UBE2E3 (ubiquitin conjugating enzyme E2 E3)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 10477
• Gene name: Ubiquitin conjugating enzyme E2 E3
• Gene symbol: UBE2E3
• Synonyms (NCBI Gene): UBCH9, UbcM2
• Chromosome: 2
• Chromosome location: 2q31.3
• Summary: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conju

miRNA Show/Hide all (137)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048393	hsa-miR-100-5p	CLASH	23622248
MIRT045204	hsa-miR-186-5p	CLASH	23622248
MIRT527083	hsa-miR-3662	PAR-CLIP	22012620
MIRT527082	hsa-miR-16-2-3p	PAR-CLIP	22012620
MIRT527081	hsa-miR-195-3p	PAR-CLIP	22012620
MIRT527080	hsa-miR-4639-5p	PAR-CLIP	22012620
MIRT527083	hsa-miR-3662	PAR-CLIP	22012620
MIRT527082	hsa-miR-16-2-3p	PAR-CLIP	22012620
MIRT527081	hsa-miR-195-3p	PAR-CLIP	22012620
MIRT527080	hsa-miR-4639-5p	PAR-CLIP	22012620
MIRT1467440	hsa-miR-1283	CLIP-seq
MIRT1467441	hsa-miR-139-5p	CLIP-seq
MIRT1467442	hsa-miR-3129-3p	CLIP-seq
MIRT1467443	hsa-miR-3168	CLIP-seq
MIRT1467444	hsa-miR-3186-5p	CLIP-seq
MIRT1467445	hsa-miR-3529	CLIP-seq
MIRT1467446	hsa-miR-369-3p	CLIP-seq
MIRT1467447	hsa-miR-374a	CLIP-seq
MIRT1467448	hsa-miR-374b	CLIP-seq
MIRT1467449	hsa-miR-374c	CLIP-seq
MIRT1467450	hsa-miR-379	CLIP-seq
MIRT1467451	hsa-miR-384	CLIP-seq
MIRT1467452	hsa-miR-4436a	CLIP-seq
MIRT1467453	hsa-miR-4451	CLIP-seq
MIRT1467454	hsa-miR-4650-3p	CLIP-seq
MIRT1467455	hsa-miR-4672	CLIP-seq
MIRT1467456	hsa-miR-4789-5p	CLIP-seq
MIRT1467457	hsa-miR-4803	CLIP-seq
MIRT1467458	hsa-miR-485-3p	CLIP-seq
MIRT1467459	hsa-miR-520d-5p	CLIP-seq
MIRT1467460	hsa-miR-524-5p	CLIP-seq
MIRT1467461	hsa-miR-629	CLIP-seq
MIRT1467462	hsa-miR-655	CLIP-seq
MIRT1467441	hsa-miR-139-5p	CLIP-seq
MIRT1467451	hsa-miR-384	CLIP-seq
MIRT2140478	hsa-miR-510	CLIP-seq
MIRT2140479	hsa-miR-512-5p	CLIP-seq
MIRT1467459	hsa-miR-520d-5p	CLIP-seq
MIRT1467460	hsa-miR-524-5p	CLIP-seq
MIRT1467440	hsa-miR-1283	CLIP-seq
MIRT1467441	hsa-miR-139-5p	CLIP-seq
MIRT2361237	hsa-miR-499-3p	CLIP-seq
MIRT2361238	hsa-miR-499a-3p	CLIP-seq
MIRT1467459	hsa-miR-520d-5p	CLIP-seq
MIRT1467460	hsa-miR-524-5p	CLIP-seq
MIRT2434414	hsa-miR-125a-3p	CLIP-seq
MIRT1467440	hsa-miR-1283	CLIP-seq
MIRT1467441	hsa-miR-139-5p	CLIP-seq
MIRT1467442	hsa-miR-3129-3p	CLIP-seq
MIRT1467444	hsa-miR-3186-5p	CLIP-seq
MIRT1467451	hsa-miR-384	CLIP-seq
MIRT2434415	hsa-miR-3907	CLIP-seq
MIRT2434416	hsa-miR-3921	CLIP-seq
MIRT2434417	hsa-miR-3934	CLIP-seq
MIRT2434418	hsa-miR-4303	CLIP-seq
MIRT2434419	hsa-miR-4653-5p	CLIP-seq
MIRT1467457	hsa-miR-4803	CLIP-seq
MIRT1467458	hsa-miR-485-3p	CLIP-seq
MIRT2361237	hsa-miR-499-3p	CLIP-seq
MIRT2361238	hsa-miR-499a-3p	CLIP-seq
MIRT1467459	hsa-miR-520d-5p	CLIP-seq
MIRT1467460	hsa-miR-524-5p	CLIP-seq
MIRT2434420	hsa-miR-610	CLIP-seq
MIRT2434421	hsa-miR-764	CLIP-seq
MIRT2441582	hsa-miR-548ag	CLIP-seq
MIRT2441583	hsa-miR-548ai	CLIP-seq
MIRT2441584	hsa-miR-548m	CLIP-seq
MIRT1467441	hsa-miR-139-5p	CLIP-seq
MIRT2655062	hsa-miR-3121-3p	CLIP-seq
MIRT1467445	hsa-miR-3529	CLIP-seq
MIRT2655063	hsa-miR-362-5p	CLIP-seq
MIRT1467446	hsa-miR-369-3p	CLIP-seq
MIRT1467447	hsa-miR-374a	CLIP-seq
MIRT1467448	hsa-miR-374b	CLIP-seq
MIRT1467449	hsa-miR-374c	CLIP-seq
MIRT1467450	hsa-miR-379	CLIP-seq
MIRT1467451	hsa-miR-384	CLIP-seq
MIRT1467452	hsa-miR-4436a	CLIP-seq
MIRT1467453	hsa-miR-4451	CLIP-seq
MIRT2655064	hsa-miR-451b	CLIP-seq
MIRT1467454	hsa-miR-4650-3p	CLIP-seq
MIRT2655065	hsa-miR-4696	CLIP-seq
MIRT2655066	hsa-miR-4719	CLIP-seq
MIRT2655067	hsa-miR-4733-5p	CLIP-seq
MIRT1467458	hsa-miR-485-3p	CLIP-seq
MIRT2361237	hsa-miR-499-3p	CLIP-seq
MIRT2361238	hsa-miR-499a-3p	CLIP-seq
MIRT2655068	hsa-miR-500b	CLIP-seq
MIRT2655069	hsa-miR-501-5p	CLIP-seq
MIRT2655070	hsa-miR-5096	CLIP-seq
MIRT2140478	hsa-miR-510	CLIP-seq
MIRT2140479	hsa-miR-512-5p	CLIP-seq
MIRT2655071	hsa-miR-513b	CLIP-seq
MIRT2441582	hsa-miR-548ag	CLIP-seq
MIRT2441583	hsa-miR-548ai	CLIP-seq
MIRT2441584	hsa-miR-548m	CLIP-seq
MIRT1467461	hsa-miR-629	CLIP-seq
MIRT1467462	hsa-miR-655	CLIP-seq
MIRT2361237	hsa-miR-499-3p	CLIP-seq
MIRT2361238	hsa-miR-499a-3p	CLIP-seq
MIRT2441582	hsa-miR-548ag	CLIP-seq
MIRT2441583	hsa-miR-548ai	CLIP-seq
MIRT2441584	hsa-miR-548m	CLIP-seq
MIRT1467441	hsa-miR-139-5p	CLIP-seq
MIRT2655062	hsa-miR-3121-3p	CLIP-seq
MIRT1467445	hsa-miR-3529	CLIP-seq
MIRT2655063	hsa-miR-362-5p	CLIP-seq
MIRT1467446	hsa-miR-369-3p	CLIP-seq
MIRT1467447	hsa-miR-374a	CLIP-seq
MIRT1467448	hsa-miR-374b	CLIP-seq
MIRT1467449	hsa-miR-374c	CLIP-seq
MIRT1467450	hsa-miR-379	CLIP-seq
MIRT1467451	hsa-miR-384	CLIP-seq
MIRT1467452	hsa-miR-4436a	CLIP-seq
MIRT1467453	hsa-miR-4451	CLIP-seq
MIRT1467454	hsa-miR-4650-3p	CLIP-seq
MIRT2655066	hsa-miR-4719	CLIP-seq
MIRT2655067	hsa-miR-4733-5p	CLIP-seq
MIRT1467458	hsa-miR-485-3p	CLIP-seq
MIRT2361237	hsa-miR-499-3p	CLIP-seq
MIRT2361238	hsa-miR-499a-3p	CLIP-seq
MIRT2655068	hsa-miR-500b	CLIP-seq
MIRT2655069	hsa-miR-501-5p	CLIP-seq
MIRT2655070	hsa-miR-5096	CLIP-seq
MIRT2140478	hsa-miR-510	CLIP-seq
MIRT2140479	hsa-miR-512-5p	CLIP-seq
MIRT2655071	hsa-miR-513b	CLIP-seq
MIRT2441582	hsa-miR-548ag	CLIP-seq
MIRT2441583	hsa-miR-548ai	CLIP-seq
MIRT2441584	hsa-miR-548m	CLIP-seq
MIRT1467461	hsa-miR-629	CLIP-seq
MIRT1467462	hsa-miR-655	CLIP-seq
MIRT2361237	hsa-miR-499-3p	CLIP-seq
MIRT2361238	hsa-miR-499a-3p	CLIP-seq
MIRT2441582	hsa-miR-548ag	CLIP-seq
MIRT2441583	hsa-miR-548ai	CLIP-seq
MIRT2441584	hsa-miR-548m	CLIP-seq

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	20061386
GO:0005515	Function	Protein binding	IPI	14667819, 16713569, 19549727, 19690564, 25416956, 26752685, 28514442, 31515488, 32296183, 32814053, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006513	Process	Protein monoubiquitination	IDA	27237050
GO:0006513	Process	Protein monoubiquitination	IEA
GO:0010629	Process	Negative regulation of gene expression	IDA	39096901
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IBA
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IDA	27237050
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IEA
GO:0070534	Process	Protein K63-linked ubiquitination	IBA
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	20061386
GO:0070936	Process	Protein K48-linked ubiquitination	IBA
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	20061386
GO:0070936	Process	Protein K48-linked ubiquitination	IEA
GO:0070979	Process	Protein K11-linked ubiquitination	IBA
GO:0070979	Process	Protein K11-linked ubiquitination	IDA	20061386

Other IDs

• MIM: 604151
• HGNC: 12479
• e!Ensembl: ENSG00000170035

Protein

• UniProt ID: Q969T4
• Protein name: Ubiquitin-conjugating enzyme E2 E3 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme E3) (UbcH9) (Ubiquitin carrier protein E3) (Ubiquitin-conjugating enzyme E2-23 kDa) (Ubiquitin-protein ligase E3)
• Protein function: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Participates in the regulation of transepithelial sodium tr
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00179	UQ_con	65 → 202	Ubiquitin-conjugating enzyme	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed at low levels. Highly expressed in skeletal muscle. {ECO:0000269|PubMed:10343118}.
• Sequence:

  MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLS
  TSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDY
  PFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLV
  GSIATQYLTNRAEHDRIARQWTKRYAT

• Sequence length: 207

Pathways

KEGG Pathway	Reactome Pathway
Ubiquitin mediated proteolysis	Synthesis of active ubiquitin: roles of E1 and E2 enzymes
	Antigen processing: Ubiquitination & Proteasome degradation

Related Genes

Sort by: Blended Diseases Pathways Evidence source

UBE2S 2 shared pathwaysUbiquitin mediated proteolysis, Synthesis of active ubiquitin: roles of E1 and E2 enzymes Related via 2 shared pathways including Ubiquitin mediated proteolysis, Synthesis of active ubiquitin: roles of E1 and E2 enzymes. UBE2K 2 shared pathwaysUbiquitin mediated proteolysis, Synthesis of active ubiquitin: roles of E1 and E2 enzymes Related via 2 shared pathways including Ubiquitin mediated proteolysis, Synthesis of active ubiquitin: roles of E1 and E2 enzymes. UBE2R2 2 shared pathwaysUbiquitin mediated proteolysis, Synthesis of active ubiquitin: roles of E1 and E2 enzymes Related via 2 shared pathways including Ubiquitin mediated proteolysis, Synthesis of active ubiquitin: roles of E1 and E2 enzymes. UBA6 2 shared pathwaysUbiquitin mediated proteolysis, Synthesis of active ubiquitin: roles of E1 and E2 enzymes Related via 2 shared pathways including Ubiquitin mediated proteolysis, Synthesis of active ubiquitin: roles of E1 and E2 enzymes. UBE2W 2 shared pathwaysUbiquitin mediated proteolysis, Synthesis of active ubiquitin: roles of E1 and E2 enzymes Related via 2 shared pathways including Ubiquitin mediated proteolysis, Synthesis of active ubiquitin: roles of E1 and E2 enzymes.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
UBE2S	0	[]	2	["Ubiquitin mediated proteolysis","Synthesis of active ubiquitin: roles of E1 and E2 enzymes"]	0	[]
UBE2K	0	[]	2	["Ubiquitin mediated proteolysis","Synthesis of active ubiquitin: roles of E1 and E2 enzymes"]	0	[]
UBE2R2	0	[]	2	["Ubiquitin mediated proteolysis","Synthesis of active ubiquitin: roles of E1 and E2 enzymes"]	0	[]
UBA6	0	[]	2	["Ubiquitin mediated proteolysis","Synthesis of active ubiquitin: roles of E1 and E2 enzymes"]	0	[]
UBE2W	0	[]	2	["Ubiquitin mediated proteolysis","Synthesis of active ubiquitin: roles of E1 and E2 enzymes"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 3 of 5 related genesUBE2S, UBE2K, UBE2W Color vision deficiency Linked via 2 of 5 related genesUBE2K, UBE2W Diabetes mellitus type 2 Linked via 2 of 5 related genesUBE2R2, UBE2W Stroke Linked via 1 of 5 related genesUBE2S Endocrine system disease Linked via 1 of 5 related genesUBE2K

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	3	["UBE2S","UBE2K","UBE2W"]
Color vision deficiency	2	["UBE2K","UBE2W"]
Diabetes mellitus type 2	2	["UBE2R2","UBE2W"]
Stroke	1	["UBE2S"]
Endocrine system disease	1	["UBE2K"]