Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	997
Gene name	Cell division cycle 34, ubiquitin conjugating enzyme
Gene symbol	CDC34
Synonyms (NCBI Gene)	E2-CDC34UBC3UBCH3UBE2R1
Chromosome	19
Chromosome location	19p13.3
Summary	The protein encoded by this gene is a member of the ubiquitin-conjugating enzyme family. Ubiquitin-conjugating enzyme catalyzes the covalent attachment of ubiquitin to other proteins. This protein is a part of the large multiprotein complex, which is requ

123 Show/Hide all (123)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001229	hsa-let-7b-5p	Luciferase reporter assayWestern blot	19126550
MIRT001229	hsa-let-7b-5p	Luciferase reporter assayWestern blot	19126550
MIRT001229	hsa-let-7b-5p	Luciferase reporter assay	19126550
MIRT001229	hsa-let-7b-5p	Luciferase reporter assay	19126550
MIRT001229	hsa-let-7b-5p	Luciferase reporter assay	19126550
MIRT001229	hsa-let-7b-5p	Microarray	17699775
MIRT006056	hsa-let-7a-5p	ImmunoblotqRT-PCRWestern blot	21252116
MIRT001229	hsa-let-7b-5p	ImmunoblotqRT-PCRWestern blot	21252116
MIRT006056	hsa-let-7a-5p	ImmunoblotqRT-PCRWestern blot	21252116
MIRT001229	hsa-let-7b-5p	ImmunoblotqRT-PCRWestern blot	21252116
MIRT006056	hsa-let-7a-5p	ImmunoblotqRT-PCRWestern blot	21252116
MIRT001229	hsa-let-7b-5p	ImmunoblotqRT-PCRWestern blot	21252116
MIRT027687	hsa-miR-98-5p	Microarray	19088304
MIRT041675	hsa-miR-484	CLASH	23622248
MIRT039748	hsa-miR-615-3p	CLASH	23622248
MIRT877352	hsa-let-7a	CLIP-seq
MIRT877353	hsa-let-7b	CLIP-seq
MIRT877354	hsa-let-7c	CLIP-seq
MIRT877355	hsa-let-7d	CLIP-seq
MIRT877356	hsa-let-7e	CLIP-seq
MIRT877357	hsa-let-7f	CLIP-seq
MIRT877358	hsa-let-7g	CLIP-seq
MIRT877359	hsa-let-7i	CLIP-seq
MIRT877360	hsa-miR-1287	CLIP-seq
MIRT877361	hsa-miR-1294	CLIP-seq
MIRT877362	hsa-miR-196a	CLIP-seq
MIRT877363	hsa-miR-196b	CLIP-seq
MIRT877364	hsa-miR-202	CLIP-seq
MIRT877365	hsa-miR-3135b	CLIP-seq
MIRT877366	hsa-miR-3144-5p	CLIP-seq
MIRT877367	hsa-miR-3173-3p	CLIP-seq
MIRT877368	hsa-miR-3174	CLIP-seq
MIRT877369	hsa-miR-330-3p	CLIP-seq
MIRT877370	hsa-miR-3605-3p	CLIP-seq
MIRT877371	hsa-miR-3664-5p	CLIP-seq
MIRT877372	hsa-miR-4428	CLIP-seq
MIRT877373	hsa-miR-4458	CLIP-seq
MIRT877374	hsa-miR-4500	CLIP-seq
MIRT877375	hsa-miR-4521	CLIP-seq
MIRT877376	hsa-miR-4668-5p	CLIP-seq
MIRT877377	hsa-miR-4778-5p	CLIP-seq
MIRT877378	hsa-miR-4785	CLIP-seq
MIRT877379	hsa-miR-4800-3p	CLIP-seq
MIRT877380	hsa-miR-483-5p	CLIP-seq
MIRT877381	hsa-miR-634	CLIP-seq
MIRT877382	hsa-miR-921	CLIP-seq
MIRT877383	hsa-miR-98	CLIP-seq
MIRT877352	hsa-let-7a	CLIP-seq
MIRT877353	hsa-let-7b	CLIP-seq
MIRT877354	hsa-let-7c	CLIP-seq
MIRT877355	hsa-let-7d	CLIP-seq
MIRT877356	hsa-let-7e	CLIP-seq
MIRT877357	hsa-let-7f	CLIP-seq
MIRT877358	hsa-let-7g	CLIP-seq
MIRT877359	hsa-let-7i	CLIP-seq
MIRT877361	hsa-miR-1294	CLIP-seq
MIRT877364	hsa-miR-202	CLIP-seq
MIRT877373	hsa-miR-4458	CLIP-seq
MIRT877374	hsa-miR-4500	CLIP-seq
MIRT877383	hsa-miR-98	CLIP-seq
MIRT877352	hsa-let-7a	CLIP-seq
MIRT877353	hsa-let-7b	CLIP-seq
MIRT877354	hsa-let-7c	CLIP-seq
MIRT877355	hsa-let-7d	CLIP-seq
MIRT877356	hsa-let-7e	CLIP-seq
MIRT877357	hsa-let-7f	CLIP-seq
MIRT877358	hsa-let-7g	CLIP-seq
MIRT877359	hsa-let-7i	CLIP-seq
MIRT877361	hsa-miR-1294	CLIP-seq
MIRT877364	hsa-miR-202	CLIP-seq
MIRT877367	hsa-miR-3173-3p	CLIP-seq
MIRT877368	hsa-miR-3174	CLIP-seq
MIRT877372	hsa-miR-4428	CLIP-seq
MIRT877373	hsa-miR-4458	CLIP-seq
MIRT877374	hsa-miR-4500	CLIP-seq
MIRT877375	hsa-miR-4521	CLIP-seq
MIRT877382	hsa-miR-921	CLIP-seq
MIRT877383	hsa-miR-98	CLIP-seq
MIRT877352	hsa-let-7a	CLIP-seq
MIRT877353	hsa-let-7b	CLIP-seq
MIRT877354	hsa-let-7c	CLIP-seq
MIRT877355	hsa-let-7d	CLIP-seq
MIRT877356	hsa-let-7e	CLIP-seq
MIRT877357	hsa-let-7f	CLIP-seq
MIRT877358	hsa-let-7g	CLIP-seq
MIRT877359	hsa-let-7i	CLIP-seq
MIRT2196933	hsa-miR-1244	CLIP-seq
MIRT877361	hsa-miR-1294	CLIP-seq
MIRT877362	hsa-miR-196a	CLIP-seq
MIRT877363	hsa-miR-196b	CLIP-seq
MIRT877364	hsa-miR-202	CLIP-seq
MIRT877367	hsa-miR-3173-3p	CLIP-seq
MIRT877368	hsa-miR-3174	CLIP-seq
MIRT877369	hsa-miR-330-3p	CLIP-seq
MIRT877370	hsa-miR-3605-3p	CLIP-seq
MIRT877372	hsa-miR-4428	CLIP-seq
MIRT877373	hsa-miR-4458	CLIP-seq
MIRT877374	hsa-miR-4500	CLIP-seq
MIRT877375	hsa-miR-4521	CLIP-seq
MIRT877376	hsa-miR-4668-5p	CLIP-seq
MIRT2196934	hsa-miR-4760-5p	CLIP-seq
MIRT877378	hsa-miR-4785	CLIP-seq
MIRT2196935	hsa-miR-607	CLIP-seq
MIRT877382	hsa-miR-921	CLIP-seq
MIRT877383	hsa-miR-98	CLIP-seq
MIRT877352	hsa-let-7a	CLIP-seq
MIRT877353	hsa-let-7b	CLIP-seq
MIRT877354	hsa-let-7c	CLIP-seq
MIRT877355	hsa-let-7d	CLIP-seq
MIRT877356	hsa-let-7e	CLIP-seq
MIRT877357	hsa-let-7f	CLIP-seq
MIRT877358	hsa-let-7g	CLIP-seq
MIRT877359	hsa-let-7i	CLIP-seq
MIRT877361	hsa-miR-1294	CLIP-seq
MIRT877364	hsa-miR-202	CLIP-seq
MIRT877367	hsa-miR-3173-3p	CLIP-seq
MIRT877368	hsa-miR-3174	CLIP-seq
MIRT877372	hsa-miR-4428	CLIP-seq
MIRT877373	hsa-miR-4458	CLIP-seq
MIRT877374	hsa-miR-4500	CLIP-seq
MIRT877375	hsa-miR-4521	CLIP-seq
MIRT877382	hsa-miR-921	CLIP-seq
MIRT877383	hsa-miR-98	CLIP-seq

Transcription factor	Regulation	Reference
MYC	Activation	21252116

29 Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	NAS	8248134
GO:0000166	Function	Nucleotide binding	IEA
GO:0000209	Process	Protein polyubiquitination	IBA
GO:0000209	Process	Protein polyubiquitination	IDA	20347421
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	10373550, 20061386, 20347421
GO:0004842	Function	Ubiquitin-protein transferase activity	NAS	8248134
GO:0005515	Function	Protein binding	IPI	10373550, 19945379, 25416956, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	8248134
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006270	Process	DNA replication initiation	NAS	8248134
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0016567	Process	Protein ubiquitination	IDA	10373550
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	NAS	8248134
GO:0016607	Component	Nuclear speck	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0035458	Process	Cellular response to interferon-beta	IMP	24882218
GO:0036211	Process	Protein modification process	NAS	8248134
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	10373550, 20347421
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IBA
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IDA	20061386
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IEA
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	20061386
GO:0070936	Process	Protein K48-linked ubiquitination	IEA

MIM	HGNC	e!Ensembl
116948	1734	ENSG00000099804

P49427

Protein name

Ubiquitin-conjugating enzyme E2 R1 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme R1) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme R1) (Ubiquitin-conjugating enzyme E2-32 kDa complementing) (Ubiquitin-conjugating enzyme E2-CDC34) (Ubiqu

Protein function

E2 ubiquitin-conjugating enzyme that accepts ubiquitin from an E1 ubiquitin-activating protein, and catalyzes its covalent attachment to other proteins by an E3 ubiquitin-protein ligase complex (PubMed:10329681, PubMed:17588522, PubMed:20061386,

PDB

2OB4 , 3RZ3 , 4MDK , 7M2K , 8RX0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00179	UQ_con	12 → 166	Ubiquitin-conjugating enzyme	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in testes during spermatogenesis to regulate repression of cAMP-induced transcription. {ECO:0000269|PubMed:10373550}.

Sequence

MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKA
RLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNV
RTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDG
VKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES

Sequence length

236

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Ubiquitin mediated proteolysis	Downstream TCR signaling
	FCERI mediated NF-kB activation
	CLEC7A (Dectin-1) signaling
	Synthesis of active ubiquitin: roles of E1 and E2 enzymes
	Antigen processing: Ubiquitination & Proteasome degradation

CDC34 (cell division cycle 34, ubiquitin conjugating enzyme)

Bookmark This Gene