Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5985
Gene name	Replication factor C subunit 5
Gene symbol	RFC5
Synonyms (NCBI Gene)	RFC36
Chromosome	12
Chromosome location	12q24.23
Summary	This gene encodes the smallest subunit of the replication factor C complex, which consists of five distinct subunits (140, 40, 38, 37, and 36 kDa) and is required for DNA replication. This subunit interacts with the C-terminal region of proliferating cell

259 Show/Hide all (259)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016278	hsa-miR-193b-3p	Microarray	20304954
MIRT023584	hsa-miR-1-3p	Proteomics	18668040
MIRT042743	hsa-miR-339-5p	CLASH	23622248
MIRT573327	hsa-miR-6856-3p	PAR-CLIP	20371350
MIRT573326	hsa-miR-4323	PAR-CLIP	20371350
MIRT573324	hsa-miR-4514	PAR-CLIP	20371350
MIRT573325	hsa-miR-4692	PAR-CLIP	20371350
MIRT573323	hsa-miR-6729-3p	PAR-CLIP	20371350
MIRT573322	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT573321	hsa-miR-4673	PAR-CLIP	20371350
MIRT573319	hsa-miR-4513	PAR-CLIP	20371350
MIRT573320	hsa-miR-6855-3p	PAR-CLIP	20371350
MIRT573318	hsa-miR-6857-3p	PAR-CLIP	20371350
MIRT573317	hsa-miR-134-5p	PAR-CLIP	20371350
MIRT573316	hsa-miR-3118	PAR-CLIP	20371350
MIRT573315	hsa-miR-188-3p	PAR-CLIP	20371350
MIRT573314	hsa-miR-3136-5p	PAR-CLIP	20371350
MIRT573313	hsa-miR-4439	PAR-CLIP	20371350
MIRT573312	hsa-miR-3151-3p	PAR-CLIP	20371350
MIRT573317	hsa-miR-134-5p	PAR-CLIP	27292025
MIRT573317	hsa-miR-134-5p	PAR-CLIP	27292025
MIRT573317	hsa-miR-134-5p	PAR-CLIP	27292025
MIRT573317	hsa-miR-134-5p	PAR-CLIP	27292025
MIRT573317	hsa-miR-134-5p	PAR-CLIP	27292025
MIRT573317	hsa-miR-134-5p	PAR-CLIP	27292025
MIRT573317	hsa-miR-134-5p	PAR-CLIP	27292025
MIRT573315	hsa-miR-188-3p	PAR-CLIP	27292025
MIRT573315	hsa-miR-188-3p	PAR-CLIP	27292025
MIRT573315	hsa-miR-188-3p	PAR-CLIP	27292025
MIRT573315	hsa-miR-188-3p	PAR-CLIP	27292025
MIRT573315	hsa-miR-188-3p	PAR-CLIP	27292025
MIRT573315	hsa-miR-188-3p	PAR-CLIP	27292025
MIRT573315	hsa-miR-188-3p	PAR-CLIP	27292025
MIRT573316	hsa-miR-3118	PAR-CLIP	27292025
MIRT573316	hsa-miR-3118	PAR-CLIP	27292025
MIRT573316	hsa-miR-3118	PAR-CLIP	27292025
MIRT573316	hsa-miR-3118	PAR-CLIP	27292025
MIRT573316	hsa-miR-3118	PAR-CLIP	27292025
MIRT573316	hsa-miR-3118	PAR-CLIP	27292025
MIRT573316	hsa-miR-3118	PAR-CLIP	27292025
MIRT573314	hsa-miR-3136-5p	PAR-CLIP	27292025
MIRT573314	hsa-miR-3136-5p	PAR-CLIP	27292025
MIRT573314	hsa-miR-3136-5p	PAR-CLIP	27292025
MIRT573314	hsa-miR-3136-5p	PAR-CLIP	27292025
MIRT573314	hsa-miR-3136-5p	PAR-CLIP	27292025
MIRT573314	hsa-miR-3136-5p	PAR-CLIP	27292025
MIRT573314	hsa-miR-3136-5p	PAR-CLIP	27292025
MIRT573312	hsa-miR-3151-3p	PAR-CLIP	27292025
MIRT573312	hsa-miR-3151-3p	PAR-CLIP	27292025
MIRT573312	hsa-miR-3151-3p	PAR-CLIP	27292025
MIRT573312	hsa-miR-3151-3p	PAR-CLIP	27292025
MIRT573312	hsa-miR-3151-3p	PAR-CLIP	27292025
MIRT573312	hsa-miR-3151-3p	PAR-CLIP	27292025
MIRT573312	hsa-miR-3151-3p	PAR-CLIP	27292025
MIRT573326	hsa-miR-4323	PAR-CLIP	27292025
MIRT573326	hsa-miR-4323	PAR-CLIP	27292025
MIRT573326	hsa-miR-4323	PAR-CLIP	27292025
MIRT573326	hsa-miR-4323	PAR-CLIP	27292025
MIRT573326	hsa-miR-4323	PAR-CLIP	27292025
MIRT573326	hsa-miR-4323	PAR-CLIP	27292025
MIRT573326	hsa-miR-4323	PAR-CLIP	27292025
MIRT573313	hsa-miR-4439	PAR-CLIP	27292025
MIRT573313	hsa-miR-4439	PAR-CLIP	27292025
MIRT573313	hsa-miR-4439	PAR-CLIP	27292025
MIRT573313	hsa-miR-4439	PAR-CLIP	27292025
MIRT573313	hsa-miR-4439	PAR-CLIP	27292025
MIRT573313	hsa-miR-4439	PAR-CLIP	27292025
MIRT573313	hsa-miR-4439	PAR-CLIP	27292025
MIRT573319	hsa-miR-4513	PAR-CLIP	27292025
MIRT573319	hsa-miR-4513	PAR-CLIP	27292025
MIRT573319	hsa-miR-4513	PAR-CLIP	27292025
MIRT573319	hsa-miR-4513	PAR-CLIP	27292025
MIRT573319	hsa-miR-4513	PAR-CLIP	27292025
MIRT573319	hsa-miR-4513	PAR-CLIP	27292025
MIRT573319	hsa-miR-4513	PAR-CLIP	27292025
MIRT573324	hsa-miR-4514	PAR-CLIP	27292025
MIRT573324	hsa-miR-4514	PAR-CLIP	27292025
MIRT573324	hsa-miR-4514	PAR-CLIP	27292025
MIRT573324	hsa-miR-4514	PAR-CLIP	27292025
MIRT573324	hsa-miR-4514	PAR-CLIP	27292025
MIRT573324	hsa-miR-4514	PAR-CLIP	27292025
MIRT573324	hsa-miR-4514	PAR-CLIP	27292025
MIRT573322	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT573322	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT573322	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT573322	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT573322	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT573322	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT573322	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT573321	hsa-miR-4673	PAR-CLIP	27292025
MIRT573321	hsa-miR-4673	PAR-CLIP	27292025
MIRT573321	hsa-miR-4673	PAR-CLIP	27292025
MIRT573321	hsa-miR-4673	PAR-CLIP	27292025
MIRT573321	hsa-miR-4673	PAR-CLIP	27292025
MIRT573321	hsa-miR-4673	PAR-CLIP	27292025
MIRT573321	hsa-miR-4673	PAR-CLIP	27292025
MIRT573325	hsa-miR-4692	PAR-CLIP	27292025
MIRT573325	hsa-miR-4692	PAR-CLIP	27292025
MIRT573325	hsa-miR-4692	PAR-CLIP	27292025
MIRT573325	hsa-miR-4692	PAR-CLIP	27292025
MIRT573325	hsa-miR-4692	PAR-CLIP	27292025
MIRT573325	hsa-miR-4692	PAR-CLIP	27292025
MIRT573325	hsa-miR-4692	PAR-CLIP	27292025
MIRT573323	hsa-miR-6729-3p	PAR-CLIP	27292025
MIRT573323	hsa-miR-6729-3p	PAR-CLIP	27292025
MIRT573323	hsa-miR-6729-3p	PAR-CLIP	27292025
MIRT573323	hsa-miR-6729-3p	PAR-CLIP	27292025
MIRT573323	hsa-miR-6729-3p	PAR-CLIP	27292025
MIRT573323	hsa-miR-6729-3p	PAR-CLIP	27292025
MIRT573323	hsa-miR-6729-3p	PAR-CLIP	27292025
MIRT573320	hsa-miR-6855-3p	PAR-CLIP	27292025
MIRT573320	hsa-miR-6855-3p	PAR-CLIP	27292025
MIRT573320	hsa-miR-6855-3p	PAR-CLIP	27292025
MIRT573320	hsa-miR-6855-3p	PAR-CLIP	27292025
MIRT573320	hsa-miR-6855-3p	PAR-CLIP	27292025
MIRT573320	hsa-miR-6855-3p	PAR-CLIP	27292025
MIRT573320	hsa-miR-6855-3p	PAR-CLIP	27292025
MIRT573327	hsa-miR-6856-3p	PAR-CLIP	27292025
MIRT573327	hsa-miR-6856-3p	PAR-CLIP	27292025
MIRT573327	hsa-miR-6856-3p	PAR-CLIP	27292025
MIRT573327	hsa-miR-6856-3p	PAR-CLIP	27292025
MIRT573327	hsa-miR-6856-3p	PAR-CLIP	27292025
MIRT573327	hsa-miR-6856-3p	PAR-CLIP	27292025
MIRT573327	hsa-miR-6856-3p	PAR-CLIP	27292025
MIRT573318	hsa-miR-6857-3p	PAR-CLIP	27292025
MIRT573318	hsa-miR-6857-3p	PAR-CLIP	27292025
MIRT573318	hsa-miR-6857-3p	PAR-CLIP	27292025
MIRT573318	hsa-miR-6857-3p	PAR-CLIP	27292025
MIRT573318	hsa-miR-6857-3p	PAR-CLIP	27292025
MIRT573318	hsa-miR-6857-3p	PAR-CLIP	27292025
MIRT573318	hsa-miR-6857-3p	PAR-CLIP	27292025
MIRT573327	hsa-miR-6856-3p	PAR-CLIP	20371350
MIRT573326	hsa-miR-4323	PAR-CLIP	20371350
MIRT573324	hsa-miR-4514	PAR-CLIP	20371350
MIRT573325	hsa-miR-4692	PAR-CLIP	20371350
MIRT573323	hsa-miR-6729-3p	PAR-CLIP	20371350
MIRT573322	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT573321	hsa-miR-4673	PAR-CLIP	20371350
MIRT573319	hsa-miR-4513	PAR-CLIP	20371350
MIRT573320	hsa-miR-6855-3p	PAR-CLIP	20371350
MIRT573318	hsa-miR-6857-3p	PAR-CLIP	20371350
MIRT573317	hsa-miR-134-5p	PAR-CLIP	20371350
MIRT573316	hsa-miR-3118	PAR-CLIP	20371350
MIRT573315	hsa-miR-188-3p	PAR-CLIP	20371350
MIRT573314	hsa-miR-3136-5p	PAR-CLIP	20371350
MIRT573313	hsa-miR-4439	PAR-CLIP	20371350
MIRT573312	hsa-miR-3151-3p	PAR-CLIP	20371350
MIRT1301607	hsa-miR-1976	CLIP-seq
MIRT1301608	hsa-miR-299-5p	CLIP-seq
MIRT1301609	hsa-miR-3155	CLIP-seq
MIRT1301610	hsa-miR-3155b	CLIP-seq
MIRT1301611	hsa-miR-3168	CLIP-seq
MIRT1301612	hsa-miR-4277	CLIP-seq
MIRT1301613	hsa-miR-4464	CLIP-seq
MIRT1301614	hsa-miR-4714-3p	CLIP-seq
MIRT1301615	hsa-miR-4748	CLIP-seq
MIRT1301616	hsa-miR-484	CLIP-seq
MIRT1301617	hsa-miR-570	CLIP-seq
MIRT1301618	hsa-miR-582-5p	CLIP-seq
MIRT1301619	hsa-miR-1225-3p	CLIP-seq
MIRT1301620	hsa-miR-1233	CLIP-seq
MIRT1301621	hsa-miR-1257	CLIP-seq
MIRT1301622	hsa-miR-125a-5p	CLIP-seq
MIRT1301623	hsa-miR-125b	CLIP-seq
MIRT1301624	hsa-miR-150	CLIP-seq
MIRT1301625	hsa-miR-2117	CLIP-seq
MIRT1301626	hsa-miR-219-2-3p	CLIP-seq
MIRT1301608	hsa-miR-299-5p	CLIP-seq
MIRT1301609	hsa-miR-3155	CLIP-seq
MIRT1301610	hsa-miR-3155b	CLIP-seq
MIRT1301611	hsa-miR-3168	CLIP-seq
MIRT1301627	hsa-miR-3611	CLIP-seq
MIRT1301628	hsa-miR-4251	CLIP-seq
MIRT1301629	hsa-miR-4273	CLIP-seq
MIRT1301612	hsa-miR-4277	CLIP-seq
MIRT1301630	hsa-miR-4319	CLIP-seq
MIRT1301631	hsa-miR-4324	CLIP-seq
MIRT1301613	hsa-miR-4464	CLIP-seq
MIRT1301632	hsa-miR-4663	CLIP-seq
MIRT1301633	hsa-miR-4713-5p	CLIP-seq
MIRT1301614	hsa-miR-4714-3p	CLIP-seq
MIRT1301615	hsa-miR-4748	CLIP-seq
MIRT1301616	hsa-miR-484	CLIP-seq
MIRT1301634	hsa-miR-532-3p	CLIP-seq
MIRT1301635	hsa-miR-580	CLIP-seq
MIRT1301618	hsa-miR-582-5p	CLIP-seq
MIRT1301636	hsa-miR-103a	CLIP-seq
MIRT1301637	hsa-miR-105	CLIP-seq
MIRT1301638	hsa-miR-107	CLIP-seq
MIRT1301619	hsa-miR-1225-3p	CLIP-seq
MIRT1301620	hsa-miR-1233	CLIP-seq
MIRT1301622	hsa-miR-125a-5p	CLIP-seq
MIRT1301623	hsa-miR-125b	CLIP-seq
MIRT1301639	hsa-miR-1264	CLIP-seq
MIRT1301640	hsa-miR-142-5p	CLIP-seq
MIRT1301624	hsa-miR-150	CLIP-seq
MIRT1301641	hsa-miR-186	CLIP-seq
MIRT1301642	hsa-miR-194	CLIP-seq
MIRT1301625	hsa-miR-2117	CLIP-seq
MIRT1301626	hsa-miR-219-2-3p	CLIP-seq
MIRT1301608	hsa-miR-299-5p	CLIP-seq
MIRT1301643	hsa-miR-3133	CLIP-seq
MIRT1301609	hsa-miR-3155	CLIP-seq
MIRT1301610	hsa-miR-3155b	CLIP-seq
MIRT1301611	hsa-miR-3168	CLIP-seq
MIRT1301644	hsa-miR-3180-5p	CLIP-seq
MIRT1301645	hsa-miR-3182	CLIP-seq
MIRT1301646	hsa-miR-3194-5p	CLIP-seq
MIRT1301647	hsa-miR-340	CLIP-seq
MIRT1301648	hsa-miR-3607-3p	CLIP-seq
MIRT1301649	hsa-miR-3614-5p	CLIP-seq
MIRT1301650	hsa-miR-3619-3p	CLIP-seq
MIRT1301651	hsa-miR-3690	CLIP-seq
MIRT1301652	hsa-miR-3909	CLIP-seq
MIRT1301653	hsa-miR-3938	CLIP-seq
MIRT1301628	hsa-miR-4251	CLIP-seq
MIRT1301654	hsa-miR-4254	CLIP-seq
MIRT1301629	hsa-miR-4273	CLIP-seq
MIRT1301630	hsa-miR-4319	CLIP-seq
MIRT1301631	hsa-miR-4324	CLIP-seq
MIRT1301655	hsa-miR-4459	CLIP-seq
MIRT1301613	hsa-miR-4464	CLIP-seq
MIRT1301656	hsa-miR-4521	CLIP-seq
MIRT1301657	hsa-miR-4535	CLIP-seq
MIRT1301658	hsa-miR-4652-3p	CLIP-seq
MIRT1301632	hsa-miR-4663	CLIP-seq
MIRT1301659	hsa-miR-4695-5p	CLIP-seq
MIRT1301660	hsa-miR-4698	CLIP-seq
MIRT1301633	hsa-miR-4713-5p	CLIP-seq
MIRT1301614	hsa-miR-4714-3p	CLIP-seq
MIRT1301661	hsa-miR-4718	CLIP-seq
MIRT1301662	hsa-miR-4719	CLIP-seq
MIRT1301615	hsa-miR-4748	CLIP-seq
MIRT1301663	hsa-miR-4776-5p	CLIP-seq
MIRT1301664	hsa-miR-4795-3p	CLIP-seq
MIRT1301616	hsa-miR-484	CLIP-seq
MIRT1301665	hsa-miR-485-5p	CLIP-seq
MIRT1301666	hsa-miR-513a-3p	CLIP-seq
MIRT1301667	hsa-miR-520a-5p	CLIP-seq
MIRT1301668	hsa-miR-525-5p	CLIP-seq
MIRT1301634	hsa-miR-532-3p	CLIP-seq
MIRT1301635	hsa-miR-580	CLIP-seq
MIRT1301618	hsa-miR-582-5p	CLIP-seq
MIRT1301669	hsa-miR-665	CLIP-seq
MIRT1301670	hsa-miR-670	CLIP-seq
MIRT1301671	hsa-miR-7	CLIP-seq
MIRT1301672	hsa-miR-890	CLIP-seq
MIRT2689676	hsa-miR-4522	CLIP-seq
MIRT1301636	hsa-miR-103a	CLIP-seq
MIRT1301637	hsa-miR-105	CLIP-seq
MIRT1301638	hsa-miR-107	CLIP-seq
MIRT2689677	hsa-miR-3130-5p	CLIP-seq
MIRT1301648	hsa-miR-3607-3p	CLIP-seq
MIRT2689678	hsa-miR-4477b	CLIP-seq
MIRT2689679	hsa-miR-4482	CLIP-seq
MIRT2689680	hsa-miR-4715-3p	CLIP-seq
MIRT1301661	hsa-miR-4718	CLIP-seq
MIRT1301662	hsa-miR-4719	CLIP-seq
MIRT2689681	hsa-miR-656	CLIP-seq

25 Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003689	Function	DNA clamp loader activity	IBA
GO:0003689	Function	DNA clamp loader activity	IDA	12930902
GO:0005515	Function	Protein binding	IPI	9488738, 16189514, 25416956, 28514442, 29892012, 30021884, 31515488, 32296183, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005663	Component	DNA replication factor C complex	IBA
GO:0005663	Component	DNA replication factor C complex	IDA	9488738
GO:0005663	Component	DNA replication factor C complex	IPI	9488738
GO:0005694	Component	Chromosome	IEA
GO:0006260	Process	DNA replication	IEA
GO:0006260	Process	DNA replication	NAS	8999859
GO:0006261	Process	DNA-templated DNA replication	IBA
GO:0006261	Process	DNA-templated DNA replication	IDA	9488738
GO:0006281	Process	DNA repair	IBA
GO:0006281	Process	DNA repair	NAS	8999859
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0017116	Function	Single-stranded DNA helicase activity	IDA	12930902
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	NAS	8999859
GO:0031390	Component	Ctf18 RFC-like complex	IDA	12930902
GO:1900264	Process	Positive regulation of DNA-directed DNA polymerase activity	IDA	12930902

MIM	HGNC	e!Ensembl
600407	9973	ENSG00000111445

P40937

Protein name

Replication factor C subunit 5 (Activator 1 36 kDa subunit) (A1 36 kDa subunit) (Activator 1 subunit 5) (Replication factor C 36 kDa subunit) (RF-C 36 kDa subunit) (RFC36)

Protein function

Subunit of the replication factor C (RFC) complex which acts during elongation of primed DNA templates by DNA polymerases delta and epsilon, and is necessary for ATP-dependent loading of proliferating cell nuclear antigen (PCNA) onto primed DNA.

PDB

6VVO , 7Z6H , 8UI7 , 8UI8 , 8UI9 , 8UII , 8UMT , 8UMU , 8UMV , 8UMW , 8UMY , 8UN0 , 8UNJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00004	AAA	56 → 177	ATPase family associated with various cellular activities (AAA)	Domain
PF08542	Rep_fac_C	242 → 328	Replication factor C C-terminal domain	Domain

Sequence

METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINEDRLPHLLLYG
PPGTGKTSTILACAKQLYKDKEFGSMVLELNASDDRGIDIIRGPILSFASTRTIFKKGFK
LVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPE
LMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTG
HPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIH
LLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA

Sequence length

340

Interactions

View interactions

KEGG Pathway	Reactome Pathway
DNA replication	Translesion synthesis by REV1
Base excision repair	Recognition of DNA damage by PCNA-containing replication complex
Nucleotide excision repair	Translesion Synthesis by POLH
Mismatch repair	Polymerase switching on the C-strand of the telomere
	Activation of ATR in response to replication stress
	PCNA-Dependent Long Patch Base Excision Repair
	Translesion synthesis by POLK
	Translesion synthesis by POLI
	Termination of translesion DNA synthesis
	HDR through Single Strand Annealing (SSA)
	HDR through Homologous Recombination (HRR)
	Processing of DNA double-strand break ends
	Presynaptic phase of homologous DNA pairing and strand exchange
	Gap-filling DNA repair synthesis and ligation in GG-NER
	Dual Incision in GG-NER
	Dual incision in TC-NER
	Gap-filling DNA repair synthesis and ligation in TC-NER
	Regulation of TP53 Activity through Phosphorylation
	Polymerase switching
	G2/M DNA damage checkpoint

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DYSLEXIA	—	GWAS catalog	36266505	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	33272962	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	30297969, 32541925, 34594039, 35551307, 38374256, 38685053	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (12)
Carcinoma of lung	Lung carcinoma	BEFREE	30214556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	31297992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31797865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	31845510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	34404366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35544695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30214556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	35483337	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17079134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	34404366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33302814, 34404366, 37302025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34151839	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
RFC2	[]	24	["DNA replication","Base excision repair","Nucleotide excision repair","Mismatch repair","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Single Strand Annealing (SSA)","HDR through Homologous Recombination (HRR)","Processing of DNA double-strand break ends","Presynaptic phase of homologous DNA pairing and strand exchange","Regulation of TP53 Activity through Phosphorylation"]	[]
RFC3	[]	24	["DNA replication","Base excision repair","Nucleotide excision repair","Mismatch repair","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Single Strand Annealing (SSA)","HDR through Homologous Recombination (HRR)","Processing of DNA double-strand break ends","Presynaptic phase of homologous DNA pairing and strand exchange","Regulation of TP53 Activity through Phosphorylation"]	[]
RFC4	[]	24	["DNA replication","Base excision repair","Nucleotide excision repair","Mismatch repair","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Single Strand Annealing (SSA)","HDR through Homologous Recombination (HRR)","Processing of DNA double-strand break ends","Presynaptic phase of homologous DNA pairing and strand exchange","Regulation of TP53 Activity through Phosphorylation"]	[]
RFC1	[]	18	["DNA replication","Base excision repair","Nucleotide excision repair","Mismatch repair","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Homologous Recombination (HRR)","Translesion synthesis by REV1","Translesion synthesis by POLK","Translesion synthesis by POLI","Recognition of DNA damage by PCNA-containing replication complex"]	[]
RPA2	[]	21	["DNA replication","Nucleotide excision repair","Mismatch repair","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Single Strand Annealing (SSA)","HDR through Homologous Recombination (HRR)","Processing of DNA double-strand break ends","Presynaptic phase of homologous DNA pairing and strand exchange","Regulation of TP53 Activity through Phosphorylation","G2\/M DNA damage checkpoint"]	[]

RFC5 (replication factor C subunit 5)

Bookmark This Gene