PLA2G1B (phospholipase A2 group IB)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 5319
Gene name Phospholipase A2 group IB
Gene symbol PLA2G1B
Synonyms (NCBI Gene)
PLA2PLA2APPLA2
Chromosome 12
Chromosome location 12q24.31
Summary This gene encodes a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. The encoded calcium-dependent enzyme catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to r
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
53 Show/Hide all (53)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002227 Process Innate immune response in mucosa IDA 12860195
GO:0002446 Process Neutrophil mediated immunity ISS 16005851
GO:0004623 Function Phospholipase A2 activity IDA 1918029
GO:0004623 Function Phospholipase A2 activity IEA
GO:0004623 Function Phospholipase A2 activity ISS 15528384
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
172410 9030 ENSG00000170890
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P04054
Protein name Phospholipase A2 (EC 3.1.1.4) (Group IB phospholipase A2) (Phosphatidylcholine 2-acylhydrolase 1B)
Protein function Secretory calcium-dependent phospholipase A2 that primarily targets dietary phospholipids in the intestinal tract (PubMed:10681567, PubMed:1420353, PubMed:17603006). Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of
PDB 3ELO , 6Q42
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00068 Phospholip_A2_1 24 → 138 Phospholipase A2 Domain
Tissue specificity TISSUE SPECIFICITY: Selectively expressed in pancreas, lung, liver and kidney. Also detected at lower levels in ovary and testis. {ECO:0000269|PubMed:10681567}.
Sequence 
MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV
DELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNC
DRNAAICFSKAPYNKAHKNLDTKKYCQS
Sequence length 148
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Glycerophospholipid metabolism Acyl chain remodelling of PC
Ether lipid metabolism Acyl chain remodelling of PS
Arachidonic acid metabolism Acyl chain remodelling of PE
Linoleic acid metabolism Acyl chain remodelling of PI
alpha-Linolenic acid metabolism Acyl chain remodelling of PG
Metabolic pathways Synthesis of PA
Ras signaling pathway  
Vascular smooth muscle contraction  
Pancreatic secretion  
Fat digestion and absorption  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER — GWAS catalog 34446935
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER — Disgenet —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS — Disgenet —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA — Disgenet —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE — GWAS catalog 34446935
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (250)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Coronary Syndrome Coronary Syndrome BEFREE 15840736, 8598867, 9093541
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 8117291
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of colon Adenocarcinoma Of Colon BEFREE 16458424
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Of Esophagus Esophageal Cancer BEFREE 21396625
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 30684134
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenoma of large intestine Colorectal adenoma BEFREE 9458096
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 10571045, 8640784, 8707313, 8912789, 9458096
★★★★★
★☆☆☆☆
Found in Text Mining only
Anemia, Sickle Cell Anemia BEFREE 27436223
★★★★★
★☆☆☆☆
Found in Text Mining only
Angina Unstable Angina pectoris Pubtator 10583927 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Angina, Unstable Intermediate coronary syndrome BEFREE 18848929
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
PLA2G2D 15 shared pathwaysGlycerophospholipid metabolism, Ether lipid metabolism, Arachidonic acid metabolism, Linoleic acid metabolism, alpha-Linolenic acid metabolism, Ras signaling pathway, Vascular smooth muscle contraction, Pancreatic secretion, Fat digestion and absorption, Acyl chain remodelling of PC, Acyl chain remodelling of PS, Acyl chain remodelling of PE +3 more Related via 15 shared pathways including Glycerophospholipid metabolism, Ether lipid metabolism. PLA2G2E 15 shared pathwaysGlycerophospholipid metabolism, Ether lipid metabolism, Arachidonic acid metabolism, Linoleic acid metabolism, alpha-Linolenic acid metabolism, Ras signaling pathway, Vascular smooth muscle contraction, Pancreatic secretion, Fat digestion and absorption, Acyl chain remodelling of PC, Acyl chain remodelling of PS, Acyl chain remodelling of PE +3 more Related via 15 shared pathways including Glycerophospholipid metabolism, Ether lipid metabolism. PLA2G5 15 shared pathwaysGlycerophospholipid metabolism, Ether lipid metabolism, Arachidonic acid metabolism, Linoleic acid metabolism, alpha-Linolenic acid metabolism, Ras signaling pathway, Vascular smooth muscle contraction, Pancreatic secretion, Fat digestion and absorption, Acyl chain remodelling of PC, Acyl chain remodelling of PS, Acyl chain remodelling of PE +3 more Related via 15 shared pathways including Glycerophospholipid metabolism, Ether lipid metabolism. PLA2G2F 15 shared pathwaysGlycerophospholipid metabolism, Ether lipid metabolism, Arachidonic acid metabolism, Linoleic acid metabolism, alpha-Linolenic acid metabolism, Ras signaling pathway, Vascular smooth muscle contraction, Pancreatic secretion, Fat digestion and absorption, Acyl chain remodelling of PC, Acyl chain remodelling of PS, Acyl chain remodelling of PE +3 more Related via 15 shared pathways including Glycerophospholipid metabolism, Ether lipid metabolism. PLA2G12A 15 shared pathwaysGlycerophospholipid metabolism, Ether lipid metabolism, Arachidonic acid metabolism, Linoleic acid metabolism, alpha-Linolenic acid metabolism, Ras signaling pathway, Vascular smooth muscle contraction, Pancreatic secretion, Fat digestion and absorption, Acyl chain remodelling of PC, Acyl chain remodelling of PS, Acyl chain remodelling of PE +3 more Related via 15 shared pathways including Glycerophospholipid metabolism, Ether lipid metabolism.
Crohn disease Linked via 2 of 5 related genesPLA2G2D, PLA2G5 Inflammatory bowel disease Linked via 2 of 5 related genesPLA2G2D, PLA2G5 Obesity Linked via 2 of 5 related genesPLA2G2D, PLA2G2F Benign flecked retina Linked via 1 of 5 related genesPLA2G5 Psoriasis Linked via 1 of 5 related genesPLA2G5