CDC26 (cell division cycle 26)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 246184
• Gene name: Cell division cycle 26
• Gene symbol: CDC26
• Synonyms (NCBI Gene): ANAPC12, APC12, C9orf17
• Chromosome: 9
• Chromosome location: 9q32
• Summary: The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-pro

miRNA Show/Hide all (21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT877231	hsa-miR-130a	CLIP-seq
MIRT877232	hsa-miR-130b	CLIP-seq
MIRT877233	hsa-miR-301a	CLIP-seq
MIRT877234	hsa-miR-301b	CLIP-seq
MIRT877235	hsa-miR-3666	CLIP-seq
MIRT877236	hsa-miR-4267	CLIP-seq
MIRT877237	hsa-miR-4295	CLIP-seq
MIRT877238	hsa-miR-454	CLIP-seq
MIRT1959976	hsa-miR-1305	CLIP-seq
MIRT1959977	hsa-miR-3976	CLIP-seq
MIRT877236	hsa-miR-4267	CLIP-seq
MIRT1959978	hsa-miR-4320	CLIP-seq
MIRT1959979	hsa-miR-4328	CLIP-seq
MIRT2196920	hsa-miR-216a	CLIP-seq
MIRT2196921	hsa-miR-216b	CLIP-seq
MIRT2196922	hsa-miR-4711-5p	CLIP-seq
MIRT2500178	hsa-miR-3128	CLIP-seq
MIRT2500179	hsa-miR-3622b-5p	CLIP-seq
MIRT2500180	hsa-miR-4696	CLIP-seq
MIRT2500181	hsa-miR-4720-5p	CLIP-seq
MIRT2500182	hsa-miR-4799-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	19668213, 20360068, 21988832, 25416956, 26496610, 31515488, 32296183, 32814053, 33961781, 34595750, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005680	Component	Anaphase-promoting complex	IBA
GO:0005680	Component	Anaphase-promoting complex	IDA	10922056, 16364912
GO:0005680	Component	Anaphase-promoting complex	IEA
GO:0005680	Component	Anaphase-promoting complex	IPI	27120157
GO:0005680	Component	Anaphase-promoting complex	NAS	27120157
GO:0005829	Component	Cytosol	TAS
GO:0007346	Process	Regulation of mitotic cell cycle	IBA
GO:0007346	Process	Regulation of mitotic cell cycle	NAS	15678131
GO:0016567	Process	Protein ubiquitination	IEA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IDA	29033132
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IEA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	NAS	15678131
GO:0051301	Process	Cell division	IEA
GO:0051445	Process	Regulation of meiotic cell cycle	NAS	15678131
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	29033132
GO:0070979	Process	Protein K11-linked ubiquitination	IBA
GO:0070979	Process	Protein K11-linked ubiquitination	IDA	18485873, 29033132
GO:0141198	Process	Protein branched polyubiquitination	IDA	29033132

Other IDs

• MIM: 614533
• HGNC: 17839
• e!Ensembl: ENSG00000176386

Protein

• UniProt ID: Q8NHZ8
• Protein name: Anaphase-promoting complex subunit CDC26 (Anaphase-promoting complex subunit 12) (APC12) (Cell division cycle protein 26 homolog)
• Protein function: Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle (PubMed:18485873). The APC/C complex acts by mediating ubiquit
• PDB: 3HYM , 4UI9 , 5A31 , 5G04 , 5G05 , 5KHR , 5KHU , 5L9T , 5L9U , 5LCW , 6Q6G , 6Q6H , 6TLJ , 6TM5 , 6TNT , 8PKP , 8TAR , 8TAU , 9GAW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10471	ANAPC_CDC26	1 → 81	Anaphase-promoting complex APC subunit CDC26	Family

• Sequence:

  MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQM
  INDRIGYKPQPKPNNRSSQFGSLEF

• Sequence length: 85

Pathways

KEGG Pathway	Reactome Pathway
Cell cycle	Inactivation of APC/C via direct inhibition of the APC/C complex
Oocyte meiosis	APC/C:Cdc20 mediated degradation of Cyclin B
Ubiquitin mediated proteolysis	Autodegradation of Cdh1 by Cdh1:APC/C
Progesterone-mediated oocyte maturation	APC/C:Cdc20 mediated degradation of Securin
Human T-cell leukemia virus 1 infection	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
	Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase
	Regulation of APC/C activators between G1/S and early anaphase
	APC/C:Cdc20 mediated degradation of mitotic proteins
	Phosphorylation of the APC/C
	APC-Cdc20 mediated degradation of Nek2A
	Separation of Sister Chromatids
	Senescence-Associated Secretory Phenotype (SASP)
	CDK-mediated phosphorylation and removal of Cdc6
	Transcriptional Regulation by VENTX
	Antigen processing: Ubiquitination & Proteasome degradation

Related Genes

Sort by: Blended Diseases Pathways Evidence source

ANAPC10 20 shared pathwaysCell cycle, Oocyte meiosis, Ubiquitin mediated proteolysis, Progesterone-mediated oocyte maturation, Human T-cell leukemia virus 1 infection, Separation of Sister Chromatids, Regulation of APC/C activators between G1/S and early anaphase, Senescence-Associated Secretory Phenotype (SASP), CDK-mediated phosphorylation and removal of Cdc6, Autodegradation of Cdh1 by Cdh1:APC/C, APC/C:Cdc20 mediated degradation of Securin, APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 +8 more Related via 20 shared pathways including Cell cycle, Oocyte meiosis. ANAPC16 20 shared pathwaysCell cycle, Oocyte meiosis, Ubiquitin mediated proteolysis, Progesterone-mediated oocyte maturation, Human T-cell leukemia virus 1 infection, Separation of Sister Chromatids, Regulation of APC/C activators between G1/S and early anaphase, Senescence-Associated Secretory Phenotype (SASP), CDK-mediated phosphorylation and removal of Cdc6, Autodegradation of Cdh1 by Cdh1:APC/C, APC/C:Cdc20 mediated degradation of Securin, APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 +8 more Related via 20 shared pathways including Cell cycle, Oocyte meiosis. ANAPC15 20 shared pathwaysCell cycle, Oocyte meiosis, Ubiquitin mediated proteolysis, Progesterone-mediated oocyte maturation, Human T-cell leukemia virus 1 infection, Separation of Sister Chromatids, Regulation of APC/C activators between G1/S and early anaphase, Senescence-Associated Secretory Phenotype (SASP), CDK-mediated phosphorylation and removal of Cdc6, Autodegradation of Cdh1 by Cdh1:APC/C, APC/C:Cdc20 mediated degradation of Securin, APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 +8 more Related via 20 shared pathways including Cell cycle, Oocyte meiosis. ANAPC2 20 shared pathwaysCell cycle, Oocyte meiosis, Ubiquitin mediated proteolysis, Progesterone-mediated oocyte maturation, Human T-cell leukemia virus 1 infection, Separation of Sister Chromatids, Regulation of APC/C activators between G1/S and early anaphase, Senescence-Associated Secretory Phenotype (SASP), CDK-mediated phosphorylation and removal of Cdc6, Autodegradation of Cdh1 by Cdh1:APC/C, APC/C:Cdc20 mediated degradation of Securin, APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 +8 more Related via 20 shared pathways including Cell cycle, Oocyte meiosis. ANAPC4 20 shared pathwaysCell cycle, Oocyte meiosis, Ubiquitin mediated proteolysis, Progesterone-mediated oocyte maturation, Human T-cell leukemia virus 1 infection, Separation of Sister Chromatids, Regulation of APC/C activators between G1/S and early anaphase, Senescence-Associated Secretory Phenotype (SASP), CDK-mediated phosphorylation and removal of Cdc6, Autodegradation of Cdh1 by Cdh1:APC/C, APC/C:Cdc20 mediated degradation of Securin, APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 +8 more Related via 20 shared pathways including Cell cycle, Oocyte meiosis.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ANAPC10	0	[]	20	["Cell cycle","Oocyte meiosis","Ubiquitin mediated proteolysis","Progesterone-mediated oocyte maturation","Human T-cell leukemia virus 1 infection","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1"]	0	[]
ANAPC16	0	[]	20	["Cell cycle","Oocyte meiosis","Ubiquitin mediated proteolysis","Progesterone-mediated oocyte maturation","Human T-cell leukemia virus 1 infection","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1"]	0	[]
ANAPC15	0	[]	20	["Cell cycle","Oocyte meiosis","Ubiquitin mediated proteolysis","Progesterone-mediated oocyte maturation","Human T-cell leukemia virus 1 infection","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1"]	0	[]
ANAPC2	0	[]	20	["Cell cycle","Oocyte meiosis","Ubiquitin mediated proteolysis","Progesterone-mediated oocyte maturation","Human T-cell leukemia virus 1 infection","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1"]	0	[]
ANAPC4	0	[]	20	["Cell cycle","Oocyte meiosis","Ubiquitin mediated proteolysis","Progesterone-mediated oocyte maturation","Human T-cell leukemia virus 1 infection","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1"]	0	[]

Diseases Linked via Similar Genes

Atrial fibrillation Linked via 2 of 5 related genesANAPC10, ANAPC4 Androgenetic alopecia Linked via 2 of 5 related genesANAPC2, ANAPC4 Alzheimer disease Linked via 1 of 5 related genesANAPC10 Irritable bowel syndrome Linked via 1 of 5 related genesANAPC10 Mayer-rokitansky-kuster-hauser syndrome Linked via 1 of 5 related genesANAPC10

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Atrial fibrillation	2	["ANAPC10","ANAPC4"]
Androgenetic alopecia	2	["ANAPC2","ANAPC4"]
Alzheimer disease	1	["ANAPC10"]
Irritable bowel syndrome	1	["ANAPC10"]
Mayer-rokitansky-kuster-hauser syndrome	1	["ANAPC10"]