UBE2D2 (ubiquitin conjugating enzyme E2 D2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7322
• Gene name: Ubiquitin conjugating enzyme E2 D2
• Gene symbol: UBE2D2
• Synonyms (NCBI Gene): E2(17)KB2, PUBC1, UBC4, UBC4/5, UBCH4, UBCH5B
• Chromosome: 5
• Chromosome location: 5q31.2
• Summary: Regulated degradation of misfolded, damaged or short-lived proteins in eukaryotes occurs via the ubiquitin (Ub)-proteasome system (UPS). An integral part of the UPS system is the ubiquitination of target proteins and covalent linkage of Ub-containing prot

miRNA Show/Hide all (330)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020586	hsa-miR-155-5p	Proteomics	18668040
MIRT024527	hsa-miR-215-5p	Microarray	19074876
MIRT026243	hsa-miR-192-5p	Microarray	19074876
MIRT032280	hsa-let-7b-5p	Proteomics	18668040
MIRT047862	hsa-miR-30c-5p	CLASH	23622248
MIRT047680	hsa-miR-10a-5p	CLASH	23622248
MIRT553184	hsa-miR-376a-3p	PAR-CLIP	21572407
MIRT553183	hsa-miR-376b-3p	PAR-CLIP	21572407
MIRT553182	hsa-miR-551b-5p	PAR-CLIP	21572407
MIRT214787	hsa-miR-4694-3p	PAR-CLIP	21572407
MIRT214784	hsa-miR-4274	PAR-CLIP	21572407
MIRT095377	hsa-miR-105-5p	PAR-CLIP	21572407
MIRT095414	hsa-miR-7853-5p	PAR-CLIP	21572407
MIRT553181	hsa-miR-5093	PAR-CLIP	21572407
MIRT553180	hsa-miR-4437	PAR-CLIP	21572407
MIRT553179	hsa-miR-4674	PAR-CLIP	21572407
MIRT095379	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT095389	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT095395	hsa-miR-3666	PAR-CLIP	21572407
MIRT095394	hsa-miR-4295	PAR-CLIP	21572407
MIRT095380	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT095388	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT095378	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT095385	hsa-miR-548a-5p	PAR-CLIP	21572407
MIRT095399	hsa-miR-548ab	PAR-CLIP	21572407
MIRT095400	hsa-miR-548ad-5p	PAR-CLIP	21572407
MIRT095401	hsa-miR-548ae-5p	PAR-CLIP	21572407
MIRT095402	hsa-miR-548ak	PAR-CLIP	21572407
MIRT095403	hsa-miR-548am-5p	PAR-CLIP	21572407
MIRT095407	hsa-miR-548ap-5p	PAR-CLIP	21572407
MIRT095408	hsa-miR-548aq-5p	PAR-CLIP	21572407
MIRT095409	hsa-miR-548ar-5p	PAR-CLIP	21572407
MIRT095410	hsa-miR-548as-5p	PAR-CLIP	21572407
MIRT095411	hsa-miR-548au-5p	PAR-CLIP	21572407
MIRT095413	hsa-miR-548ay-5p	PAR-CLIP	21572407
MIRT095384	hsa-miR-548b-5p	PAR-CLIP	21572407
MIRT095415	hsa-miR-548bb-5p	PAR-CLIP	21572407
MIRT095386	hsa-miR-548c-5p	PAR-CLIP	21572407
MIRT095387	hsa-miR-548d-5p	PAR-CLIP	21572407
MIRT095391	hsa-miR-548h-5p	PAR-CLIP	21572407
MIRT095392	hsa-miR-548i	PAR-CLIP	21572407
MIRT095390	hsa-miR-548j-5p	PAR-CLIP	21572407
MIRT095398	hsa-miR-548o-5p	PAR-CLIP	21572407
MIRT095393	hsa-miR-548w	PAR-CLIP	21572407
MIRT095397	hsa-miR-548y	PAR-CLIP	21572407
MIRT095383	hsa-miR-559	PAR-CLIP	21572407
MIRT553178	hsa-miR-944	PAR-CLIP	21572407
MIRT095396	hsa-miR-3668	PAR-CLIP	21572407
MIRT553177	hsa-miR-7852-3p	PAR-CLIP	21572407
MIRT095404	hsa-miR-3973	PAR-CLIP	21572407
MIRT095405	hsa-miR-4671-3p	PAR-CLIP	21572407
MIRT553176	hsa-miR-4473	PAR-CLIP	21572407
MIRT553175	hsa-miR-3924	PAR-CLIP	21572407
MIRT095381	hsa-miR-518a-5p	PAR-CLIP	21572407
MIRT095382	hsa-miR-527	PAR-CLIP	21572407
MIRT553184	hsa-miR-376a-3p	PAR-CLIP	21572407
MIRT553183	hsa-miR-376b-3p	PAR-CLIP	21572407
MIRT553182	hsa-miR-551b-5p	PAR-CLIP	21572407
MIRT214787	hsa-miR-4694-3p	PAR-CLIP	21572407
MIRT214784	hsa-miR-4274	PAR-CLIP	21572407
MIRT095377	hsa-miR-105-5p	PAR-CLIP	21572407
MIRT095414	hsa-miR-7853-5p	PAR-CLIP	21572407
MIRT553181	hsa-miR-5093	PAR-CLIP	21572407
MIRT553180	hsa-miR-4437	PAR-CLIP	21572407
MIRT553179	hsa-miR-4674	PAR-CLIP	21572407
MIRT095379	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT095389	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT095395	hsa-miR-3666	PAR-CLIP	21572407
MIRT095394	hsa-miR-4295	PAR-CLIP	21572407
MIRT095380	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT095388	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT095378	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT095385	hsa-miR-548a-5p	PAR-CLIP	21572407
MIRT095399	hsa-miR-548ab	PAR-CLIP	21572407
MIRT095400	hsa-miR-548ad-5p	PAR-CLIP	21572407
MIRT095401	hsa-miR-548ae-5p	PAR-CLIP	21572407
MIRT095402	hsa-miR-548ak	PAR-CLIP	21572407
MIRT095403	hsa-miR-548am-5p	PAR-CLIP	21572407
MIRT095407	hsa-miR-548ap-5p	PAR-CLIP	21572407
MIRT095408	hsa-miR-548aq-5p	PAR-CLIP	21572407
MIRT095409	hsa-miR-548ar-5p	PAR-CLIP	21572407
MIRT095410	hsa-miR-548as-5p	PAR-CLIP	21572407
MIRT095411	hsa-miR-548au-5p	PAR-CLIP	21572407
MIRT095413	hsa-miR-548ay-5p	PAR-CLIP	21572407
MIRT095384	hsa-miR-548b-5p	PAR-CLIP	21572407
MIRT095415	hsa-miR-548bb-5p	PAR-CLIP	21572407
MIRT095386	hsa-miR-548c-5p	PAR-CLIP	21572407
MIRT095387	hsa-miR-548d-5p	PAR-CLIP	21572407
MIRT095391	hsa-miR-548h-5p	PAR-CLIP	21572407
MIRT095392	hsa-miR-548i	PAR-CLIP	21572407
MIRT095390	hsa-miR-548j-5p	PAR-CLIP	21572407
MIRT095398	hsa-miR-548o-5p	PAR-CLIP	21572407
MIRT095393	hsa-miR-548w	PAR-CLIP	21572407
MIRT095397	hsa-miR-548y	PAR-CLIP	21572407
MIRT095383	hsa-miR-559	PAR-CLIP	21572407
MIRT553178	hsa-miR-944	PAR-CLIP	21572407
MIRT095396	hsa-miR-3668	PAR-CLIP	21572407
MIRT553177	hsa-miR-7852-3p	PAR-CLIP	21572407
MIRT095404	hsa-miR-3973	PAR-CLIP	21572407
MIRT095405	hsa-miR-4671-3p	PAR-CLIP	21572407
MIRT553176	hsa-miR-4473	PAR-CLIP	21572407
MIRT553175	hsa-miR-3924	PAR-CLIP	21572407
MIRT095381	hsa-miR-518a-5p	PAR-CLIP	21572407
MIRT095382	hsa-miR-527	PAR-CLIP	21572407
MIRT1467161	hsa-miR-101	CLIP-seq
MIRT1467162	hsa-miR-1228	CLIP-seq
MIRT1467163	hsa-miR-1263	CLIP-seq
MIRT1467164	hsa-miR-1265	CLIP-seq
MIRT1467165	hsa-miR-1286	CLIP-seq
MIRT1467166	hsa-miR-130a	CLIP-seq
MIRT1467167	hsa-miR-130b	CLIP-seq
MIRT1467168	hsa-miR-144	CLIP-seq
MIRT1467169	hsa-miR-193a-5p	CLIP-seq
MIRT1467170	hsa-miR-19a	CLIP-seq
MIRT1467171	hsa-miR-19b	CLIP-seq
MIRT1467172	hsa-miR-208a	CLIP-seq
MIRT1467173	hsa-miR-208b	CLIP-seq
MIRT1467174	hsa-miR-299-3p	CLIP-seq
MIRT1467175	hsa-miR-301a	CLIP-seq
MIRT1467176	hsa-miR-301b	CLIP-seq
MIRT1467177	hsa-miR-30a	CLIP-seq
MIRT1467178	hsa-miR-30b	CLIP-seq
MIRT1467179	hsa-miR-30c	CLIP-seq
MIRT1467180	hsa-miR-30d	CLIP-seq
MIRT1467181	hsa-miR-30e	CLIP-seq
MIRT1467182	hsa-miR-3121-3p	CLIP-seq
MIRT1467183	hsa-miR-3154	CLIP-seq
MIRT1467184	hsa-miR-3200-3p	CLIP-seq
MIRT1467185	hsa-miR-342-3p	CLIP-seq
MIRT1467186	hsa-miR-3612	CLIP-seq
MIRT1467187	hsa-miR-3662	CLIP-seq
MIRT1467188	hsa-miR-3669	CLIP-seq
MIRT1467189	hsa-miR-3684	CLIP-seq
MIRT1467190	hsa-miR-3691-3p	CLIP-seq
MIRT1467191	hsa-miR-377	CLIP-seq
MIRT1467192	hsa-miR-409-3p	CLIP-seq
MIRT1467193	hsa-miR-4266	CLIP-seq
MIRT1467194	hsa-miR-4271	CLIP-seq
MIRT1467195	hsa-miR-4446-3p	CLIP-seq
MIRT1467196	hsa-miR-4448	CLIP-seq
MIRT1467197	hsa-miR-454	CLIP-seq
MIRT1467198	hsa-miR-4635	CLIP-seq
MIRT1467199	hsa-miR-4656	CLIP-seq
MIRT1467200	hsa-miR-4695-5p	CLIP-seq
MIRT1467201	hsa-miR-4718	CLIP-seq
MIRT1467202	hsa-miR-4722-5p	CLIP-seq
MIRT1467203	hsa-miR-4725-3p	CLIP-seq
MIRT1467204	hsa-miR-4764-5p	CLIP-seq
MIRT1467205	hsa-miR-4766-5p	CLIP-seq
MIRT1467206	hsa-miR-4779	CLIP-seq
MIRT1467207	hsa-miR-4781-3p	CLIP-seq
MIRT1467208	hsa-miR-4789-5p	CLIP-seq
MIRT1467209	hsa-miR-4803	CLIP-seq
MIRT1467210	hsa-miR-488	CLIP-seq
MIRT1467211	hsa-miR-5096	CLIP-seq
MIRT1467212	hsa-miR-520a-5p	CLIP-seq
MIRT1467213	hsa-miR-525-5p	CLIP-seq
MIRT1467214	hsa-miR-526b	CLIP-seq
MIRT1467215	hsa-miR-548ac	CLIP-seq
MIRT1467216	hsa-miR-548ae	CLIP-seq
MIRT1467217	hsa-miR-548aj	CLIP-seq
MIRT1467218	hsa-miR-548am	CLIP-seq
MIRT1467219	hsa-miR-548d-3p	CLIP-seq
MIRT1467220	hsa-miR-548h	CLIP-seq
MIRT1467221	hsa-miR-548j	CLIP-seq
MIRT1467222	hsa-miR-548k	CLIP-seq
MIRT1467223	hsa-miR-548x	CLIP-seq
MIRT1467224	hsa-miR-548z	CLIP-seq
MIRT1467225	hsa-miR-603	CLIP-seq
MIRT1467226	hsa-miR-650	CLIP-seq
MIRT1467227	hsa-miR-7	CLIP-seq
MIRT1467228	hsa-miR-942	CLIP-seq
MIRT1467229	hsa-miR-105	CLIP-seq
MIRT1467230	hsa-miR-147	CLIP-seq
MIRT1467169	hsa-miR-193a-5p	CLIP-seq
MIRT1467231	hsa-miR-216a	CLIP-seq
MIRT1467232	hsa-miR-216b	CLIP-seq
MIRT1467177	hsa-miR-30a	CLIP-seq
MIRT1467178	hsa-miR-30b	CLIP-seq
MIRT1467179	hsa-miR-30c	CLIP-seq
MIRT1467180	hsa-miR-30d	CLIP-seq
MIRT1467181	hsa-miR-30e	CLIP-seq
MIRT1467233	hsa-miR-329	CLIP-seq
MIRT1467234	hsa-miR-362-3p	CLIP-seq
MIRT1467235	hsa-miR-3908	CLIP-seq
MIRT1467236	hsa-miR-3942-3p	CLIP-seq
MIRT1467237	hsa-miR-3942-5p	CLIP-seq
MIRT1467238	hsa-miR-4282	CLIP-seq
MIRT1467239	hsa-miR-4305	CLIP-seq
MIRT1467240	hsa-miR-4668-3p	CLIP-seq
MIRT1467241	hsa-miR-4703-5p	CLIP-seq
MIRT1467242	hsa-miR-4705	CLIP-seq
MIRT1467201	hsa-miR-4718	CLIP-seq
MIRT1467243	hsa-miR-4731-3p	CLIP-seq
MIRT1467244	hsa-miR-4766-3p	CLIP-seq
MIRT1467208	hsa-miR-4789-5p	CLIP-seq
MIRT1467245	hsa-miR-4795-5p	CLIP-seq
MIRT1467246	hsa-miR-4801	CLIP-seq
MIRT1467247	hsa-miR-4804-3p	CLIP-seq
MIRT1467212	hsa-miR-520a-5p	CLIP-seq
MIRT1467213	hsa-miR-525-5p	CLIP-seq
MIRT1467222	hsa-miR-548k	CLIP-seq
MIRT1467248	hsa-miR-587	CLIP-seq
MIRT1467162	hsa-miR-1228	CLIP-seq
MIRT2140403	hsa-miR-2052	CLIP-seq
MIRT2140404	hsa-miR-2116	CLIP-seq
MIRT2140405	hsa-miR-3140-3p	CLIP-seq
MIRT1467184	hsa-miR-3200-3p	CLIP-seq
MIRT1467185	hsa-miR-342-3p	CLIP-seq
MIRT2140406	hsa-miR-365	CLIP-seq
MIRT1467192	hsa-miR-409-3p	CLIP-seq
MIRT2140407	hsa-miR-412	CLIP-seq
MIRT2140408	hsa-miR-452	CLIP-seq
MIRT1467198	hsa-miR-4635	CLIP-seq
MIRT2140409	hsa-miR-4676-3p	CLIP-seq
MIRT2140410	hsa-miR-4677-5p	CLIP-seq
MIRT1467210	hsa-miR-488	CLIP-seq
MIRT1467214	hsa-miR-526b	CLIP-seq
MIRT1467222	hsa-miR-548k	CLIP-seq
MIRT2140411	hsa-miR-892b	CLIP-seq
MIRT1467162	hsa-miR-1228	CLIP-seq
MIRT1467177	hsa-miR-30a	CLIP-seq
MIRT1467178	hsa-miR-30b	CLIP-seq
MIRT1467179	hsa-miR-30c	CLIP-seq
MIRT1467180	hsa-miR-30d	CLIP-seq
MIRT1467181	hsa-miR-30e	CLIP-seq
MIRT2361139	hsa-miR-3197	CLIP-seq
MIRT1467184	hsa-miR-3200-3p	CLIP-seq
MIRT1467185	hsa-miR-342-3p	CLIP-seq
MIRT2361140	hsa-miR-3646	CLIP-seq
MIRT2140406	hsa-miR-365	CLIP-seq
MIRT1467191	hsa-miR-377	CLIP-seq
MIRT1467192	hsa-miR-409-3p	CLIP-seq
MIRT1467193	hsa-miR-4266	CLIP-seq
MIRT1467194	hsa-miR-4271	CLIP-seq
MIRT1467200	hsa-miR-4695-5p	CLIP-seq
MIRT1467203	hsa-miR-4725-3p	CLIP-seq
MIRT1467206	hsa-miR-4779	CLIP-seq
MIRT1467211	hsa-miR-5096	CLIP-seq
MIRT1467225	hsa-miR-603	CLIP-seq
MIRT2140411	hsa-miR-892b	CLIP-seq
MIRT1467228	hsa-miR-942	CLIP-seq
MIRT1467168	hsa-miR-144	CLIP-seq
MIRT1467162	hsa-miR-1228	CLIP-seq
MIRT1467184	hsa-miR-3200-3p	CLIP-seq
MIRT1467186	hsa-miR-3612	CLIP-seq
MIRT1467192	hsa-miR-409-3p	CLIP-seq
MIRT1467193	hsa-miR-4266	CLIP-seq
MIRT1467198	hsa-miR-4635	CLIP-seq
MIRT1467200	hsa-miR-4695-5p	CLIP-seq
MIRT1467206	hsa-miR-4779	CLIP-seq
MIRT1467207	hsa-miR-4781-3p	CLIP-seq
MIRT1467210	hsa-miR-488	CLIP-seq
MIRT1467212	hsa-miR-520a-5p	CLIP-seq
MIRT1467213	hsa-miR-525-5p	CLIP-seq
MIRT1467214	hsa-miR-526b	CLIP-seq
MIRT1467222	hsa-miR-548k	CLIP-seq
MIRT1467225	hsa-miR-603	CLIP-seq
MIRT1467226	hsa-miR-650	CLIP-seq
MIRT1467228	hsa-miR-942	CLIP-seq
MIRT1467162	hsa-miR-1228	CLIP-seq
MIRT2654925	hsa-miR-1246	CLIP-seq
MIRT1467164	hsa-miR-1265	CLIP-seq
MIRT1467165	hsa-miR-1286	CLIP-seq
MIRT2140403	hsa-miR-2052	CLIP-seq
MIRT1467172	hsa-miR-208a	CLIP-seq
MIRT1467173	hsa-miR-208b	CLIP-seq
MIRT2140404	hsa-miR-2116	CLIP-seq
MIRT1467231	hsa-miR-216a	CLIP-seq
MIRT1467232	hsa-miR-216b	CLIP-seq
MIRT2654926	hsa-miR-224	CLIP-seq
MIRT1467174	hsa-miR-299-3p	CLIP-seq
MIRT2654927	hsa-miR-3132	CLIP-seq
MIRT2140405	hsa-miR-3140-3p	CLIP-seq
MIRT1467184	hsa-miR-3200-3p	CLIP-seq
MIRT2654928	hsa-miR-337-3p	CLIP-seq
MIRT2140406	hsa-miR-365	CLIP-seq
MIRT1467187	hsa-miR-3662	CLIP-seq
MIRT1467189	hsa-miR-3684	CLIP-seq
MIRT1467191	hsa-miR-377	CLIP-seq
MIRT2140407	hsa-miR-412	CLIP-seq
MIRT2654929	hsa-miR-4320	CLIP-seq
MIRT2654930	hsa-miR-4436b-5p	CLIP-seq
MIRT1467196	hsa-miR-4448	CLIP-seq
MIRT2654931	hsa-miR-4451	CLIP-seq
MIRT2654932	hsa-miR-4481	CLIP-seq
MIRT2140408	hsa-miR-452	CLIP-seq
MIRT2140409	hsa-miR-4676-3p	CLIP-seq
MIRT2140410	hsa-miR-4677-5p	CLIP-seq
MIRT1467202	hsa-miR-4722-5p	CLIP-seq
MIRT2654933	hsa-miR-4745-5p	CLIP-seq
MIRT2654934	hsa-miR-4758-5p	CLIP-seq
MIRT1467204	hsa-miR-4764-5p	CLIP-seq
MIRT1467211	hsa-miR-5096	CLIP-seq
MIRT2654935	hsa-miR-522	CLIP-seq
MIRT2654936	hsa-miR-548c-3p	CLIP-seq
MIRT2140411	hsa-miR-892b	CLIP-seq
MIRT1467162	hsa-miR-1228	CLIP-seq
MIRT1467162	hsa-miR-1228	CLIP-seq
MIRT2654925	hsa-miR-1246	CLIP-seq
MIRT1467164	hsa-miR-1265	CLIP-seq
MIRT1467165	hsa-miR-1286	CLIP-seq
MIRT2140403	hsa-miR-2052	CLIP-seq
MIRT2140404	hsa-miR-2116	CLIP-seq
MIRT1467231	hsa-miR-216a	CLIP-seq
MIRT1467232	hsa-miR-216b	CLIP-seq
MIRT2654926	hsa-miR-224	CLIP-seq
MIRT1467174	hsa-miR-299-3p	CLIP-seq
MIRT2694605	hsa-miR-3124-3p	CLIP-seq
MIRT2654927	hsa-miR-3132	CLIP-seq
MIRT2140405	hsa-miR-3140-3p	CLIP-seq
MIRT1467184	hsa-miR-3200-3p	CLIP-seq
MIRT2654928	hsa-miR-337-3p	CLIP-seq
MIRT1467187	hsa-miR-3662	CLIP-seq
MIRT1467189	hsa-miR-3684	CLIP-seq
MIRT2140407	hsa-miR-412	CLIP-seq
MIRT2654929	hsa-miR-4320	CLIP-seq
MIRT2654930	hsa-miR-4436b-5p	CLIP-seq
MIRT2654931	hsa-miR-4451	CLIP-seq
MIRT2654932	hsa-miR-4481	CLIP-seq
MIRT2140408	hsa-miR-452	CLIP-seq
MIRT2140409	hsa-miR-4676-3p	CLIP-seq
MIRT2140410	hsa-miR-4677-5p	CLIP-seq
MIRT1467202	hsa-miR-4722-5p	CLIP-seq
MIRT2654933	hsa-miR-4745-5p	CLIP-seq
MIRT2654934	hsa-miR-4758-5p	CLIP-seq
MIRT1467204	hsa-miR-4764-5p	CLIP-seq
MIRT1467211	hsa-miR-5096	CLIP-seq
MIRT2654935	hsa-miR-522	CLIP-seq
MIRT2654936	hsa-miR-548c-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000209	Process	Protein polyubiquitination	IDA	15247280
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	18359941, 18703417, 20061386, 26475854
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS	8090726
GO:0005515	Function	Protein binding	IPI	14667819, 15001359, 15231748, 18313049, 19043414, 19549727, 19615732, 19690564, 20152160, 20696396, 20705607, 22124327, 22158902, 22266821, 22902369, 24446487, 26752685, 26789245, 28514442, 32296183, 32814053, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS	7724550
GO:0016567	Process	Protein ubiquitination	IDA	9990509, 14593114
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032991	Component	Protein-containing complex	IDA	22797923
GO:0036211	Process	Protein modification process	TAS	8090726
GO:0051865	Process	Protein autoubiquitination	IDA	21068390
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	8530467
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IBA
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IDA	14593114, 15247280, 20061386, 21068390, 23509263
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070936	Process	Protein K48-linked ubiquitination	IBA
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	20061386
GO:0070936	Process	Protein K48-linked ubiquitination	IEA

Other IDs

• MIM: 602962
• HGNC: 12475
• e!Ensembl: ENSG00000131508

Protein

• UniProt ID: P62837
• Protein name: Ubiquitin-conjugating enzyme E2 D2 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme D2) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2(17)KB 2) (Ubiquitin-conjugating enzym
• Protein function: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins (PubMed:10329681, PubMed:18042044, PubMed:18703417, PubMed:20061386, PubMed:20403326, PubMed:20525694, PubMed:26475854, PubMed:28322253). Catalyzes 'Ly
• PDB: 1UR6 , 1W4U , 2CLW , 2ESK , 2ESO , 2ESP , 2ESQ , 3A33 , 3JVZ , 3JW0 , 3L1Y , 3TGD , 3ZNI , 4A49 , 4A4B , 4A4C , 4AUQ , 4DDG , 4DDI , 4LDT , 4V3K , 4V3L , 4WZ3 , 5D0K , 5D0M , 5D1K , 5D1L , 5D1M , 5EDV , 5MNJ , 5ULF , 5ULH , 5ULK , 5VZW , 5ZBU , 6HPR , 6M2C , 6SQO , 6SQR , 6SQS , 6TTU , 6W7Z , 6W9D , 7AI0 , 7AI1 , 7BOL , 7R71 , 8B3I , 8GBQ , 8GCB , 8GRM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00179	UQ_con	5 → 142	Ubiquitin-conjugating enzyme	Domain

• Sequence:

  MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
  PFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLV
  PEIARIYKTDREKYNRIAREWTQKYAM

• Sequence length: 147

Pathways

KEGG Pathway	Reactome Pathway
Polycomb repressive complex	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Ubiquitin mediated proteolysis	TICAM1, RIP1-mediated IKK complex recruitment
Protein processing in endoplasmic reticulum	Downstream TCR signaling
Shigellosis	FCERI mediated NF-kB activation
	CLEC7A (Dectin-1) signaling
	Synthesis of active ubiquitin: roles of E1 and E2 enzymes
	E3 ubiquitin ligases ubiquitinate target proteins
	Neddylation
	Peroxisomal protein import
	IKK complex recruitment mediated by RIP1
	Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
SCHIZOPHRENIA	—	GWAS catalog	35396580	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (7)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	31336316		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30755640	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	22710419	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31336316		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12095419		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	26395032		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31336316		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

UBE2D3 10 shared pathwaysPolycomb repressive complex, Ubiquitin mediated proteolysis, Protein processing in endoplasmic reticulum, Shigellosis, Peroxisomal protein import, Neddylation, IKK complex recruitment mediated by RIP1, Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha, E3 ubiquitin ligases ubiquitinate target proteins, TICAM1, RIP1-mediated IKK complex recruitment Related via 10 shared pathways including Polycomb repressive complex, Ubiquitin mediated proteolysis. UBE2D1 14 shared pathwaysPolycomb repressive complex, Ubiquitin mediated proteolysis, Protein processing in endoplasmic reticulum, Shigellosis, Peroxisomal protein import, Neddylation, IKK complex recruitment mediated by RIP1, Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha, Downstream TCR signaling, FCERI mediated NF-kB activation, CLEC7A (Dectin-1) signaling, Synthesis of active ubiquitin: roles of E1 and E2 enzymes +2 more Related via 14 shared pathways including Polycomb repressive complex, Ubiquitin mediated proteolysis. CDC34 5 shared pathwaysUbiquitin mediated proteolysis, Downstream TCR signaling, FCERI mediated NF-kB activation, CLEC7A (Dectin-1) signaling, Synthesis of active ubiquitin: roles of E1 and E2 enzymes Related via 5 shared pathways including Ubiquitin mediated proteolysis, Downstream TCR signaling. UBE2D4 4 shared pathwaysPolycomb repressive complex, Ubiquitin mediated proteolysis, Protein processing in endoplasmic reticulum, Shigellosis Related via 4 shared pathways including Polycomb repressive complex, Ubiquitin mediated proteolysis. UBE2N 8 shared pathwaysUbiquitin mediated proteolysis, Shigellosis, IKK complex recruitment mediated by RIP1, Downstream TCR signaling, FCERI mediated NF-kB activation, CLEC7A (Dectin-1) signaling, E3 ubiquitin ligases ubiquitinate target proteins, TICAM1, RIP1-mediated IKK complex recruitment Related via 8 shared pathways including Ubiquitin mediated proteolysis, Shigellosis.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
UBE2D3	0	[]	10	["Polycomb repressive complex","Ubiquitin mediated proteolysis","Protein processing in endoplasmic reticulum","Shigellosis","Peroxisomal protein import","Neddylation","IKK complex recruitment mediated by RIP1","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha","E3 ubiquitin ligases ubiquitinate target proteins","TICAM1, RIP1-mediated IKK complex recruitment"]	0	[]
UBE2D1	0	[]	14	["Polycomb repressive complex","Ubiquitin mediated proteolysis","Protein processing in endoplasmic reticulum","Shigellosis","Peroxisomal protein import","Neddylation","IKK complex recruitment mediated by RIP1","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha","Downstream TCR signaling","FCERI mediated NF-kB activation","CLEC7A (Dectin-1) signaling","Synthesis of active ubiquitin: roles of E1 and E2 enzymes"]	0	[]
CDC34	0	[]	5	["Ubiquitin mediated proteolysis","Downstream TCR signaling","FCERI mediated NF-kB activation","CLEC7A (Dectin-1) signaling","Synthesis of active ubiquitin: roles of E1 and E2 enzymes"]	0	[]
UBE2D4	0	[]	4	["Polycomb repressive complex","Ubiquitin mediated proteolysis","Protein processing in endoplasmic reticulum","Shigellosis"]	0	[]
UBE2N	0	[]	8	["Ubiquitin mediated proteolysis","Shigellosis","IKK complex recruitment mediated by RIP1","Downstream TCR signaling","FCERI mediated NF-kB activation","CLEC7A (Dectin-1) signaling","E3 ubiquitin ligases ubiquitinate target proteins","TICAM1, RIP1-mediated IKK complex recruitment"]	0	[]

Diseases Linked via Similar Genes

Atrial fibrillation Linked via 1 of 5 related genesUBE2D3 Attention deficit hyperactivity disorder Linked via 1 of 5 related genesUBE2D3 Autism Linked via 1 of 5 related genesUBE2D3 Diabetes mellitus Linked via 1 of 5 related genesUBE2D3 Migraine Linked via 1 of 5 related genesUBE2D3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Atrial fibrillation	1	["UBE2D3"]
Attention deficit hyperactivity disorder	1	["UBE2D3"]
Autism	1	["UBE2D3"]
Diabetes mellitus	1	["UBE2D3"]
Migraine	1	["UBE2D3"]