Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	50487
Gene name	Phospholipase A2 group III
Gene symbol	PLA2G3
Synonyms (NCBI Gene)	GIII-SPLA2SPLA2IIIsPLA2-III
Chromosome	22
Chromosome location	22q12.2
Summary	This gene encodes a protein that belongs to the secreted phospholipase A2 family, whose members include the bee venom enzyme. The encoded enzyme functions in lipid metabolism and catalyzes the calcium-dependent hydrolysis of the sn-2 acyl bond of phosphol

48 Show/Hide all (48)

miRTarBase ID	miRNA	Experiments
MIRT1238683	hsa-let-7a	CLIP-seq
MIRT1238684	hsa-let-7b	CLIP-seq
MIRT1238685	hsa-let-7c	CLIP-seq
MIRT1238686	hsa-let-7d	CLIP-seq
MIRT1238687	hsa-let-7e	CLIP-seq
MIRT1238688	hsa-let-7f	CLIP-seq
MIRT1238689	hsa-let-7g	CLIP-seq
MIRT1238690	hsa-let-7i	CLIP-seq
MIRT1238691	hsa-miR-202	CLIP-seq
MIRT1238692	hsa-miR-3065-5p	CLIP-seq
MIRT1238693	hsa-miR-376c	CLIP-seq
MIRT1238694	hsa-miR-3929	CLIP-seq
MIRT1238695	hsa-miR-4419b	CLIP-seq
MIRT1238696	hsa-miR-4458	CLIP-seq
MIRT1238697	hsa-miR-4478	CLIP-seq
MIRT1238698	hsa-miR-4500	CLIP-seq
MIRT1238699	hsa-miR-485-3p	CLIP-seq
MIRT1238700	hsa-miR-485-5p	CLIP-seq
MIRT1238701	hsa-miR-583	CLIP-seq
MIRT1238702	hsa-miR-592	CLIP-seq
MIRT1238703	hsa-miR-597	CLIP-seq
MIRT1238704	hsa-miR-599	CLIP-seq
MIRT1238705	hsa-miR-98	CLIP-seq
MIRT2070229	hsa-miR-1224-3p	CLIP-seq
MIRT2070230	hsa-miR-1260	CLIP-seq
MIRT2070231	hsa-miR-1260b	CLIP-seq
MIRT2070232	hsa-miR-1280	CLIP-seq
MIRT2070233	hsa-miR-188-3p	CLIP-seq
MIRT2070234	hsa-miR-1972	CLIP-seq
MIRT2070235	hsa-miR-3156-3p	CLIP-seq
MIRT2070236	hsa-miR-4650-5p	CLIP-seq
MIRT2070237	hsa-miR-4687-5p	CLIP-seq
MIRT2070238	hsa-miR-4717-5p	CLIP-seq
MIRT2070239	hsa-miR-4727-5p	CLIP-seq
MIRT2070240	hsa-miR-4769-3p	CLIP-seq
MIRT2070241	hsa-miR-4777-3p	CLIP-seq
MIRT2070242	hsa-miR-515-5p	CLIP-seq
MIRT2297515	hsa-miR-1324	CLIP-seq
MIRT2297516	hsa-miR-2355-5p	CLIP-seq
MIRT2297517	hsa-miR-3679-3p	CLIP-seq
MIRT2297518	hsa-miR-4320	CLIP-seq
MIRT2297519	hsa-miR-4652-3p	CLIP-seq
MIRT2456596	hsa-miR-3690	CLIP-seq
MIRT2456597	hsa-miR-4254	CLIP-seq
MIRT2070242	hsa-miR-515-5p	CLIP-seq
MIRT2456596	hsa-miR-3690	CLIP-seq
MIRT2456597	hsa-miR-4254	CLIP-seq
MIRT2070242	hsa-miR-515-5p	CLIP-seq

63 Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001675	Process	Acrosome assembly	IEA
GO:0002532	Process	Production of molecular mediator involved in inflammatory response	IEA
GO:0004620	Function	Phospholipase activity	IEA
GO:0004623	Function	Phospholipase A2 activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	TAS	10713052
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005814	Component	Centriole	IDA	20393563
GO:0005814	Component	Centriole	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	TAS	10713052
GO:0006658	Process	Phosphatidylserine metabolic process	IDA	28947740
GO:0007288	Process	Sperm axoneme assembly	IEA
GO:0010629	Process	Negative regulation of gene expression	IDA	26637123
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IDA	18801741
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IMP	17868035
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019372	Process	Lipoxygenase pathway	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0031394	Process	Positive regulation of prostaglandin biosynthetic process	IDA	23624557
GO:0031394	Process	Positive regulation of prostaglandin biosynthetic process	IEA
GO:0032308	Process	Positive regulation of prostaglandin secretion	IEA
GO:0034374	Process	Low-density lipoprotein particle remodeling	IDA	18801741
GO:0034375	Process	High-density lipoprotein particle remodeling	IDA	18801741
GO:0042116	Process	Macrophage activation	IEA
GO:0043303	Process	Mast cell degranulation	IEA
GO:0043303	Process	Mast cell degranulation	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IMP	17868035
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0046337	Process	Phosphatidylethanolamine metabolic process	IDA	28947740
GO:0046470	Process	Phosphatidylcholine metabolic process	IDA	28947740
GO:0046470	Process	Phosphatidylcholine metabolic process	IEA
GO:0046470	Process	Phosphatidylcholine metabolic process	IEA
GO:0046471	Process	Phosphatidylglycerol metabolic process	IDA	28947740
GO:0046473	Process	Phosphatidic acid metabolic process	IDA	28947740
GO:0046488	Process	Phosphatidylinositol metabolic process	IDA	28947740
GO:0046872	Function	Metal ion binding	IEA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IDA	12522102, 18801741, 28947740
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IEA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	TAS	10713052
GO:0048468	Process	Cell development	IEA
GO:0048469	Process	Cell maturation	IEA
GO:0050482	Process	Arachidonate secretion	IEA
GO:0055037	Component	Recycling endosome	IDA	20393563
GO:0055037	Component	Recycling endosome	IEA
GO:0060271	Process	Cilium assembly	IEA
GO:0060271	Process	Cilium assembly	IMP	20393563
GO:0060376	Process	Positive regulation of mast cell differentiation	IEA
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IEA
GO:1900222	Process	Negative regulation of amyloid-beta clearance	IEA
GO:1903595	Process	Positive regulation of histamine secretion by mast cell	IDA	23624557
GO:1903595	Process	Positive regulation of histamine secretion by mast cell	IEA
GO:2001135	Process	Regulation of endocytic recycling	IMP	20393563

MIM	HGNC	e!Ensembl
611651	17934	ENSG00000100078

Q9NZ20

Protein name

Group 3 secretory phospholipase A2 (EC 3.1.1.4) (Group III secretory phospholipase A2) (GIII sPLA2) (sPLA2-III) (Phosphatidylcholine 2-acylhydrolase 3)

Protein function

Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids. Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids without apparent head group selectivity (PubMed:1252210

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05826	Phospholip_A2_2	152 → 248	Phospholipase A2	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in kidney, heart, liver, and skeletal muscle. Also present in placenta and peripheral blood leukocytes. Not detected in colon, thymus, spleen and small intestine. In lung, expressed in bronchial epithelial cells and alveolar

Sequence

MGVQAGLFGMLGFLGVALGGSPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHA
RWDAHRRLQSCSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRA
LEESPAGARKKRAAGQSGVPGGGHQREKRGWTMPGTLWCGVGDSAGNSSELGVFQGPDLC
CREHDRCPQNISPLQYNYGIRNYRFHTISHCDCDTRFQQCLQNQHDSISDIVGVAFFNVL
EIPCFVLEEQEACVAWYWWGGCRMYGTVPLARLQPRTFYNASWSSRATSPTPSSRSPAPP
KPRQKQHLRKGPPHQKGSKRPSKANTTALQDPMVSPRLDVAPTGLQGPQGGLKPQGARWV
CRSFRRHLDQCEHQIGPREIEFQLLNSAQEPLFHCNCTRRLARFLRLHSPPEVTNMLWEL
LGTTCFKLAPPLDCVEGKNCSRDPRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSEPL
RGPMSFYNQCLQLTQAARRPDRQQKSWSQ

Sequence length

509

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glycerophospholipid metabolism	Acyl chain remodelling of PC
Ether lipid metabolism	Acyl chain remodelling of PE
Arachidonic acid metabolism	Acyl chain remodelling of PG
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Vascular smooth muscle contraction
Pancreatic secretion
Fat digestion and absorption

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HYPOTHYROIDISM	—	GWAS catalog	41238958	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (11)
Adenocarcinoma	Adenocarcinoma	BEFREE	18212756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	18801741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18212756, 28947740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	18212756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20042636, 25964585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18212756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15863501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18212756, 28947740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29377892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	21211798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15863501		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
PLA2G2D	[]	12	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PE","Acyl chain remodelling of PG"]	[]
PLA2G2E	[]	12	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PE","Acyl chain remodelling of PG"]	[]
PLA2G1B	[]	12	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PE","Acyl chain remodelling of PG"]	[]
PLA2G5	[]	12	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PE","Acyl chain remodelling of PG"]	[]
PLA2G2F	[]	12	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PE","Acyl chain remodelling of PG"]	[]

PLA2G3 (phospholipase A2 group III)

Bookmark This Gene