Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	7321
Gene name	Ubiquitin conjugating enzyme E2 D1
Gene symbol	UBE2D1
Synonyms (NCBI Gene)	E2(17)KB1SFTUBC4/5UBCH5UBCH5A
Chromosome	10
Chromosome location	10q21.1
Summary	The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conju

507 Show/Hide all (507)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021975	hsa-miR-128-3p	Microarray	17612493
MIRT024683	hsa-miR-215-5p	Microarray	19074876
MIRT026353	hsa-miR-192-5p	Microarray	19074876
MIRT044897	hsa-miR-188-5p	CLASH	23622248
MIRT520378	hsa-miR-548ac	PAR-CLIP	20371350
MIRT520377	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT520376	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT520375	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT520374	hsa-miR-548z	PAR-CLIP	20371350
MIRT177611	hsa-miR-409-3p	PAR-CLIP	20371350
MIRT520373	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT177614	hsa-miR-4699-3p	PAR-CLIP	20371350
MIRT177612	hsa-miR-653-5p	PAR-CLIP	20371350
MIRT177615	hsa-miR-219a-1-3p	PAR-CLIP	20371350
MIRT500611	hsa-miR-200c-3p	PAR-CLIP	20371350
MIRT500610	hsa-miR-429	PAR-CLIP	20371350
MIRT500609	hsa-miR-200b-3p	PAR-CLIP	20371350
MIRT177622	hsa-miR-548n	PAR-CLIP	20371350
MIRT177618	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT177629	hsa-miR-548ab	PAR-CLIP	20371350
MIRT177630	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT177631	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT177632	hsa-miR-548ak	PAR-CLIP	20371350
MIRT177633	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT177634	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT177635	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT177636	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT177637	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT177638	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT177639	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT177617	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT177640	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT177619	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT177620	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT177623	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT177624	hsa-miR-548i	PAR-CLIP	20371350
MIRT177621	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT177628	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT177626	hsa-miR-548w	PAR-CLIP	20371350
MIRT177627	hsa-miR-548y	PAR-CLIP	20371350
MIRT177616	hsa-miR-559	PAR-CLIP	20371350
MIRT500608	hsa-miR-452-5p	PAR-CLIP	20371350
MIRT500606	hsa-miR-4676-3p	PAR-CLIP	20371350
MIRT500607	hsa-miR-892c-3p	PAR-CLIP	20371350
MIRT500605	hsa-miR-571	PAR-CLIP	20371350
MIRT177625	hsa-miR-3148	PAR-CLIP	20371350
MIRT056720	hsa-miR-513a-5p	PAR-CLIP	20371350
MIRT056717	hsa-miR-27a-3p	PAR-CLIP	20371350
MIRT056718	hsa-miR-27b-3p	PAR-CLIP	20371350
MIRT500604	hsa-miR-489-3p	PAR-CLIP	20371350
MIRT177615	hsa-miR-219a-1-3p	PAR-CLIP	21572407
MIRT500611	hsa-miR-200c-3p	PAR-CLIP	21572407
MIRT500610	hsa-miR-429	PAR-CLIP	21572407
MIRT500609	hsa-miR-200b-3p	PAR-CLIP	21572407
MIRT177622	hsa-miR-548n	PAR-CLIP	21572407
MIRT177618	hsa-miR-548a-5p	PAR-CLIP	21572407
MIRT177629	hsa-miR-548ab	PAR-CLIP	21572407
MIRT177630	hsa-miR-548ad-5p	PAR-CLIP	21572407
MIRT177631	hsa-miR-548ae-5p	PAR-CLIP	21572407
MIRT177632	hsa-miR-548ak	PAR-CLIP	21572407
MIRT177633	hsa-miR-548am-5p	PAR-CLIP	21572407
MIRT177634	hsa-miR-548ap-5p	PAR-CLIP	21572407
MIRT177635	hsa-miR-548aq-5p	PAR-CLIP	21572407
MIRT177636	hsa-miR-548ar-5p	PAR-CLIP	21572407
MIRT177637	hsa-miR-548as-5p	PAR-CLIP	21572407
MIRT177638	hsa-miR-548au-5p	PAR-CLIP	21572407
MIRT177639	hsa-miR-548ay-5p	PAR-CLIP	21572407
MIRT177617	hsa-miR-548b-5p	PAR-CLIP	21572407
MIRT177640	hsa-miR-548bb-5p	PAR-CLIP	21572407
MIRT177619	hsa-miR-548c-5p	PAR-CLIP	21572407
MIRT177620	hsa-miR-548d-5p	PAR-CLIP	21572407
MIRT177623	hsa-miR-548h-5p	PAR-CLIP	21572407
MIRT177624	hsa-miR-548i	PAR-CLIP	21572407
MIRT177621	hsa-miR-548j-5p	PAR-CLIP	21572407
MIRT177628	hsa-miR-548o-5p	PAR-CLIP	21572407
MIRT177626	hsa-miR-548w	PAR-CLIP	21572407
MIRT177627	hsa-miR-548y	PAR-CLIP	21572407
MIRT177616	hsa-miR-559	PAR-CLIP	21572407
MIRT500608	hsa-miR-452-5p	PAR-CLIP	21572407
MIRT500606	hsa-miR-4676-3p	PAR-CLIP	21572407
MIRT500607	hsa-miR-892c-3p	PAR-CLIP	21572407
MIRT500605	hsa-miR-571	PAR-CLIP	21572407
MIRT177625	hsa-miR-3148	PAR-CLIP	21572407
MIRT056720	hsa-miR-513a-5p	PAR-CLIP	21572407
MIRT056717	hsa-miR-27a-3p	PAR-CLIP	21572407
MIRT056718	hsa-miR-27b-3p	PAR-CLIP	21572407
MIRT500604	hsa-miR-489-3p	PAR-CLIP	21572407
MIRT520378	hsa-miR-548ac	PAR-CLIP	23446348
MIRT520377	hsa-miR-548bb-3p	PAR-CLIP	23446348
MIRT520376	hsa-miR-548d-3p	PAR-CLIP	23446348
MIRT520375	hsa-miR-548h-3p	PAR-CLIP	23446348
MIRT520374	hsa-miR-548z	PAR-CLIP	23446348
MIRT177611	hsa-miR-409-3p	PAR-CLIP	23446348
MIRT520373	hsa-miR-33a-3p	PAR-CLIP	23446348
MIRT177614	hsa-miR-4699-3p	PAR-CLIP	23446348
MIRT520372	hsa-miR-7158-5p	PAR-CLIP	23446348
MIRT177612	hsa-miR-653-5p	PAR-CLIP	23446348
MIRT177615	hsa-miR-219a-1-3p	PAR-CLIP	24398324
MIRT500611	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT500610	hsa-miR-429	PAR-CLIP	24398324
MIRT500609	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT177622	hsa-miR-548n	PAR-CLIP	24398324
MIRT177618	hsa-miR-548a-5p	PAR-CLIP	24398324
MIRT177629	hsa-miR-548ab	PAR-CLIP	24398324
MIRT177630	hsa-miR-548ad-5p	PAR-CLIP	24398324
MIRT177631	hsa-miR-548ae-5p	PAR-CLIP	24398324
MIRT177632	hsa-miR-548ak	PAR-CLIP	24398324
MIRT177633	hsa-miR-548am-5p	PAR-CLIP	24398324
MIRT177634	hsa-miR-548ap-5p	PAR-CLIP	24398324
MIRT177635	hsa-miR-548aq-5p	PAR-CLIP	24398324
MIRT177636	hsa-miR-548ar-5p	PAR-CLIP	24398324
MIRT177637	hsa-miR-548as-5p	PAR-CLIP	24398324
MIRT177638	hsa-miR-548au-5p	PAR-CLIP	24398324
MIRT177639	hsa-miR-548ay-5p	PAR-CLIP	24398324
MIRT177617	hsa-miR-548b-5p	PAR-CLIP	24398324
MIRT177640	hsa-miR-548bb-5p	PAR-CLIP	24398324
MIRT177619	hsa-miR-548c-5p	PAR-CLIP	24398324
MIRT177620	hsa-miR-548d-5p	PAR-CLIP	24398324
MIRT177623	hsa-miR-548h-5p	PAR-CLIP	24398324
MIRT177624	hsa-miR-548i	PAR-CLIP	24398324
MIRT177621	hsa-miR-548j-5p	PAR-CLIP	24398324
MIRT177628	hsa-miR-548o-5p	PAR-CLIP	24398324
MIRT177626	hsa-miR-548w	PAR-CLIP	24398324
MIRT177627	hsa-miR-548y	PAR-CLIP	24398324
MIRT177616	hsa-miR-559	PAR-CLIP	24398324
MIRT500608	hsa-miR-452-5p	PAR-CLIP	24398324
MIRT500606	hsa-miR-4676-3p	PAR-CLIP	24398324
MIRT500607	hsa-miR-892c-3p	PAR-CLIP	24398324
MIRT500605	hsa-miR-571	PAR-CLIP	24398324
MIRT177625	hsa-miR-3148	PAR-CLIP	24398324
MIRT056720	hsa-miR-513a-5p	PAR-CLIP	24398324
MIRT056717	hsa-miR-27a-3p	PAR-CLIP	24398324
MIRT056718	hsa-miR-27b-3p	PAR-CLIP	24398324
MIRT500604	hsa-miR-489-3p	PAR-CLIP	24398324
MIRT520378	hsa-miR-548ac	PAR-CLIP	20371350
MIRT520377	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT520376	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT520375	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT520374	hsa-miR-548z	PAR-CLIP	20371350
MIRT177611	hsa-miR-409-3p	PAR-CLIP	20371350
MIRT520373	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT177614	hsa-miR-4699-3p	PAR-CLIP	20371350
MIRT177612	hsa-miR-653-5p	PAR-CLIP	20371350
MIRT177615	hsa-miR-219a-1-3p	PAR-CLIP	20371350
MIRT500611	hsa-miR-200c-3p	PAR-CLIP	20371350
MIRT500610	hsa-miR-429	PAR-CLIP	20371350
MIRT500609	hsa-miR-200b-3p	PAR-CLIP	20371350
MIRT177622	hsa-miR-548n	PAR-CLIP	20371350
MIRT177618	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT177629	hsa-miR-548ab	PAR-CLIP	20371350
MIRT177630	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT177631	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT177632	hsa-miR-548ak	PAR-CLIP	20371350
MIRT177633	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT177634	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT177635	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT177636	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT177637	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT177638	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT177639	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT177617	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT177640	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT177619	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT177620	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT177623	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT177624	hsa-miR-548i	PAR-CLIP	20371350
MIRT177621	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT177628	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT177626	hsa-miR-548w	PAR-CLIP	20371350
MIRT177627	hsa-miR-548y	PAR-CLIP	20371350
MIRT177616	hsa-miR-559	PAR-CLIP	20371350
MIRT500608	hsa-miR-452-5p	PAR-CLIP	20371350
MIRT500606	hsa-miR-4676-3p	PAR-CLIP	20371350
MIRT500607	hsa-miR-892c-3p	PAR-CLIP	20371350
MIRT500605	hsa-miR-571	PAR-CLIP	20371350
MIRT177625	hsa-miR-3148	PAR-CLIP	20371350
MIRT056720	hsa-miR-513a-5p	PAR-CLIP	20371350
MIRT056717	hsa-miR-27a-3p	PAR-CLIP	20371350
MIRT056718	hsa-miR-27b-3p	PAR-CLIP	20371350
MIRT500604	hsa-miR-489-3p	PAR-CLIP	20371350
MIRT177615	hsa-miR-219a-1-3p	PAR-CLIP	21572407
MIRT500611	hsa-miR-200c-3p	PAR-CLIP	21572407
MIRT500610	hsa-miR-429	PAR-CLIP	21572407
MIRT500609	hsa-miR-200b-3p	PAR-CLIP	21572407
MIRT177622	hsa-miR-548n	PAR-CLIP	21572407
MIRT177618	hsa-miR-548a-5p	PAR-CLIP	21572407
MIRT177629	hsa-miR-548ab	PAR-CLIP	21572407
MIRT177630	hsa-miR-548ad-5p	PAR-CLIP	21572407
MIRT177631	hsa-miR-548ae-5p	PAR-CLIP	21572407
MIRT177632	hsa-miR-548ak	PAR-CLIP	21572407
MIRT177633	hsa-miR-548am-5p	PAR-CLIP	21572407
MIRT177634	hsa-miR-548ap-5p	PAR-CLIP	21572407
MIRT177635	hsa-miR-548aq-5p	PAR-CLIP	21572407
MIRT177636	hsa-miR-548ar-5p	PAR-CLIP	21572407
MIRT177637	hsa-miR-548as-5p	PAR-CLIP	21572407
MIRT177638	hsa-miR-548au-5p	PAR-CLIP	21572407
MIRT177639	hsa-miR-548ay-5p	PAR-CLIP	21572407
MIRT177617	hsa-miR-548b-5p	PAR-CLIP	21572407
MIRT177640	hsa-miR-548bb-5p	PAR-CLIP	21572407
MIRT177619	hsa-miR-548c-5p	PAR-CLIP	21572407
MIRT177620	hsa-miR-548d-5p	PAR-CLIP	21572407
MIRT177623	hsa-miR-548h-5p	PAR-CLIP	21572407
MIRT177624	hsa-miR-548i	PAR-CLIP	21572407
MIRT177621	hsa-miR-548j-5p	PAR-CLIP	21572407
MIRT177628	hsa-miR-548o-5p	PAR-CLIP	21572407
MIRT177626	hsa-miR-548w	PAR-CLIP	21572407
MIRT177627	hsa-miR-548y	PAR-CLIP	21572407
MIRT177616	hsa-miR-559	PAR-CLIP	21572407
MIRT500608	hsa-miR-452-5p	PAR-CLIP	21572407
MIRT500606	hsa-miR-4676-3p	PAR-CLIP	21572407
MIRT500607	hsa-miR-892c-3p	PAR-CLIP	21572407
MIRT500605	hsa-miR-571	PAR-CLIP	21572407
MIRT177625	hsa-miR-3148	PAR-CLIP	21572407
MIRT056720	hsa-miR-513a-5p	PAR-CLIP	21572407
MIRT056717	hsa-miR-27a-3p	PAR-CLIP	21572407
MIRT056718	hsa-miR-27b-3p	PAR-CLIP	21572407
MIRT500604	hsa-miR-489-3p	PAR-CLIP	21572407
MIRT520378	hsa-miR-548ac	PAR-CLIP	23446348
MIRT520377	hsa-miR-548bb-3p	PAR-CLIP	23446348
MIRT520376	hsa-miR-548d-3p	PAR-CLIP	23446348
MIRT520375	hsa-miR-548h-3p	PAR-CLIP	23446348
MIRT520374	hsa-miR-548z	PAR-CLIP	23446348
MIRT177611	hsa-miR-409-3p	PAR-CLIP	23446348
MIRT520373	hsa-miR-33a-3p	PAR-CLIP	23446348
MIRT177614	hsa-miR-4699-3p	PAR-CLIP	23446348
MIRT520372	hsa-miR-7158-5p	PAR-CLIP	23446348
MIRT177612	hsa-miR-653-5p	PAR-CLIP	23446348
MIRT177615	hsa-miR-219a-1-3p	PAR-CLIP	24398324
MIRT500611	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT500610	hsa-miR-429	PAR-CLIP	24398324
MIRT500609	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT177622	hsa-miR-548n	PAR-CLIP	24398324
MIRT177618	hsa-miR-548a-5p	PAR-CLIP	24398324
MIRT177629	hsa-miR-548ab	PAR-CLIP	24398324
MIRT177630	hsa-miR-548ad-5p	PAR-CLIP	24398324
MIRT177631	hsa-miR-548ae-5p	PAR-CLIP	24398324
MIRT177632	hsa-miR-548ak	PAR-CLIP	24398324
MIRT177633	hsa-miR-548am-5p	PAR-CLIP	24398324
MIRT177634	hsa-miR-548ap-5p	PAR-CLIP	24398324
MIRT177635	hsa-miR-548aq-5p	PAR-CLIP	24398324
MIRT177636	hsa-miR-548ar-5p	PAR-CLIP	24398324
MIRT177637	hsa-miR-548as-5p	PAR-CLIP	24398324
MIRT177638	hsa-miR-548au-5p	PAR-CLIP	24398324
MIRT177639	hsa-miR-548ay-5p	PAR-CLIP	24398324
MIRT177617	hsa-miR-548b-5p	PAR-CLIP	24398324
MIRT177640	hsa-miR-548bb-5p	PAR-CLIP	24398324
MIRT177619	hsa-miR-548c-5p	PAR-CLIP	24398324
MIRT177620	hsa-miR-548d-5p	PAR-CLIP	24398324
MIRT177623	hsa-miR-548h-5p	PAR-CLIP	24398324
MIRT177624	hsa-miR-548i	PAR-CLIP	24398324
MIRT177621	hsa-miR-548j-5p	PAR-CLIP	24398324
MIRT177628	hsa-miR-548o-5p	PAR-CLIP	24398324
MIRT177626	hsa-miR-548w	PAR-CLIP	24398324
MIRT177627	hsa-miR-548y	PAR-CLIP	24398324
MIRT177616	hsa-miR-559	PAR-CLIP	24398324
MIRT500608	hsa-miR-452-5p	PAR-CLIP	24398324
MIRT500606	hsa-miR-4676-3p	PAR-CLIP	24398324
MIRT500607	hsa-miR-892c-3p	PAR-CLIP	24398324
MIRT500605	hsa-miR-571	PAR-CLIP	24398324
MIRT177625	hsa-miR-3148	PAR-CLIP	24398324
MIRT056720	hsa-miR-513a-5p	PAR-CLIP	24398324
MIRT056717	hsa-miR-27a-3p	PAR-CLIP	24398324
MIRT056718	hsa-miR-27b-3p	PAR-CLIP	24398324
MIRT500604	hsa-miR-489-3p	PAR-CLIP	24398324
MIRT1467083	hsa-miR-128	CLIP-seq
MIRT1467084	hsa-miR-1297	CLIP-seq
MIRT1467085	hsa-miR-130a	CLIP-seq
MIRT1467086	hsa-miR-130b	CLIP-seq
MIRT1467087	hsa-miR-142-5p	CLIP-seq
MIRT1467088	hsa-miR-148a	CLIP-seq
MIRT1467089	hsa-miR-148b	CLIP-seq
MIRT1467090	hsa-miR-152	CLIP-seq
MIRT1467091	hsa-miR-200b	CLIP-seq
MIRT1467092	hsa-miR-200c	CLIP-seq
MIRT1467093	hsa-miR-224	CLIP-seq
MIRT1467094	hsa-miR-23a	CLIP-seq
MIRT1467095	hsa-miR-23b	CLIP-seq
MIRT1467096	hsa-miR-23c	CLIP-seq
MIRT1467097	hsa-miR-26a	CLIP-seq
MIRT1467098	hsa-miR-26b	CLIP-seq
MIRT1467099	hsa-miR-27a	CLIP-seq
MIRT1467100	hsa-miR-27b	CLIP-seq
MIRT1467101	hsa-miR-2964a-5p	CLIP-seq
MIRT1467102	hsa-miR-301a	CLIP-seq
MIRT1467103	hsa-miR-301b	CLIP-seq
MIRT1467104	hsa-miR-3064-3p	CLIP-seq
MIRT1467105	hsa-miR-320e	CLIP-seq
MIRT1467106	hsa-miR-3646	CLIP-seq
MIRT1467107	hsa-miR-3653	CLIP-seq
MIRT1467108	hsa-miR-3658	CLIP-seq
MIRT1467109	hsa-miR-3666	CLIP-seq
MIRT1467110	hsa-miR-3685	CLIP-seq
MIRT1467111	hsa-miR-3691-3p	CLIP-seq
MIRT1467112	hsa-miR-3942-3p	CLIP-seq
MIRT1467113	hsa-miR-4274	CLIP-seq
MIRT1467114	hsa-miR-4295	CLIP-seq
MIRT1467115	hsa-miR-4465	CLIP-seq
MIRT1467116	hsa-miR-4519	CLIP-seq
MIRT1467117	hsa-miR-452	CLIP-seq
MIRT1467118	hsa-miR-4524	CLIP-seq
MIRT1467119	hsa-miR-454	CLIP-seq
MIRT1467120	hsa-miR-4699-5p	CLIP-seq
MIRT1467121	hsa-miR-4719	CLIP-seq
MIRT1467122	hsa-miR-4760-3p	CLIP-seq
MIRT1467123	hsa-miR-495	CLIP-seq
MIRT1467124	hsa-miR-511	CLIP-seq
MIRT1467125	hsa-miR-513c	CLIP-seq
MIRT1467126	hsa-miR-514b-5p	CLIP-seq
MIRT1467127	hsa-miR-548h	CLIP-seq
MIRT1467128	hsa-miR-548j	CLIP-seq
MIRT1467129	hsa-miR-561	CLIP-seq
MIRT1467130	hsa-miR-582-5p	CLIP-seq
MIRT1467131	hsa-miR-106a	CLIP-seq
MIRT1467132	hsa-miR-106b	CLIP-seq
MIRT1467133	hsa-miR-1305	CLIP-seq
MIRT1467085	hsa-miR-130a	CLIP-seq
MIRT1467086	hsa-miR-130b	CLIP-seq
MIRT1467087	hsa-miR-142-5p	CLIP-seq
MIRT1467088	hsa-miR-148a	CLIP-seq
MIRT1467089	hsa-miR-148b	CLIP-seq
MIRT1467090	hsa-miR-152	CLIP-seq
MIRT1467134	hsa-miR-17	CLIP-seq
MIRT1467135	hsa-miR-186	CLIP-seq
MIRT1467091	hsa-miR-200b	CLIP-seq
MIRT1467092	hsa-miR-200c	CLIP-seq
MIRT1467136	hsa-miR-20a	CLIP-seq
MIRT1467137	hsa-miR-20b	CLIP-seq
MIRT1467138	hsa-miR-219-1-3p	CLIP-seq
MIRT1467094	hsa-miR-23a	CLIP-seq
MIRT1467095	hsa-miR-23b	CLIP-seq
MIRT1467096	hsa-miR-23c	CLIP-seq
MIRT1467099	hsa-miR-27a	CLIP-seq
MIRT1467100	hsa-miR-27b	CLIP-seq
MIRT1467102	hsa-miR-301a	CLIP-seq
MIRT1467103	hsa-miR-301b	CLIP-seq
MIRT1467139	hsa-miR-30a	CLIP-seq
MIRT1467140	hsa-miR-30b	CLIP-seq
MIRT1467141	hsa-miR-30c	CLIP-seq
MIRT1467142	hsa-miR-30d	CLIP-seq
MIRT1467143	hsa-miR-30e	CLIP-seq
MIRT1467144	hsa-miR-3170	CLIP-seq
MIRT1467145	hsa-miR-340	CLIP-seq
MIRT1467146	hsa-miR-3609	CLIP-seq
MIRT1467147	hsa-miR-361-5p	CLIP-seq
MIRT1467109	hsa-miR-3666	CLIP-seq
MIRT1467110	hsa-miR-3685	CLIP-seq
MIRT1467148	hsa-miR-3941	CLIP-seq
MIRT1467149	hsa-miR-411	CLIP-seq
MIRT1467113	hsa-miR-4274	CLIP-seq
MIRT1467114	hsa-miR-4295	CLIP-seq
MIRT1467150	hsa-miR-4422	CLIP-seq
MIRT1467116	hsa-miR-4519	CLIP-seq
MIRT1467117	hsa-miR-452	CLIP-seq
MIRT1467118	hsa-miR-4524	CLIP-seq
MIRT1467119	hsa-miR-454	CLIP-seq
MIRT1467151	hsa-miR-4643	CLIP-seq
MIRT1467152	hsa-miR-466	CLIP-seq
MIRT1467153	hsa-miR-4672	CLIP-seq
MIRT1467122	hsa-miR-4760-3p	CLIP-seq
MIRT1467154	hsa-miR-4789-3p	CLIP-seq
MIRT1467155	hsa-miR-4796-3p	CLIP-seq
MIRT1467156	hsa-miR-494	CLIP-seq
MIRT1467123	hsa-miR-495	CLIP-seq
MIRT1467157	hsa-miR-519d	CLIP-seq
MIRT1467158	hsa-miR-548ah	CLIP-seq
MIRT1467127	hsa-miR-548h	CLIP-seq
MIRT1467128	hsa-miR-548j	CLIP-seq
MIRT1467159	hsa-miR-610	CLIP-seq
MIRT1467160	hsa-miR-93	CLIP-seq
MIRT2140396	hsa-miR-139-5p	CLIP-seq
MIRT2140397	hsa-miR-144	CLIP-seq
MIRT2140398	hsa-miR-217	CLIP-seq
MIRT2140399	hsa-miR-3682-5p	CLIP-seq
MIRT2140400	hsa-miR-4418	CLIP-seq
MIRT2140401	hsa-miR-509-3-5p	CLIP-seq
MIRT2140402	hsa-miR-509-5p	CLIP-seq
MIRT2361114	hsa-miR-101	CLIP-seq
MIRT2361115	hsa-miR-105	CLIP-seq
MIRT2361116	hsa-miR-1257	CLIP-seq
MIRT1467083	hsa-miR-128	CLIP-seq
MIRT1467133	hsa-miR-1305	CLIP-seq
MIRT1467085	hsa-miR-130a	CLIP-seq
MIRT1467086	hsa-miR-130b	CLIP-seq
MIRT2140396	hsa-miR-139-5p	CLIP-seq
MIRT1467087	hsa-miR-142-5p	CLIP-seq
MIRT2140397	hsa-miR-144	CLIP-seq
MIRT1467088	hsa-miR-148a	CLIP-seq
MIRT1467089	hsa-miR-148b	CLIP-seq
MIRT1467090	hsa-miR-152	CLIP-seq
MIRT1467091	hsa-miR-200b	CLIP-seq
MIRT1467092	hsa-miR-200c	CLIP-seq
MIRT1467138	hsa-miR-219-1-3p	CLIP-seq
MIRT1467093	hsa-miR-224	CLIP-seq
MIRT1467094	hsa-miR-23a	CLIP-seq
MIRT1467095	hsa-miR-23b	CLIP-seq
MIRT1467096	hsa-miR-23c	CLIP-seq
MIRT1467099	hsa-miR-27a	CLIP-seq
MIRT1467100	hsa-miR-27b	CLIP-seq
MIRT1467102	hsa-miR-301a	CLIP-seq
MIRT1467103	hsa-miR-301b	CLIP-seq
MIRT2361117	hsa-miR-3065-5p	CLIP-seq
MIRT1467139	hsa-miR-30a	CLIP-seq
MIRT1467140	hsa-miR-30b	CLIP-seq
MIRT1467141	hsa-miR-30c	CLIP-seq
MIRT1467142	hsa-miR-30d	CLIP-seq
MIRT1467143	hsa-miR-30e	CLIP-seq
MIRT2361118	hsa-miR-3117-5p	CLIP-seq
MIRT2361119	hsa-miR-3120-3p	CLIP-seq
MIRT2361120	hsa-miR-3156-5p	CLIP-seq
MIRT1467144	hsa-miR-3170	CLIP-seq
MIRT1467145	hsa-miR-340	CLIP-seq
MIRT2361121	hsa-miR-3607-3p	CLIP-seq
MIRT1467147	hsa-miR-361-5p	CLIP-seq
MIRT2361122	hsa-miR-3647-3p	CLIP-seq
MIRT2361123	hsa-miR-3662	CLIP-seq
MIRT2361124	hsa-miR-3664-5p	CLIP-seq
MIRT1467109	hsa-miR-3666	CLIP-seq
MIRT2361125	hsa-miR-3680	CLIP-seq
MIRT2140399	hsa-miR-3682-5p	CLIP-seq
MIRT1467110	hsa-miR-3685	CLIP-seq
MIRT2361126	hsa-miR-3686	CLIP-seq
MIRT2361127	hsa-miR-3913-3p	CLIP-seq
MIRT1467148	hsa-miR-3941	CLIP-seq
MIRT2361128	hsa-miR-3977	CLIP-seq
MIRT1467113	hsa-miR-4274	CLIP-seq
MIRT1467114	hsa-miR-4295	CLIP-seq
MIRT2361129	hsa-miR-4307	CLIP-seq
MIRT2361130	hsa-miR-431	CLIP-seq
MIRT2361131	hsa-miR-4490	CLIP-seq
MIRT1467116	hsa-miR-4519	CLIP-seq
MIRT1467117	hsa-miR-452	CLIP-seq
MIRT1467118	hsa-miR-4524	CLIP-seq
MIRT1467119	hsa-miR-454	CLIP-seq
MIRT1467151	hsa-miR-4643	CLIP-seq
MIRT1467152	hsa-miR-466	CLIP-seq
MIRT1467153	hsa-miR-4672	CLIP-seq
MIRT2361132	hsa-miR-4714-5p	CLIP-seq
MIRT1467122	hsa-miR-4760-3p	CLIP-seq
MIRT2361133	hsa-miR-4761-5p	CLIP-seq
MIRT2361134	hsa-miR-4774-5p	CLIP-seq
MIRT1467154	hsa-miR-4789-3p	CLIP-seq
MIRT2361135	hsa-miR-489	CLIP-seq
MIRT1467124	hsa-miR-511	CLIP-seq
MIRT1467127	hsa-miR-548h	CLIP-seq
MIRT1467128	hsa-miR-548j	CLIP-seq
MIRT2361136	hsa-miR-548t	CLIP-seq
MIRT1467129	hsa-miR-561	CLIP-seq
MIRT2361137	hsa-miR-563	CLIP-seq
MIRT1467130	hsa-miR-582-5p	CLIP-seq
MIRT2361138	hsa-miR-944	CLIP-seq
MIRT2140396	hsa-miR-139-5p	CLIP-seq
MIRT2140399	hsa-miR-3682-5p	CLIP-seq
MIRT2361114	hsa-miR-101	CLIP-seq
MIRT2654898	hsa-miR-1207-3p	CLIP-seq
MIRT2654899	hsa-miR-1276	CLIP-seq
MIRT2140397	hsa-miR-144	CLIP-seq
MIRT2654900	hsa-miR-2355-5p	CLIP-seq
MIRT2361118	hsa-miR-3117-5p	CLIP-seq
MIRT2654901	hsa-miR-3140-3p	CLIP-seq
MIRT2654902	hsa-miR-3171	CLIP-seq
MIRT2654903	hsa-miR-33a	CLIP-seq
MIRT2654904	hsa-miR-33b	CLIP-seq
MIRT2654905	hsa-miR-3613-3p	CLIP-seq
MIRT2654906	hsa-miR-3674	CLIP-seq
MIRT2654907	hsa-miR-3679-3p	CLIP-seq
MIRT2361125	hsa-miR-3680	CLIP-seq
MIRT2361127	hsa-miR-3913-3p	CLIP-seq
MIRT2654908	hsa-miR-3935	CLIP-seq
MIRT2654909	hsa-miR-4291	CLIP-seq
MIRT2654910	hsa-miR-4311	CLIP-seq
MIRT2654911	hsa-miR-4446-5p	CLIP-seq
MIRT2654912	hsa-miR-4495	CLIP-seq
MIRT2361133	hsa-miR-4761-5p	CLIP-seq
MIRT1467154	hsa-miR-4789-3p	CLIP-seq
MIRT2361135	hsa-miR-489	CLIP-seq
MIRT2654913	hsa-miR-545	CLIP-seq
MIRT2654914	hsa-miR-548a-3p	CLIP-seq
MIRT2654915	hsa-miR-548ae	CLIP-seq
MIRT2654916	hsa-miR-548aj	CLIP-seq
MIRT2654917	hsa-miR-548am	CLIP-seq
MIRT2654918	hsa-miR-548e	CLIP-seq
MIRT2654919	hsa-miR-548f	CLIP-seq
MIRT2654920	hsa-miR-548p	CLIP-seq
MIRT2654921	hsa-miR-548x	CLIP-seq
MIRT2361137	hsa-miR-563	CLIP-seq
MIRT2654922	hsa-miR-583	CLIP-seq
MIRT2654923	hsa-miR-643	CLIP-seq
MIRT2654924	hsa-miR-659	CLIP-seq
MIRT2361114	hsa-miR-101	CLIP-seq
MIRT2654899	hsa-miR-1276	CLIP-seq
MIRT2140397	hsa-miR-144	CLIP-seq
MIRT2654900	hsa-miR-2355-5p	CLIP-seq
MIRT2361118	hsa-miR-3117-5p	CLIP-seq
MIRT2654902	hsa-miR-3171	CLIP-seq
MIRT2654907	hsa-miR-3679-3p	CLIP-seq
MIRT2361125	hsa-miR-3680	CLIP-seq
MIRT2361127	hsa-miR-3913-3p	CLIP-seq
MIRT2654910	hsa-miR-4311	CLIP-seq
MIRT2654911	hsa-miR-4446-5p	CLIP-seq
MIRT2361133	hsa-miR-4761-5p	CLIP-seq
MIRT1467154	hsa-miR-4789-3p	CLIP-seq
MIRT2361135	hsa-miR-489	CLIP-seq
MIRT2654914	hsa-miR-548a-3p	CLIP-seq
MIRT2654918	hsa-miR-548e	CLIP-seq
MIRT2654919	hsa-miR-548f	CLIP-seq
MIRT2361137	hsa-miR-563	CLIP-seq
MIRT2654922	hsa-miR-583	CLIP-seq

33 Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS
GO:0000166	Function	Nucleotide binding	IEA
GO:0000209	Process	Protein polyubiquitination	IDA	15247280, 16275645
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	18359941, 20061386
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS
GO:0005515	Function	Protein binding	IPI	16189514, 16522193, 17318174, 19549727, 19690564, 21516116, 21857666, 22124327, 25327252, 25416956, 26752685, 27411375, 31515488, 32296183, 32814053, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	18845142
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	16275645
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS	8090726
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	TAS
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	16275645
GO:0031669	Process	Cellular response to nutrient levels	IDA	12747827, 29750193
GO:0032991	Component	Protein-containing complex	IDA	22797923
GO:0038202	Process	TORC1 signaling	IDA	12747827, 29750193
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	35927303
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	8530467
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IBA
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IDA	15247280, 19103148, 20061386, 21685362, 23509263, 35927303
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IEA
GO:0070936	Process	Protein K48-linked ubiquitination	IBA
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	20061386
GO:0070936	Process	Protein K48-linked ubiquitination	IEA
GO:1902916	Process	Positive regulation of protein polyubiquitination	IEA
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	35927303

MIM	HGNC	e!Ensembl
602961	12474	ENSG00000072401

P51668

Protein name

Ubiquitin-conjugating enzyme E2 D1 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme D1) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme D1) (Stimulator of Fe transport) (SFT) (UBC4/5 homolog) (UbcH5) (Ubiquitin carrier protein D1) (Ubiquitin

Protein function

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins (PubMed:22496338). In vitro catalyzes 'Lys-48'-linked polyubiquitination (PubMed:20061386). Mediates the selective degradation of short-lived and abnor

PDB

2C4P , 2YHO , 3OJ4 , 3PTF , 4AP4 , 4QPL , 5FER , 5TUT , 6D4P , 7ZJ3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00179	UQ_con	5 → 142	Ubiquitin-conjugating enzyme	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Up-regulated in livers of iron-overloaded patients with hereditary hemochromatosis. {ECO:0000269|PubMed:12480712, ECO:0000269|PubMed:9362508}.

Sequence

MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDY
PFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLV
PDIAQIYKSDKEKYNRHAREWTQKYAM

Sequence length

147

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Polycomb repressive complex	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Ubiquitin mediated proteolysis	Inactivation of APC/C via direct inhibition of the APC/C complex
Protein processing in endoplasmic reticulum	TICAM1, RIP1-mediated IKK complex recruitment
Shigellosis	APC/C:Cdc20 mediated degradation of Cyclin B
	Autodegradation of Cdh1 by Cdh1:APC/C
	APC/C:Cdc20 mediated degradation of Securin
	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
	Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase
	Regulation of APC/C activators between G1/S and early anaphase
	APC/C:Cdc20 mediated degradation of mitotic proteins
	Phosphorylation of the APC/C
	APC-Cdc20 mediated degradation of Nek2A
	Signaling by BMP
	Downstream TCR signaling
	Downregulation of SMAD2/3:SMAD4 transcriptional activity
	Separation of Sister Chromatids
	Senescence-Associated Secretory Phenotype (SASP)
	FCERI mediated NF-kB activation
	CLEC7A (Dectin-1) signaling
	Ovarian tumor domain proteases
	CDK-mediated phosphorylation and removal of Cdc6
	Transcriptional Regulation by VENTX
	Synthesis of active ubiquitin: roles of E1 and E2 enzymes
	E3 ubiquitin ligases ubiquitinate target proteins
	Neddylation
	Peroxisomal protein import
	IKK complex recruitment mediated by RIP1
	Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	35589863	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (25)
Anaplasia	Anaplasia	BEFREE	30603845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	11313310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angiomatous Meningioma	Angiomatous Meningioma	BEFREE	30777209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	34416429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	30420903	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29427365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34854395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	BEFREE	29521591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	11313310, 9918797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	12480712	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	LHGDN	12480712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	9856986	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	11313310, 9918797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	12480712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	9856986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30482241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	29427365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30482241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	31233926, 31673748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29427365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11891950, 16151577, 29521591, 30183767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obstructive Hydrocephalus	Obstructive Hydrocephalus	BEFREE	28803175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28226265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	26927892, 29675794, 30183767, 30603845, 31233926, 31673748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34776794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
UBE2E1	[]	18	["Ubiquitin mediated proteolysis","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1","Cdc20:Phospho-APC\/C mediated degradation of Cyclin A","Transcriptional Regulation by VENTX","Inactivation of APC\/C via direct inhibition of the APC\/C complex","APC\/C:Cdc20 mediated degradation of Cyclin B"]	[]
UBE2C	[]	17	["Ubiquitin mediated proteolysis","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1","Cdc20:Phospho-APC\/C mediated degradation of Cyclin A","Transcriptional Regulation by VENTX","Inactivation of APC\/C via direct inhibition of the APC\/C complex","APC\/C:Cdc20 mediated degradation of Cyclin B"]	[]
ANAPC10	[]	16	["Ubiquitin mediated proteolysis","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1","Cdc20:Phospho-APC\/C mediated degradation of Cyclin A","Transcriptional Regulation by VENTX","Inactivation of APC\/C via direct inhibition of the APC\/C complex","APC\/C:Cdc20 mediated degradation of Cyclin B"]	[]
ANAPC16	[]	16	["Ubiquitin mediated proteolysis","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1","Cdc20:Phospho-APC\/C mediated degradation of Cyclin A","Transcriptional Regulation by VENTX","Inactivation of APC\/C via direct inhibition of the APC\/C complex","APC\/C:Cdc20 mediated degradation of Cyclin B"]	[]
CDC26	[]	16	["Ubiquitin mediated proteolysis","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1","Cdc20:Phospho-APC\/C mediated degradation of Cyclin A","Transcriptional Regulation by VENTX","Inactivation of APC\/C via direct inhibition of the APC\/C complex","APC\/C:Cdc20 mediated degradation of Cyclin B"]	[]

UBE2D1 (ubiquitin conjugating enzyme E2 D1)

Bookmark This Gene