Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	2180
Gene name	Acyl-CoA synthetase long chain family member 1
Gene symbol	ACSL1
Synonyms (NCBI Gene)	ACS1FACL1FACL2LACSLACS1LACS2
Chromosome	4
Chromosome location	4q35.1
Summary	The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty

336

Show/Hide all (336)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017213	hsa-miR-335-5p	Microarray	18185580
MIRT025381	hsa-miR-34a-5p	Reporter assay;Proteomics	21566225
MIRT025381	hsa-miR-34a-5p	Proteomics	21566225
MIRT025381	hsa-miR-34a-5p	Proteomics	21566225
MIRT025381	hsa-miR-34a-5p	Proteomics	21566225
MIRT025381	hsa-miR-34a-5p	Proteomics	21566225
MIRT026287	hsa-miR-192-5p	Microarray	19074876
MIRT032285	hsa-let-7b-5p	Proteomics	18668040
MIRT045814	hsa-miR-191-5p	CLASH	23622248
MIRT038888	hsa-miR-93-3p	CLASH	23622248
MIRT054854	hsa-miR-205-5p	Luciferase reporter assayqRT-PCRWestern blot	24462768
MIRT441290	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT441288	hsa-miR-154-5p	HITS-CLIP	24374217
MIRT441289	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT441290	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT441288	hsa-miR-154-5p	HITS-CLIP	24374217
MIRT441289	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT735216	hsa-miR-16-5p	Luciferase reporter assayWestern blottingqRT-PCR	32143184
MIRT735217	hsa-miR-30b-5p	Luciferase reporter assayWestern blottingqRT-PCR	32143184
MIRT735218	hsa-miR-30c-5p	Luciferase reporter assayWestern blottingqRT-PCR	32143184
MIRT763409	hsa-miR-1179	CLIP-seq
MIRT763410	hsa-miR-1227	CLIP-seq
MIRT763411	hsa-miR-1238	CLIP-seq
MIRT763412	hsa-miR-124	CLIP-seq
MIRT763413	hsa-miR-1251	CLIP-seq
MIRT763414	hsa-miR-1253	CLIP-seq
MIRT763415	hsa-miR-130a	CLIP-seq
MIRT763416	hsa-miR-130b	CLIP-seq
MIRT763417	hsa-miR-1323	CLIP-seq
MIRT763418	hsa-miR-134	CLIP-seq
MIRT763419	hsa-miR-181a	CLIP-seq
MIRT763420	hsa-miR-181b	CLIP-seq
MIRT763421	hsa-miR-181c	CLIP-seq
MIRT763422	hsa-miR-181d	CLIP-seq
MIRT763423	hsa-miR-205	CLIP-seq
MIRT763424	hsa-miR-2116	CLIP-seq
MIRT763425	hsa-miR-2117	CLIP-seq
MIRT763426	hsa-miR-214	CLIP-seq
MIRT763427	hsa-miR-2682	CLIP-seq
MIRT763428	hsa-miR-301a	CLIP-seq
MIRT763429	hsa-miR-301b	CLIP-seq
MIRT763430	hsa-miR-3118	CLIP-seq
MIRT763431	hsa-miR-3124-3p	CLIP-seq
MIRT763432	hsa-miR-3160-5p	CLIP-seq
MIRT763433	hsa-miR-337-3p	CLIP-seq
MIRT763434	hsa-miR-34a	CLIP-seq
MIRT763435	hsa-miR-34c-5p	CLIP-seq
MIRT763436	hsa-miR-3619-5p	CLIP-seq
MIRT763437	hsa-miR-3666	CLIP-seq
MIRT763438	hsa-miR-3714	CLIP-seq
MIRT763439	hsa-miR-3910	CLIP-seq
MIRT763440	hsa-miR-3921	CLIP-seq
MIRT763441	hsa-miR-4255	CLIP-seq
MIRT763442	hsa-miR-4262	CLIP-seq
MIRT763443	hsa-miR-4272	CLIP-seq
MIRT763444	hsa-miR-4273	CLIP-seq
MIRT763445	hsa-miR-4291	CLIP-seq
MIRT763446	hsa-miR-4295	CLIP-seq
MIRT763447	hsa-miR-4303	CLIP-seq
MIRT763448	hsa-miR-4422	CLIP-seq
MIRT763449	hsa-miR-4434	CLIP-seq
MIRT763450	hsa-miR-4436a	CLIP-seq
MIRT763451	hsa-miR-4493	CLIP-seq
MIRT763452	hsa-miR-449a	CLIP-seq
MIRT763453	hsa-miR-449b	CLIP-seq
MIRT763454	hsa-miR-449c	CLIP-seq
MIRT763455	hsa-miR-4516	CLIP-seq
MIRT763456	hsa-miR-4529-5p	CLIP-seq
MIRT763457	hsa-miR-454	CLIP-seq
MIRT763458	hsa-miR-4653-5p	CLIP-seq
MIRT763459	hsa-miR-4659a-3p	CLIP-seq
MIRT763460	hsa-miR-4659b-3p	CLIP-seq
MIRT763461	hsa-miR-4671-3p	CLIP-seq
MIRT763462	hsa-miR-4677-5p	CLIP-seq
MIRT763463	hsa-miR-4698	CLIP-seq
MIRT763464	hsa-miR-4712-3p	CLIP-seq
MIRT763465	hsa-miR-4722-5p	CLIP-seq
MIRT763466	hsa-miR-4742-3p	CLIP-seq
MIRT763467	hsa-miR-4753-3p	CLIP-seq
MIRT763468	hsa-miR-4753-5p	CLIP-seq
MIRT763469	hsa-miR-4768-3p	CLIP-seq
MIRT763470	hsa-miR-506	CLIP-seq
MIRT763471	hsa-miR-543	CLIP-seq
MIRT763472	hsa-miR-548b-3p	CLIP-seq
MIRT763473	hsa-miR-548o	CLIP-seq
MIRT763474	hsa-miR-556-3p	CLIP-seq
MIRT763475	hsa-miR-630	CLIP-seq
MIRT763476	hsa-miR-642a	CLIP-seq
MIRT763477	hsa-miR-659	CLIP-seq
MIRT763478	hsa-miR-761	CLIP-seq
MIRT763479	hsa-miR-922	CLIP-seq
MIRT763480	hsa-miR-943	CLIP-seq
MIRT763419	hsa-miR-181a	CLIP-seq
MIRT763420	hsa-miR-181b	CLIP-seq
MIRT763421	hsa-miR-181c	CLIP-seq
MIRT763422	hsa-miR-181d	CLIP-seq
MIRT1924991	hsa-miR-2276	CLIP-seq
MIRT1924992	hsa-miR-3978	CLIP-seq
MIRT763442	hsa-miR-4262	CLIP-seq
MIRT763448	hsa-miR-4422	CLIP-seq
MIRT1924993	hsa-miR-4527	CLIP-seq
MIRT1924994	hsa-miR-4772-3p	CLIP-seq
MIRT763471	hsa-miR-543	CLIP-seq
MIRT763474	hsa-miR-556-3p	CLIP-seq
MIRT2166352	hsa-miR-103a	CLIP-seq
MIRT2166353	hsa-miR-105	CLIP-seq
MIRT2166354	hsa-miR-106a	CLIP-seq
MIRT2166355	hsa-miR-106b	CLIP-seq
MIRT2166356	hsa-miR-107	CLIP-seq
MIRT763409	hsa-miR-1179	CLIP-seq
MIRT2166357	hsa-miR-1202	CLIP-seq
MIRT763411	hsa-miR-1238	CLIP-seq
MIRT763412	hsa-miR-124	CLIP-seq
MIRT763413	hsa-miR-1251	CLIP-seq
MIRT763414	hsa-miR-1253	CLIP-seq
MIRT2166358	hsa-miR-1257	CLIP-seq
MIRT2166359	hsa-miR-1267	CLIP-seq
MIRT2166360	hsa-miR-1297	CLIP-seq
MIRT2166361	hsa-miR-1301	CLIP-seq
MIRT763415	hsa-miR-130a	CLIP-seq
MIRT763416	hsa-miR-130b	CLIP-seq
MIRT763417	hsa-miR-1323	CLIP-seq
MIRT763418	hsa-miR-134	CLIP-seq
MIRT2166362	hsa-miR-140-3p	CLIP-seq
MIRT2166363	hsa-miR-142-5p	CLIP-seq
MIRT2166364	hsa-miR-17	CLIP-seq
MIRT763419	hsa-miR-181a	CLIP-seq
MIRT763420	hsa-miR-181b	CLIP-seq
MIRT763421	hsa-miR-181c	CLIP-seq
MIRT763422	hsa-miR-181d	CLIP-seq
MIRT2166365	hsa-miR-186	CLIP-seq
MIRT2166366	hsa-miR-1915	CLIP-seq
MIRT2166367	hsa-miR-2053	CLIP-seq
MIRT2166368	hsa-miR-20a	CLIP-seq
MIRT2166369	hsa-miR-20b	CLIP-seq
MIRT763424	hsa-miR-2116	CLIP-seq
MIRT763425	hsa-miR-2117	CLIP-seq
MIRT1924991	hsa-miR-2276	CLIP-seq
MIRT2166370	hsa-miR-2467-5p	CLIP-seq
MIRT763427	hsa-miR-2682	CLIP-seq
MIRT2166371	hsa-miR-26a	CLIP-seq
MIRT2166372	hsa-miR-26b	CLIP-seq
MIRT2166373	hsa-miR-298	CLIP-seq
MIRT763428	hsa-miR-301a	CLIP-seq
MIRT763429	hsa-miR-301b	CLIP-seq
MIRT763430	hsa-miR-3118	CLIP-seq
MIRT2166374	hsa-miR-3123	CLIP-seq
MIRT763431	hsa-miR-3124-3p	CLIP-seq
MIRT2166375	hsa-miR-3133	CLIP-seq
MIRT2166376	hsa-miR-3154	CLIP-seq
MIRT2166377	hsa-miR-3156-5p	CLIP-seq
MIRT2166378	hsa-miR-3162-3p	CLIP-seq
MIRT2166379	hsa-miR-3166	CLIP-seq
MIRT2166380	hsa-miR-3199	CLIP-seq
MIRT2166381	hsa-miR-326	CLIP-seq
MIRT2166382	hsa-miR-330-5p	CLIP-seq
MIRT763434	hsa-miR-34a	CLIP-seq
MIRT763435	hsa-miR-34c-5p	CLIP-seq
MIRT2166383	hsa-miR-3545-3p	CLIP-seq
MIRT2166384	hsa-miR-3609	CLIP-seq
MIRT2166385	hsa-miR-3646	CLIP-seq
MIRT2166386	hsa-miR-3663-3p	CLIP-seq
MIRT2166387	hsa-miR-3663-5p	CLIP-seq
MIRT763437	hsa-miR-3666	CLIP-seq
MIRT2166388	hsa-miR-3667-3p	CLIP-seq
MIRT2166389	hsa-miR-3688-5p	CLIP-seq
MIRT763438	hsa-miR-3714	CLIP-seq
MIRT2166390	hsa-miR-376a	CLIP-seq
MIRT2166391	hsa-miR-376b	CLIP-seq
MIRT763439	hsa-miR-3910	CLIP-seq
MIRT2166392	hsa-miR-3919	CLIP-seq
MIRT2166393	hsa-miR-3925-3p	CLIP-seq
MIRT2166394	hsa-miR-3941	CLIP-seq
MIRT2166395	hsa-miR-3972	CLIP-seq
MIRT2166396	hsa-miR-410	CLIP-seq
MIRT763441	hsa-miR-4255	CLIP-seq
MIRT763442	hsa-miR-4262	CLIP-seq
MIRT763444	hsa-miR-4273	CLIP-seq
MIRT2166397	hsa-miR-4287	CLIP-seq
MIRT763446	hsa-miR-4295	CLIP-seq
MIRT2166398	hsa-miR-4311	CLIP-seq
MIRT2166399	hsa-miR-4324	CLIP-seq
MIRT2166400	hsa-miR-4327	CLIP-seq
MIRT2166401	hsa-miR-4330	CLIP-seq
MIRT763448	hsa-miR-4422	CLIP-seq
MIRT2166402	hsa-miR-4432	CLIP-seq
MIRT763449	hsa-miR-4434	CLIP-seq
MIRT763450	hsa-miR-4436a	CLIP-seq
MIRT2166403	hsa-miR-4448	CLIP-seq
MIRT2166404	hsa-miR-4465	CLIP-seq
MIRT2166405	hsa-miR-4470	CLIP-seq
MIRT2166406	hsa-miR-4475	CLIP-seq
MIRT763452	hsa-miR-449a	CLIP-seq
MIRT763453	hsa-miR-449b	CLIP-seq
MIRT763454	hsa-miR-449c	CLIP-seq
MIRT2166407	hsa-miR-4502	CLIP-seq
MIRT2166408	hsa-miR-4504	CLIP-seq
MIRT2166409	hsa-miR-4511	CLIP-seq
MIRT2166410	hsa-miR-4515	CLIP-seq
MIRT763455	hsa-miR-4516	CLIP-seq
MIRT1924993	hsa-miR-4527	CLIP-seq
MIRT2166411	hsa-miR-4528	CLIP-seq
MIRT2166412	hsa-miR-4531	CLIP-seq
MIRT763457	hsa-miR-454	CLIP-seq
MIRT2166413	hsa-miR-4645-3p	CLIP-seq
MIRT2166414	hsa-miR-4652-5p	CLIP-seq
MIRT2166415	hsa-miR-4659a-5p	CLIP-seq
MIRT2166416	hsa-miR-4659b-5p	CLIP-seq
MIRT2166417	hsa-miR-466	CLIP-seq
MIRT2166418	hsa-miR-4670-3p	CLIP-seq
MIRT763461	hsa-miR-4671-3p	CLIP-seq
MIRT2166419	hsa-miR-4672	CLIP-seq
MIRT2166420	hsa-miR-4677-3p	CLIP-seq
MIRT763462	hsa-miR-4677-5p	CLIP-seq
MIRT2166421	hsa-miR-4679	CLIP-seq
MIRT2166422	hsa-miR-4685-3p	CLIP-seq
MIRT2166423	hsa-miR-4686	CLIP-seq
MIRT2166424	hsa-miR-4690-5p	CLIP-seq
MIRT2166425	hsa-miR-4693-3p	CLIP-seq
MIRT2166426	hsa-miR-4693-5p	CLIP-seq
MIRT2166427	hsa-miR-4704-3p	CLIP-seq
MIRT2166428	hsa-miR-4726-3p	CLIP-seq
MIRT2166429	hsa-miR-4727-5p	CLIP-seq
MIRT763467	hsa-miR-4753-3p	CLIP-seq
MIRT2166430	hsa-miR-4756-3p	CLIP-seq
MIRT2166431	hsa-miR-4761-5p	CLIP-seq
MIRT2166432	hsa-miR-4762-3p	CLIP-seq
MIRT2166433	hsa-miR-4769-3p	CLIP-seq
MIRT1924994	hsa-miR-4772-3p	CLIP-seq
MIRT2166434	hsa-miR-4776-3p	CLIP-seq
MIRT2166435	hsa-miR-4796-3p	CLIP-seq
MIRT2166436	hsa-miR-4797-5p	CLIP-seq
MIRT2166437	hsa-miR-5047	CLIP-seq
MIRT763470	hsa-miR-506	CLIP-seq
MIRT2166438	hsa-miR-515-5p	CLIP-seq
MIRT2166439	hsa-miR-516a-3p	CLIP-seq
MIRT2166440	hsa-miR-519d	CLIP-seq
MIRT763471	hsa-miR-543	CLIP-seq
MIRT2166441	hsa-miR-548ah	CLIP-seq
MIRT763472	hsa-miR-548b-3p	CLIP-seq
MIRT763473	hsa-miR-548o	CLIP-seq
MIRT2166442	hsa-miR-548p	CLIP-seq
MIRT2166443	hsa-miR-548u	CLIP-seq
MIRT763474	hsa-miR-556-3p	CLIP-seq
MIRT2166444	hsa-miR-562	CLIP-seq
MIRT2166445	hsa-miR-569	CLIP-seq
MIRT2166446	hsa-miR-633	CLIP-seq
MIRT2166447	hsa-miR-660	CLIP-seq
MIRT2166448	hsa-miR-766	CLIP-seq
MIRT2166449	hsa-miR-888	CLIP-seq
MIRT763479	hsa-miR-922	CLIP-seq
MIRT2166450	hsa-miR-93	CLIP-seq
MIRT763480	hsa-miR-943	CLIP-seq
MIRT2166451	hsa-miR-944	CLIP-seq
MIRT2166366	hsa-miR-1915	CLIP-seq
MIRT2443082	hsa-miR-4254	CLIP-seq
MIRT2443083	hsa-miR-4308	CLIP-seq
MIRT763449	hsa-miR-4434	CLIP-seq
MIRT763455	hsa-miR-4516	CLIP-seq
MIRT2166412	hsa-miR-4531	CLIP-seq
MIRT2166428	hsa-miR-4726-3p	CLIP-seq
MIRT2166366	hsa-miR-1915	CLIP-seq
MIRT2443082	hsa-miR-4254	CLIP-seq
MIRT2443083	hsa-miR-4308	CLIP-seq
MIRT763449	hsa-miR-4434	CLIP-seq
MIRT763455	hsa-miR-4516	CLIP-seq
MIRT2166412	hsa-miR-4531	CLIP-seq
MIRT2166428	hsa-miR-4726-3p	CLIP-seq
MIRT763414	hsa-miR-1253	CLIP-seq
MIRT2166358	hsa-miR-1257	CLIP-seq
MIRT763415	hsa-miR-130a	CLIP-seq
MIRT763416	hsa-miR-130b	CLIP-seq
MIRT2166362	hsa-miR-140-3p	CLIP-seq
MIRT2468904	hsa-miR-146b-3p	CLIP-seq
MIRT2468905	hsa-miR-19a	CLIP-seq
MIRT2468906	hsa-miR-19b	CLIP-seq
MIRT2468907	hsa-miR-2113	CLIP-seq
MIRT2468908	hsa-miR-218	CLIP-seq
MIRT763428	hsa-miR-301a	CLIP-seq
MIRT763429	hsa-miR-301b	CLIP-seq
MIRT2166376	hsa-miR-3154	CLIP-seq
MIRT2166380	hsa-miR-3199	CLIP-seq
MIRT2468909	hsa-miR-3591-5p	CLIP-seq
MIRT2468910	hsa-miR-3653	CLIP-seq
MIRT2468911	hsa-miR-3658	CLIP-seq
MIRT763437	hsa-miR-3666	CLIP-seq
MIRT763446	hsa-miR-4295	CLIP-seq
MIRT763449	hsa-miR-4434	CLIP-seq
MIRT2468912	hsa-miR-4473	CLIP-seq
MIRT2166410	hsa-miR-4515	CLIP-seq
MIRT763455	hsa-miR-4516	CLIP-seq
MIRT2166412	hsa-miR-4531	CLIP-seq
MIRT763457	hsa-miR-454	CLIP-seq
MIRT2166414	hsa-miR-4652-5p	CLIP-seq
MIRT2166418	hsa-miR-4670-3p	CLIP-seq
MIRT763461	hsa-miR-4671-3p	CLIP-seq
MIRT2166420	hsa-miR-4677-3p	CLIP-seq
MIRT2166421	hsa-miR-4679	CLIP-seq
MIRT2468913	hsa-miR-568	CLIP-seq
MIRT2468914	hsa-miR-636	CLIP-seq
MIRT2468915	hsa-miR-643	CLIP-seq
MIRT2166451	hsa-miR-944	CLIP-seq
MIRT2166353	hsa-miR-105	CLIP-seq
MIRT763414	hsa-miR-1253	CLIP-seq
MIRT763415	hsa-miR-130a	CLIP-seq
MIRT763416	hsa-miR-130b	CLIP-seq
MIRT2166362	hsa-miR-140-3p	CLIP-seq
MIRT2468904	hsa-miR-146b-3p	CLIP-seq
MIRT2468905	hsa-miR-19a	CLIP-seq
MIRT2468906	hsa-miR-19b	CLIP-seq
MIRT2468907	hsa-miR-2113	CLIP-seq
MIRT2468908	hsa-miR-218	CLIP-seq
MIRT2674315	hsa-miR-2277-3p	CLIP-seq
MIRT763428	hsa-miR-301a	CLIP-seq
MIRT763429	hsa-miR-301b	CLIP-seq
MIRT2166376	hsa-miR-3154	CLIP-seq
MIRT2166380	hsa-miR-3199	CLIP-seq
MIRT2468909	hsa-miR-3591-5p	CLIP-seq
MIRT2468910	hsa-miR-3653	CLIP-seq
MIRT2468911	hsa-miR-3658	CLIP-seq
MIRT763437	hsa-miR-3666	CLIP-seq
MIRT763446	hsa-miR-4295	CLIP-seq
MIRT763449	hsa-miR-4434	CLIP-seq
MIRT2468912	hsa-miR-4473	CLIP-seq
MIRT2166410	hsa-miR-4515	CLIP-seq
MIRT763455	hsa-miR-4516	CLIP-seq
MIRT2166412	hsa-miR-4531	CLIP-seq
MIRT763457	hsa-miR-454	CLIP-seq
MIRT2166414	hsa-miR-4652-5p	CLIP-seq
MIRT2166418	hsa-miR-4670-3p	CLIP-seq
MIRT763461	hsa-miR-4671-3p	CLIP-seq
MIRT2166427	hsa-miR-4704-3p	CLIP-seq
MIRT2468913	hsa-miR-568	CLIP-seq
MIRT2468914	hsa-miR-636	CLIP-seq
MIRT2468915	hsa-miR-643	CLIP-seq
MIRT2166451	hsa-miR-944	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
PPARA	Repression	17150915

Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000038	Process	Very long-chain fatty acid metabolic process	IBA
GO:0000038	Process	Very long-chain fatty acid metabolic process	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001676	Process	Long-chain fatty acid metabolic process	IBA
GO:0001676	Process	Long-chain fatty acid metabolic process	IDA	22022213, 24269233
GO:0001676	Process	Long-chain fatty acid metabolic process	IEA
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IDA	21242590, 22022213, 24269233
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IEA
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	TAS
GO:0005524	Function	ATP binding	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	22022213
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005777	Component	Peroxisome	IEA
GO:0005778	Component	Peroxisomal membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	24269233
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0008610	Process	Lipid biosynthetic process	IDA	21242590
GO:0008610	Process	Lipid biosynthetic process	IMP	25592151
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010747	Process	Positive regulation of long-chain fatty acid import across plasma membrane	IEA
GO:0010747	Process	Positive regulation of long-chain fatty acid import across plasma membrane	ISS	24503477
GO:0015908	Process	Fatty acid transport	IEA
GO:0015908	Process	Fatty acid transport	IMP	32521232
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016874	Function	Ligase activity	IEA
GO:0019432	Process	Triglyceride biosynthetic process	IEA
GO:0033211	Process	Adiponectin-activated signaling pathway	IEA
GO:0034201	Process	Response to oleic acid	IEA
GO:0035338	Process	Long-chain fatty-acyl-CoA biosynthetic process	IBA
GO:0035338	Process	Long-chain fatty-acyl-CoA biosynthetic process	IEA
GO:0035338	Process	Long-chain fatty-acyl-CoA biosynthetic process	TAS
GO:0042178	Process	Xenobiotic catabolic process	IEA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IEA
GO:0043651	Process	Linoleic acid metabolic process	IEA
GO:0044539	Process	Long-chain fatty acid import into cell	IDA	22022213
GO:0044539	Process	Long-chain fatty acid import into cell	IEA
GO:0044539	Process	Long-chain fatty acid import into cell	ISS
GO:0047676	Function	Arachidonate-CoA ligase activity	IBA
GO:0047676	Function	Arachidonate-CoA ligase activity	IEA
GO:0047676	Function	Arachidonate-CoA ligase activity	ISS
GO:0050197	Function	Phytanate-CoA ligase activity	IEA
GO:0050197	Function	Phytanate-CoA ligase activity	ISS
GO:0070251	Function	Pristanate-CoA ligase activity	IEA
GO:0090433	Function	Palmitoyl-CoA ligase activity	IEA
GO:0090434	Function	Oleoyl-CoA ligase activity	IEA
GO:0090434	Function	Oleoyl-CoA ligase activity	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	20620995

MIM	HGNC	e!Ensembl
152425	3569	ENSG00000151726

P33121

Protein name

Long-chain-fatty-acid--CoA ligase 1 (EC 6.2.1.3) (Acyl-CoA synthetase 1) (ACS1) (Arachidonate--CoA ligase) (EC 6.2.1.15) (Long-chain acyl-CoA synthetase 1) (LACS 1) (Long-chain acyl-CoA synthetase 2) (LACS 2) (Long-chain fatty acid-CoA ligase 2) (Palmitoy

Protein function

Catalyzes the conversion of long-chain fatty acids to their active form acyl-CoAs for both synthesis of cellular lipids, and degradation via beta-oxidation (PubMed:21242590, PubMed:22633490, PubMed:24269233). Preferentially uses palmitoleate, ol

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00501	AMP-binding	96 → 563	AMP-binding enzyme	Family
PF13193	AMP-binding_C	572 → 643	AMP-binding enzyme C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in liver, heart, skeletal muscle, kidney and erythroid cells, and to a lesser extent in brain, lung, placenta and pancreas. {ECO:0000269|PubMed:10548543}.

Sequence

MQAHELFRYFRMPELVDFRQYVRTLPTNTLMGFGAFAALTTFWYATRPKPLKPPCDLSMQ
SVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEW
LSYKQVAELSECIGSALIQKGFKTAPDQFIGIFAQNRPEWVIIEQGCFAYSMVIVPLYDT
LGNEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIVVMDAYGSELVERGQR
CGVEVTSMKAMEDLGRANRRKPKPPAPEDLAVICFTSGTTGNPKGAMVTHRNIVSDCSAF
VKATENTVNPCPDDTLISFLPLAHMFERVVECVMLCHGAKIGFFQGDIRLLMDDLKVLQP
TVFPVVPRLLNRMFDRIFGQANTTLKRWLLDFASKRKEAELRSGIIRNNSLWDRLIFHKV
QSSLGGRVRLMVTGAAPVSATVLTFLRAALGCQFYEGYGQTECTAGCCLTMPGDWTAGHV
GAPMPCNLIKLVDVEEMNYMAAEGEGEVCVKGPNVFQGYLKDPAKTAEALDKDGWLHTGD
IGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYMRSEPVAQVFVHGESLQAFLIAI
VVPDVETLCSWAQKRGFEGSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHP
ELFSIDNGLLTPTMKAKRPELRNYFRSQIDDLYSTIKV

Sequence length

698

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (25)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (60)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	39508514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaphylaxis	Anaphylaxis	Pubtator	19476020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	22308341, 26711138, 29104625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	22308341, 26711138, 29104625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	26711138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27171439, 28132807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27171439, 31581558, 33066575, 35739271, 38310106, 39362925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22022213, 34861383, 40500772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27171439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37608295	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37856813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	30615229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	23388545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27992526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28894242, 29464044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25749516, 27171439, 27992526, 28894242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31089396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	22308341, 23991914, 26711138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22308341, 23991914, 24665124, 26711138		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	26711138	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25368101, 34309093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37726199	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	22308341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23303383, 25368101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	28566273, 30054458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	23991914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	20176858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36661650	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	23749645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30596429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucose Metabolism Disorders	Glucose Metabolism Disorders	BEFREE	29027371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	36930661	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37005321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	16439103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17453718	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	20176858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	31488013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37596597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24462768, 25592151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	24462768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27171439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27171439, 28132807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	24462768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27171439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27992526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20176858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	20176858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	32218693, 36863716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23749645, 27171439, 31089396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	25661699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15168018, 25784542		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	20882379		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	37726199	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	31681299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	22308341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular hypertrophy	Ventricular hypertrophy	BEFREE	29622588		★★★★★ ★☆☆☆☆ Found in Text Mining only

ACSL1 (acyl-CoA synthetase long chain family member 1)