ACSL5 (acyl-CoA synthetase long chain family member 5)

Gene

• Entrez ID: 51703
• Gene name: Acyl-CoA synthetase long chain family member 5
• Gene symbol: ACSL5
• Synonyms (NCBI Gene): ACS2, ACS5, DIAR13, FACL5
• Chromosome: 10
• Chromosome location: 10q25.2
• Summary: The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019161	hsa-miR-335-5p	Microarray	18185580
MIRT022047	hsa-miR-128-3p	Microarray	17612493
MIRT023184	hsa-miR-124-3p	Microarray	18668037
MIRT763562	hsa-miR-122	CLIP-seq
MIRT763563	hsa-miR-1229	CLIP-seq
MIRT763564	hsa-miR-1273e	CLIP-seq
MIRT763565	hsa-miR-148a	CLIP-seq
MIRT763566	hsa-miR-148b	CLIP-seq
MIRT763567	hsa-miR-152	CLIP-seq
MIRT763568	hsa-miR-342-3p	CLIP-seq
MIRT763569	hsa-miR-3915	CLIP-seq
MIRT763570	hsa-miR-3928	CLIP-seq
MIRT763571	hsa-miR-3935	CLIP-seq
MIRT763572	hsa-miR-3945	CLIP-seq
MIRT763573	hsa-miR-3978	CLIP-seq
MIRT763574	hsa-miR-4253	CLIP-seq
MIRT763575	hsa-miR-4265	CLIP-seq
MIRT763576	hsa-miR-4296	CLIP-seq
MIRT763577	hsa-miR-4322	CLIP-seq
MIRT763578	hsa-miR-4327	CLIP-seq
MIRT763579	hsa-miR-4417	CLIP-seq
MIRT763580	hsa-miR-4457	CLIP-seq
MIRT763581	hsa-miR-4477a	CLIP-seq
MIRT763582	hsa-miR-4519	CLIP-seq
MIRT763583	hsa-miR-4752	CLIP-seq
MIRT763584	hsa-miR-513b	CLIP-seq
MIRT763585	hsa-miR-570	CLIP-seq
MIRT763586	hsa-miR-204	CLIP-seq
MIRT763587	hsa-miR-211	CLIP-seq
MIRT763588	hsa-miR-4446-5p	CLIP-seq
MIRT763589	hsa-miR-4755-5p	CLIP-seq
MIRT763590	hsa-miR-548u	CLIP-seq
MIRT763591	hsa-miR-623	CLIP-seq
MIRT763569	hsa-miR-3915	CLIP-seq
MIRT763570	hsa-miR-3928	CLIP-seq
MIRT763573	hsa-miR-3978	CLIP-seq
MIRT763581	hsa-miR-4477a	CLIP-seq
MIRT1925055	hsa-miR-1197	CLIP-seq
MIRT763569	hsa-miR-3915	CLIP-seq
MIRT763570	hsa-miR-3928	CLIP-seq
MIRT763573	hsa-miR-3978	CLIP-seq
MIRT1925056	hsa-miR-4476	CLIP-seq
MIRT763581	hsa-miR-4477a	CLIP-seq
MIRT1925057	hsa-miR-4533	CLIP-seq
MIRT1925055	hsa-miR-1197	CLIP-seq
MIRT2166499	hsa-miR-15a	CLIP-seq
MIRT2166500	hsa-miR-15b	CLIP-seq
MIRT2166501	hsa-miR-16	CLIP-seq
MIRT2166502	hsa-miR-195	CLIP-seq
MIRT2166503	hsa-miR-2115	CLIP-seq
MIRT2166504	hsa-miR-214	CLIP-seq
MIRT2166505	hsa-miR-3185	CLIP-seq
MIRT2166506	hsa-miR-3619-5p	CLIP-seq
MIRT763569	hsa-miR-3915	CLIP-seq
MIRT763570	hsa-miR-3928	CLIP-seq
MIRT763573	hsa-miR-3978	CLIP-seq
MIRT2166507	hsa-miR-424	CLIP-seq
MIRT2166508	hsa-miR-4267	CLIP-seq
MIRT2166509	hsa-miR-4291	CLIP-seq
MIRT1925056	hsa-miR-4476	CLIP-seq
MIRT763581	hsa-miR-4477a	CLIP-seq
MIRT1925057	hsa-miR-4533	CLIP-seq
MIRT2166510	hsa-miR-497	CLIP-seq
MIRT2166511	hsa-miR-545	CLIP-seq
MIRT2166512	hsa-miR-548g	CLIP-seq
MIRT2166513	hsa-miR-761	CLIP-seq
MIRT2166514	hsa-miR-922	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001676	Process	Long-chain fatty acid metabolic process	IDA	17681178, 24269233
GO:0001676	Process	Long-chain fatty acid metabolic process	IEA
GO:0001676	Process	Long-chain fatty acid metabolic process	IMP	22633490
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IDA	17681178, 24269233
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IEA
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IMP	22633490
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	TAS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	17681178, 33191500
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	17681178, 24269233, 33191500
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IDA	24269233
GO:0005886	Component	Plasma membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0010747	Process	Positive regulation of long-chain fatty acid import across plasma membrane	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016874	Function	Ligase activity	IEA
GO:0035338	Process	Long-chain fatty-acyl-CoA biosynthetic process	IBA
GO:0035338	Process	Long-chain fatty-acyl-CoA biosynthetic process	TAS
GO:0047676	Function	Arachidonate-CoA ligase activity	IBA
GO:0047676	Function	Arachidonate-CoA ligase activity	IEA
GO:0047676	Function	Arachidonate-CoA ligase activity	ISS
GO:0090434	Function	Oleoyl-CoA ligase activity	IDA	33191500
GO:2001236	Process	Regulation of extrinsic apoptotic signaling pathway	IDA	17681178

Other IDs

• MIM: 605677
• HGNC: 16526
• e!Ensembl: ENSG00000197142

Protein

• UniProt ID: Q9ULC5
• Protein name: Long-chain-fatty-acid--CoA ligase 5 (EC 6.2.1.3) (Arachidonate--CoA ligase) (EC 6.2.1.15) (Long-chain acyl-CoA synthetase 5) (LACS 5)
• Protein function: Catalyzes the conversion of long-chain fatty acids to their active form acyl-CoAs for both synthesis of cellular lipids, and degradation via beta-oxidation (PubMed:17681178, PubMed:22633490, PubMed:24269233, PubMed:33191500). ACSL5 may activate
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00501	AMP-binding	81 → 548	AMP-binding enzyme	Family

• Sequence:

  MLFIFNFLFSPLPTPALICILTFGAAIFLWLITRPQPVLPLLDLNNQSVGIEGGARKGVS
  QKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGS
  CLLHKGYKSSPDQFVGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEAIVHIVNKADI
  AMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLG
  KEHFRKPVPPSPEDLSVICFTSGTTGDPKGAMITHQNIVSNAAAFLKCVEHAYEPTPDDV
  AISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYD
  KVQNEAKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGA
  APMSTSVMTFFRAAMGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVA
  DMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDR
  KKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKL
  GVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLK
  AKRGELSKYFRTQIDSLYEHIQD

• Sequence length: 683

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Diarrhea 13	Pathogenic	rs1336100636	RCV003224825	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	29566413, 30340765		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	10502316		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	16110457, 24770931, 28153554		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	16241998		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	33523907	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anaplasia	Anaplasia	BEFREE	16241998		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	31053784		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	31053784	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28498416		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23348389		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	15809837		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16110457, 28808653		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25782664	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28808653, 32155177	Stimulate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30340765		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	34943992	Associate	★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	14608540		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	23749645		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11127823		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11127823, 18806831		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	18806831		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	10502316		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	27171439	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	LHGDN	17761945		★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	34859867	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10502316		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24625834, 38350448	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22163040	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22163040		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28498416		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27171439		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18806831		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	36466837	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	31053784	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	27189022		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	27189022	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10502316		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29566413, 30340765		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16241998, 17681178, 18806831, 19903339, 22436383, 23749645, 28122360		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	27515448		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27515448	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30712446	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	38167332	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	38167332	Associate	★☆☆☆☆ Found in Text Mining only
Refractory anaemia with excess blasts	Myelodysplastic syndrome	BEFREE	10502316		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	20470896		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28122360	Associate	★☆☆☆☆ Found in Text Mining only