Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	64600
Gene name	Phospholipase A2 group IIF
Gene symbol	PLA2G2F
Synonyms (NCBI Gene)	GIIFsPLA2sPLA2-IIF
Chromosome	1
Chromosome location	1p36.12

77 Show/Hide all (77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT455412	hsa-miR-4428	PAR-CLIP	23592263
MIRT455411	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT455410	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT455409	hsa-miR-548ag	PAR-CLIP	23592263
MIRT455408	hsa-miR-548ai	PAR-CLIP	23592263
MIRT455407	hsa-miR-548ba	PAR-CLIP	23592263
MIRT455406	hsa-miR-570-5p	PAR-CLIP	23592263
MIRT455405	hsa-miR-18a-5p	PAR-CLIP	23592263
MIRT455404	hsa-miR-18b-5p	PAR-CLIP	23592263
MIRT455403	hsa-miR-4735-3p	PAR-CLIP	23592263
MIRT455402	hsa-miR-4476	PAR-CLIP	23592263
MIRT455401	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT455400	hsa-miR-7112-5p	PAR-CLIP	23592263
MIRT455399	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT455398	hsa-miR-4736	PAR-CLIP	23592263
MIRT455397	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT455412	hsa-miR-4428	PAR-CLIP	23592263
MIRT455411	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT455410	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT455409	hsa-miR-548ag	PAR-CLIP	23592263
MIRT455408	hsa-miR-548ai	PAR-CLIP	23592263
MIRT455407	hsa-miR-548ba	PAR-CLIP	23592263
MIRT455406	hsa-miR-570-5p	PAR-CLIP	23592263
MIRT455405	hsa-miR-18a-5p	PAR-CLIP	23592263
MIRT455404	hsa-miR-18b-5p	PAR-CLIP	23592263
MIRT455403	hsa-miR-4735-3p	PAR-CLIP	23592263
MIRT455402	hsa-miR-4476	PAR-CLIP	23592263
MIRT455401	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT455400	hsa-miR-7112-5p	PAR-CLIP	23592263
MIRT455399	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT455398	hsa-miR-4736	PAR-CLIP	23592263
MIRT455397	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT1238666	hsa-miR-1225-3p	CLIP-seq
MIRT1238667	hsa-miR-1233	CLIP-seq
MIRT1238668	hsa-miR-1237	CLIP-seq
MIRT1238669	hsa-miR-3160-3p	CLIP-seq
MIRT1238670	hsa-miR-3909	CLIP-seq
MIRT1238671	hsa-miR-3921	CLIP-seq
MIRT1238672	hsa-miR-4251	CLIP-seq
MIRT1238673	hsa-miR-4257	CLIP-seq
MIRT1238674	hsa-miR-4286	CLIP-seq
MIRT1238675	hsa-miR-4329	CLIP-seq
MIRT1238676	hsa-miR-4653-5p	CLIP-seq
MIRT1238677	hsa-miR-4663	CLIP-seq
MIRT1238678	hsa-miR-4666-5p	CLIP-seq
MIRT1238679	hsa-miR-4687-5p	CLIP-seq
MIRT1238680	hsa-miR-4727-5p	CLIP-seq
MIRT1238681	hsa-miR-4758-3p	CLIP-seq
MIRT1238682	hsa-miR-485-3p	CLIP-seq
MIRT2070223	hsa-miR-3157-5p	CLIP-seq
MIRT2070224	hsa-miR-3612	CLIP-seq
MIRT2070225	hsa-miR-4323	CLIP-seq
MIRT2070226	hsa-miR-4436b-5p	CLIP-seq
MIRT2070227	hsa-miR-4690-3p	CLIP-seq
MIRT2070228	hsa-miR-650	CLIP-seq
MIRT2297505	hsa-miR-1302	CLIP-seq
MIRT2297506	hsa-miR-34a	CLIP-seq
MIRT2297507	hsa-miR-34c-5p	CLIP-seq
MIRT2297508	hsa-miR-4298	CLIP-seq
MIRT2297509	hsa-miR-4302	CLIP-seq
MIRT2297510	hsa-miR-449a	CLIP-seq
MIRT2297511	hsa-miR-449b	CLIP-seq
MIRT2297512	hsa-miR-4651	CLIP-seq
MIRT2297513	hsa-miR-485-5p	CLIP-seq
MIRT2297514	hsa-miR-608	CLIP-seq
MIRT2392586	hsa-miR-1254	CLIP-seq
MIRT2392587	hsa-miR-3116	CLIP-seq
MIRT2070224	hsa-miR-3612	CLIP-seq
MIRT2392588	hsa-miR-4283	CLIP-seq
MIRT2392589	hsa-miR-4489	CLIP-seq
MIRT2392590	hsa-miR-4505	CLIP-seq
MIRT2392591	hsa-miR-4731-5p	CLIP-seq
MIRT2070228	hsa-miR-650	CLIP-seq
MIRT2594858	hsa-miR-3663-5p	CLIP-seq
MIRT2594859	hsa-miR-4281	CLIP-seq
MIRT2594858	hsa-miR-3663-5p	CLIP-seq
MIRT2594859	hsa-miR-4281	CLIP-seq

33 Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0004623	Function	Phospholipase A2 activity	IEA
GO:0004623	Function	Phospholipase A2 activity	NAS	11112443
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005543	Function	Phospholipid binding	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	11112443
GO:0005576	Component	Extracellular region	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019369	Process	Arachidonate metabolic process	IEA
GO:0036148	Process	Phosphatidylglycerol acyl-chain remodeling	IDA	11112443
GO:0036150	Process	Phosphatidylserine acyl-chain remodeling	IDA	11112443
GO:0036151	Process	Phosphatidylcholine acyl-chain remodeling	IDA	11112443
GO:0036152	Process	Phosphatidylethanolamine acyl-chain remodeling	IDA	11112443
GO:0036152	Process	Phosphatidylethanolamine acyl-chain remodeling	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IBA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0046470	Process	Phosphatidylcholine metabolic process	IBA
GO:0046471	Process	Phosphatidylglycerol metabolic process	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IBA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IDA	11112443
GO:0050482	Process	Arachidonate secretion	IEA

MIM	HGNC	e!Ensembl
616793	30040	ENSG00000158786

Q9BZM2

Protein name

Group IIF secretory phospholipase A2 (GIIF sPLA2) (sPLA2-IIF) (EC 3.1.1.4) (Phosphatidylcholine 2-acylhydrolase 2F)

Protein function

Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids. Hydrolyzes the ester bond of the fatty acyl group attached at the sn-2 position of phospholipids (phospholipase A2 activity), the catalytic efficien

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00068	Phospholip_A2_1	22 → 131	Phospholipase A2	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in placenta, testis, thymus and at lower levels in heart, kidney, liver and prostate (PubMed:11112443). Highly expressed in rheumatoid arthritic tissues, including synovial lining cells in the intima, capillary

Sequence

MKKFFTVAILAGSVLSTAHGSLLNLKAMVEAVTGRSAILSFVGYGCYCGLGGRGQPKDEV
DWCCHAHDCCYQELFDQGCHPYVDHYDHTIENNTEIVCSDLNKTECDKQTCMCDKNMVLC
LMNQTYREEYRGFLNVYCQGPTPNCSIYEPPPEEVTCSHQSPAPPAPP

Sequence length

168

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glycerophospholipid metabolism	Acyl chain remodelling of PC
Ether lipid metabolism	Acyl chain remodelling of PS
Arachidonic acid metabolism	Acyl chain remodelling of PE
Linoleic acid metabolism	Acyl chain remodelling of PI
alpha-Linolenic acid metabolism	Acyl chain remodelling of PG
Metabolic pathways	Synthesis of PA
Ras signaling pathway
Vascular smooth muscle contraction
Pancreatic secretion
Fat digestion and absorption

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (6)
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	37033223	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	37033223	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
PLA2G2D	[]	15	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PS","Acyl chain remodelling of PE"]	[]
PLA2G2E	[]	15	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PS","Acyl chain remodelling of PE"]	[]
PLA2G1B	[]	15	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PS","Acyl chain remodelling of PE"]	[]
PLA2G5	[]	15	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PS","Acyl chain remodelling of PE"]	[]
PLA2G12A	[]	15	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PS","Acyl chain remodelling of PE"]	[]

PLA2G2F (phospholipase A2 group IIF)

Bookmark This Gene