLIP-seq
MIRT2594857	hsa-miR-590-3p	CLIP-seq
MIRT2070222	hsa-miR-661	CLIP-seq

33 Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002361	Process	CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	IEA
GO:0002864	Process	Regulation of acute inflammatory response to antigenic stimulus	IEA
GO:0002864	Process	Regulation of acute inflammatory response to antigenic stimulus	ISS
GO:0004623	Function	Phospholipase A2 activity	IEA
GO:0004623	Function	Phospholipase A2 activity	TAS	10455175
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005543	Function	Phospholipid binding	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	10455175
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	TAS	10455175
GO:0006954	Process	Inflammatory response	TAS	10455175
GO:0008201	Function	Heparin binding	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IBA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0043395	Function	Heparan sulfate proteoglycan binding	IEA
GO:0046337	Process	Phosphatidylethanolamine metabolic process	IEA
GO:0046337	Process	Phosphatidylethanolamine metabolic process	ISS
GO:0046470	Process	Phosphatidylcholine metabolic process	IBA
GO:0046470	Process	Phosphatidylcholine metabolic process	IDA	10681567
GO:0046470	Process	Phosphatidylcholine metabolic process	IEA
GO:0046471	Process	Phosphatidylglycerol metabolic process	IBA
GO:0046471	Process	Phosphatidylglycerol metabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IBA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IDA	10681567
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IEA
GO:0050482	Process	Arachidonate secretion	IEA
GO:0050868	Process	Negative regulation of T cell activation	IEA

MIM	HGNC	e!Ensembl
605630	9033	ENSG00000117215

Q9UNK4

Protein name

Group IID secretory phospholipase A2 (GIID sPLA2) (sPLA2-IID) (EC 3.1.1.4) (PLA2IID) (Phosphatidylcholine 2-acylhydrolase 2D) (Secretory-type PLA, stroma-associated homolog)

Protein function

Secretory calcium-dependent phospholipase A2 that primarily targets extracellular lipids, exerting anti-inflammatory and immunosuppressive functions (PubMed:10455175, PubMed:10681567). Hydrolyzes the ester bond of the fatty acyl group attached a

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00068	Phospholip_A2_1	22 → 131	Phospholipase A2	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in pancreas and spleen and less abundantly in colon, thymus, placenta, small intestine, and prostate. {ECO:0000269|PubMed:10455175}.

Sequence

MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDAT
DWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLK
RNLDTYQKRLRFYWRPHCRGQTPGC

Sequence length

145

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glycerophospholipid metabolism	Acyl chain remodelling of PC
Ether lipid metabolism	Acyl chain remodelling of PS
Arachidonic acid metabolism	Acyl chain remodelling of PE
Linoleic acid metabolism	Acyl chain remodelling of PI
alpha-Linolenic acid metabolism	Acyl chain remodelling of PG
Metabolic pathways	Synthesis of PA
Ras signaling pathway
Vascular smooth muscle contraction
Pancreatic secretion
Fat digestion and absorption

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CROHN'S DISEASE	—	GWAS catalog	32581322	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	32581322	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (25)
Adenocarcinoma	Adenocarcinoma	BEFREE	18212756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23349189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15670148	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	17901411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23349189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24508801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	10094942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	16002569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	16002569, 19365107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18212756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23349189, 26338298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23349189, 26338298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	23349189, 26338298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	17578498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	27293319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	27293319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24508801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24692702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18212756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37305390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	36518097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	17578498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24508801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35844514, 37210507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34539641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
PLA2G2E	[]	15	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PS","Acyl chain remodelling of PE"]	[]
PLA2G1B	[]	15	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PS","Acyl chain remodelling of PE"]	[]
PLA2G5	[]	15	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PS","Acyl chain remodelling of PE"]	[]
PLA2G2F	[]	15	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PS","Acyl chain remodelling of PE"]	[]
PLA2G12A	[]	15	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PS","Acyl chain remodelling of PE"]	[]

PLA2G2D (phospholipase A2 group IID)

Bookmark This Gene