Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5981
Gene name	Replication factor C subunit 1
Gene symbol	RFC1
Synonyms (NCBI Gene)	A1CANVASMHCBFBPO-GARECC1RFCRFC140
Chromosome	4
Chromosome location	4p14
Summary	This gene encodes the large subunit of replication factor C, a five subunit DNA polymerase accessory protein, which is a DNA-dependent ATPase required for eukaryotic DNA replication and repair. The large subunit acts as an activator of DNA polymerases, bi

197 Show/Hide all (197)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046779	hsa-miR-222-3p	CLASH	23622248
MIRT042834	hsa-miR-324-3p	CLASH	23622248
MIRT439781	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439781	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1301486	hsa-let-7a	CLIP-seq
MIRT1301487	hsa-let-7b	CLIP-seq
MIRT1301488	hsa-let-7c	CLIP-seq
MIRT1301489	hsa-let-7d	CLIP-seq
MIRT1301490	hsa-let-7e	CLIP-seq
MIRT1301491	hsa-let-7f	CLIP-seq
MIRT1301492	hsa-let-7g	CLIP-seq
MIRT1301493	hsa-let-7i	CLIP-seq
MIRT1301494	hsa-miR-3144-3p	CLIP-seq
MIRT1301495	hsa-miR-3145-5p	CLIP-seq
MIRT1301496	hsa-miR-3190	CLIP-seq
MIRT1301497	hsa-miR-345	CLIP-seq
MIRT1301498	hsa-miR-3934	CLIP-seq
MIRT1301499	hsa-miR-4257	CLIP-seq
MIRT1301500	hsa-miR-4436a	CLIP-seq
MIRT1301501	hsa-miR-4458	CLIP-seq
MIRT1301502	hsa-miR-4500	CLIP-seq
MIRT1301503	hsa-miR-4700-3p	CLIP-seq
MIRT1301504	hsa-miR-4703-3p	CLIP-seq
MIRT1301505	hsa-miR-4726-3p	CLIP-seq
MIRT1301506	hsa-miR-4752	CLIP-seq
MIRT1301507	hsa-miR-4777-3p	CLIP-seq
MIRT1301508	hsa-miR-4786-3p	CLIP-seq
MIRT1301509	hsa-miR-513a-5p	CLIP-seq
MIRT1301510	hsa-miR-671-5p	CLIP-seq
MIRT1301511	hsa-miR-875-5p	CLIP-seq
MIRT1301512	hsa-miR-98	CLIP-seq
MIRT1301513	hsa-miR-1278	CLIP-seq
MIRT1301514	hsa-miR-1283	CLIP-seq
MIRT1301515	hsa-miR-139-5p	CLIP-seq
MIRT1301516	hsa-miR-1915	CLIP-seq
MIRT1301517	hsa-miR-2053	CLIP-seq
MIRT1301518	hsa-miR-28-3p	CLIP-seq
MIRT1301519	hsa-miR-3155	CLIP-seq
MIRT1301520	hsa-miR-3155b	CLIP-seq
MIRT1301498	hsa-miR-3934	CLIP-seq
MIRT1301521	hsa-miR-4528	CLIP-seq
MIRT1301504	hsa-miR-4703-3p	CLIP-seq
MIRT1301505	hsa-miR-4726-3p	CLIP-seq
MIRT1301522	hsa-miR-484	CLIP-seq
MIRT1301515	hsa-miR-139-5p	CLIP-seq
MIRT2089500	hsa-miR-1910	CLIP-seq
MIRT1301495	hsa-miR-3145-5p	CLIP-seq
MIRT2089501	hsa-miR-3148	CLIP-seq
MIRT2089502	hsa-miR-3153	CLIP-seq
MIRT2089503	hsa-miR-3192	CLIP-seq
MIRT2089504	hsa-miR-3194-3p	CLIP-seq
MIRT2089505	hsa-miR-326	CLIP-seq
MIRT2089506	hsa-miR-330-5p	CLIP-seq
MIRT1301497	hsa-miR-345	CLIP-seq
MIRT2089507	hsa-miR-3663-5p	CLIP-seq
MIRT2089508	hsa-miR-3672	CLIP-seq
MIRT1301498	hsa-miR-3934	CLIP-seq
MIRT2089509	hsa-miR-3940-5p	CLIP-seq
MIRT2089510	hsa-miR-4274	CLIP-seq
MIRT2089511	hsa-miR-4314	CLIP-seq
MIRT2089512	hsa-miR-4507	CLIP-seq
MIRT2089513	hsa-miR-4527	CLIP-seq
MIRT2089514	hsa-miR-4539	CLIP-seq
MIRT2089515	hsa-miR-4646-5p	CLIP-seq
MIRT2089516	hsa-miR-4668-5p	CLIP-seq
MIRT1301504	hsa-miR-4703-3p	CLIP-seq
MIRT1301505	hsa-miR-4726-3p	CLIP-seq
MIRT2089517	hsa-miR-4789-3p	CLIP-seq
MIRT2089518	hsa-miR-579	CLIP-seq
MIRT2089519	hsa-miR-582-5p	CLIP-seq
MIRT2610807	hsa-miR-1184	CLIP-seq
MIRT2610808	hsa-miR-1205	CLIP-seq
MIRT2610809	hsa-miR-134	CLIP-seq
MIRT1301515	hsa-miR-139-5p	CLIP-seq
MIRT2610810	hsa-miR-186	CLIP-seq
MIRT2089500	hsa-miR-1910	CLIP-seq
MIRT2610811	hsa-miR-1912	CLIP-seq
MIRT2610812	hsa-miR-197	CLIP-seq
MIRT2610813	hsa-miR-2052	CLIP-seq
MIRT2610814	hsa-miR-217	CLIP-seq
MIRT2610815	hsa-miR-3118	CLIP-seq
MIRT2610816	hsa-miR-3130-5p	CLIP-seq
MIRT1301495	hsa-miR-3145-5p	CLIP-seq
MIRT2610817	hsa-miR-3149	CLIP-seq
MIRT2610818	hsa-miR-3158-5p	CLIP-seq
MIRT2610819	hsa-miR-3168	CLIP-seq
MIRT2610820	hsa-miR-3177-5p	CLIP-seq
MIRT2610821	hsa-miR-3182	CLIP-seq
MIRT2610822	hsa-miR-3189-5p	CLIP-seq
MIRT2089507	hsa-miR-3663-5p	CLIP-seq
MIRT2089508	hsa-miR-3672	CLIP-seq
MIRT2610823	hsa-miR-3685	CLIP-seq
MIRT2610824	hsa-miR-377	CLIP-seq
MIRT2610825	hsa-miR-3914	CLIP-seq
MIRT1301498	hsa-miR-3934	CLIP-seq
MIRT2089509	hsa-miR-3940-5p	CLIP-seq
MIRT2610826	hsa-miR-3943	CLIP-seq
MIRT2610827	hsa-miR-4251	CLIP-seq
MIRT2089510	hsa-miR-4274	CLIP-seq
MIRT2610828	hsa-miR-4277	CLIP-seq
MIRT2610829	hsa-miR-4282	CLIP-seq
MIRT2610830	hsa-miR-4307	CLIP-seq
MIRT2610831	hsa-miR-4323	CLIP-seq
MIRT2610832	hsa-miR-4329	CLIP-seq
MIRT2610833	hsa-miR-4482	CLIP-seq
MIRT2089512	hsa-miR-4507	CLIP-seq
MIRT2610834	hsa-miR-450b-5p	CLIP-seq
MIRT2610835	hsa-miR-452	CLIP-seq
MIRT2089513	hsa-miR-4527	CLIP-seq
MIRT2089514	hsa-miR-4539	CLIP-seq
MIRT2610836	hsa-miR-4676-3p	CLIP-seq
MIRT2610837	hsa-miR-4699-3p	CLIP-seq
MIRT1301504	hsa-miR-4703-3p	CLIP-seq
MIRT2610838	hsa-miR-4714-3p	CLIP-seq
MIRT1301505	hsa-miR-4726-3p	CLIP-seq
MIRT2610839	hsa-miR-4729	CLIP-seq
MIRT2610840	hsa-miR-4751	CLIP-seq
MIRT2610841	hsa-miR-508-5p	CLIP-seq
MIRT2610842	hsa-miR-5096	CLIP-seq
MIRT2610843	hsa-miR-513a-3p	CLIP-seq
MIRT2610844	hsa-miR-518a-5p	CLIP-seq
MIRT2610845	hsa-miR-520d-5p	CLIP-seq
MIRT2610846	hsa-miR-524-5p	CLIP-seq
MIRT2610847	hsa-miR-527	CLIP-seq
MIRT2610848	hsa-miR-544	CLIP-seq
MIRT2610849	hsa-miR-568	CLIP-seq
MIRT2089518	hsa-miR-579	CLIP-seq
MIRT2610850	hsa-miR-580	CLIP-seq
MIRT2610851	hsa-miR-654-3p	CLIP-seq
MIRT2610852	hsa-miR-711	CLIP-seq
MIRT2610853	hsa-miR-765	CLIP-seq
MIRT2610854	hsa-miR-767-3p	CLIP-seq
MIRT2610855	hsa-miR-943	CLIP-seq
MIRT2610807	hsa-miR-1184	CLIP-seq
MIRT2610808	hsa-miR-1205	CLIP-seq
MIRT2610809	hsa-miR-134	CLIP-seq
MIRT1301515	hsa-miR-139-5p	CLIP-seq
MIRT2610810	hsa-miR-186	CLIP-seq
MIRT2089500	hsa-miR-1910	CLIP-seq
MIRT2610811	hsa-miR-1912	CLIP-seq
MIRT2610812	hsa-miR-197	CLIP-seq
MIRT2610813	hsa-miR-2052	CLIP-seq
MIRT2610815	hsa-miR-3118	CLIP-seq
MIRT2610816	hsa-miR-3130-5p	CLIP-seq
MIRT1301495	hsa-miR-3145-5p	CLIP-seq
MIRT2610817	hsa-miR-3149	CLIP-seq
MIRT2610818	hsa-miR-3158-5p	CLIP-seq
MIRT2610819	hsa-miR-3168	CLIP-seq
MIRT2610820	hsa-miR-3177-5p	CLIP-seq
MIRT2610821	hsa-miR-3182	CLIP-seq
MIRT2610822	hsa-miR-3189-5p	CLIP-seq
MIRT2089507	hsa-miR-3663-5p	CLIP-seq
MIRT2089508	hsa-miR-3672	CLIP-seq
MIRT2610823	hsa-miR-3685	CLIP-seq
MIRT2610824	hsa-miR-377	CLIP-seq
MIRT2610825	hsa-miR-3914	CLIP-seq
MIRT1301498	hsa-miR-3934	CLIP-seq
MIRT2089509	hsa-miR-3940-5p	CLIP-seq
MIRT2610826	hsa-miR-3943	CLIP-seq
MIRT2610827	hsa-miR-4251	CLIP-seq
MIRT2089510	hsa-miR-4274	CLIP-seq
MIRT2610828	hsa-miR-4277	CLIP-seq
MIRT2610829	hsa-miR-4282	CLIP-seq
MIRT2610830	hsa-miR-4307	CLIP-seq
MIRT2610831	hsa-miR-4323	CLIP-seq
MIRT2610832	hsa-miR-4329	CLIP-seq
MIRT2610833	hsa-miR-4482	CLIP-seq
MIRT2089512	hsa-miR-4507	CLIP-seq
MIRT2610834	hsa-miR-450b-5p	CLIP-seq
MIRT2610835	hsa-miR-452	CLIP-seq
MIRT2089513	hsa-miR-4527	CLIP-seq
MIRT2089514	hsa-miR-4539	CLIP-seq
MIRT2610836	hsa-miR-4676-3p	CLIP-seq
MIRT2610837	hsa-miR-4699-3p	CLIP-seq
MIRT1301504	hsa-miR-4703-3p	CLIP-seq
MIRT2610838	hsa-miR-4714-3p	CLIP-seq
MIRT1301505	hsa-miR-4726-3p	CLIP-seq
MIRT2610839	hsa-miR-4729	CLIP-seq
MIRT2689674	hsa-miR-4735-5p	CLIP-seq
MIRT2610840	hsa-miR-4751	CLIP-seq
MIRT2689675	hsa-miR-488	CLIP-seq
MIRT2610841	hsa-miR-508-5p	CLIP-seq
MIRT2610842	hsa-miR-5096	CLIP-seq
MIRT2610843	hsa-miR-513a-3p	CLIP-seq
MIRT2610844	hsa-miR-518a-5p	CLIP-seq
MIRT2610845	hsa-miR-520d-5p	CLIP-seq
MIRT2610846	hsa-miR-524-5p	CLIP-seq
MIRT2610847	hsa-miR-527	CLIP-seq
MIRT2610848	hsa-miR-544	CLIP-seq
MIRT2610849	hsa-miR-568	CLIP-seq
MIRT2089518	hsa-miR-579	CLIP-seq
MIRT2610850	hsa-miR-580	CLIP-seq
MIRT2610851	hsa-miR-654-3p	CLIP-seq
MIRT2610852	hsa-miR-711	CLIP-seq
MIRT2610853	hsa-miR-765	CLIP-seq
MIRT2610854	hsa-miR-767-3p	CLIP-seq
MIRT2610855	hsa-miR-943	CLIP-seq

35 Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003689	Function	DNA clamp loader activity	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	9488738, 15655353, 16438930
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	TAS	8248204
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005663	Component	DNA replication factor C complex	IDA	9488738
GO:0005663	Component	DNA replication factor C complex	IEA
GO:0005663	Component	DNA replication factor C complex	IPI	9488738
GO:0005694	Component	Chromosome	IEA
GO:0006260	Process	DNA replication	IEA
GO:0006261	Process	DNA-templated DNA replication	IDA	9488738
GO:0006261	Process	DNA-templated DNA replication	TAS	8248204
GO:0006281	Process	DNA repair	IEA
GO:0007004	Process	Telomere maintenance via telomerase	TAS	8954124
GO:0008047	Function	Enzyme activator activity	TAS	8954124
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0031391	Component	Elg1 RFC-like complex	IDA	23277426
GO:0032991	Component	Protein-containing complex	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0061860	Function	DNA clamp unloader activity	IBA
GO:0061860	Function	DNA clamp unloader activity	IMP	23277426
GO:0070062	Component	Extracellular exosome	HDA
GO:0140297	Function	DNA-binding transcription factor binding	IEA

MIM	HGNC	e!Ensembl
102579	9969	ENSG00000035928

P35251

Protein name

Replication factor C subunit 1 (Activator 1 140 kDa subunit) (A1 140 kDa subunit) (Activator 1 large subunit) (Activator 1 subunit 1) (DNA-binding protein PO-GA) (Replication factor C 140 kDa subunit) (RF-C 140 kDa subunit) (RFC140) (Replication factor C

Protein function

Subunit of the replication factor C (RFC) complex which acts during elongation of primed DNA templates by DNA polymerases delta and epsilon, and is necessary for ATP-dependent loading of proliferating cell nuclear antigen (PCNA) onto primed DNA

PDB

2EBU , 2K6G , 2K7F , 6VVO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00004	AAA	647 → 776	ATPase family associated with various cellular activities (AAA)	Domain
PF00533	BRCT	402 → 479	BRCA1 C Terminus (BRCT) domain	Family
PF08519	RFC1	915 → 1068	Replication factor RFC1 C terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Wide tissue distribution. Undetectable in placental tissue.

Sequence

MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPS
KKKRIIYDSDSESEETLQVKNAKKPPEKLPVSSKPGKISRQDPVTYISETDEEDDFMCKK
AASKSKENGRSTNSHLGTSNMKKNEENTKTKNKPLSPIKLTPTSVLDYFGTGSVQRSNKK
MVASKRKELSQNTDESGLNDEAIAKQLQLDEDAELERQLHEDEEFARTLAMLDEEPKTKK
ARKDTEAGETFSSVQANLSKAEKHKYPHKVKTAQVSDERKSYSPRKQSKYESSKESQQHS
KSSADKIGEVSSPKASSKLAIMKRKEESSYKEIEPVASKRKENAIKLKGETKTPKKTKSS
PAKKESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLIFVITGVLES
IERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIR
TMPGKKSKYEIAVETEMKKESKLERTPQKNVQGKRKISPSKKESESKKSRPTSKRDSLAK
TIKKETDVFWKSLDFKEQVAEETSGDSKARNLADDSSENKVENLLWVDKYKPTSLKTIIG
QQGDQSCANKLLRWLRNWQKSSSEDKKHAAKFGKFSGKDDGSSFKAALLSGPPGVGKTTT
ASLVCQELGYSYVELNASDTRSKSSLKAIVAESLNNTSIKGFYSNGAASSVSTKHALIMD
EVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQI
KGAMMSIAFKEGLKIPPPAMNEIILGANQDIRQVLHNLSMWCARSKALTYDQAKADSHRA
KKDIKMGPFDVARKVFAAGEETAHMSLVDKSDLFFHDYSIAPLFVQENYIHVKPVAAGGD
MKKHLMLLSRAADSICDGDLVDSQIRSKQNWSLLPAQAIYASVLPGELMRGYMTQFPTFP
SWLGKHSSTGKHDRIVQDLALHMSLRTYSSKRTVNMDYLSLLRDALVQPLTSQGVDGVQD
VVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAI
KASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAIETDAMIKKKTKSSKPSKPEKDKEPRK
GKGKSSKK

Sequence length

1148

Interactions

View interactions

KEGG Pathway	Reactome Pathway
DNA replication	Translesion synthesis by REV1
Base excision repair	Recognition of DNA damage by PCNA-containing replication complex
Nucleotide excision repair	Translesion Synthesis by POLH
Mismatch repair	Polymerase switching on the C-strand of the telomere
	PCNA-Dependent Long Patch Base Excision Repair
	Translesion synthesis by POLK
	Translesion synthesis by POLI
	Termination of translesion DNA synthesis
	HDR through Homologous Recombination (HRR)
	Gap-filling DNA repair synthesis and ligation in GG-NER
	Dual Incision in GG-NER
	Dual incision in TC-NER
	Gap-filling DNA repair synthesis and ligation in TC-NER
	Polymerase switching

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Cerebellar ataxia with neuropathy and bilateral vestibular areflexia syndrome	Likely pathogenic; Pathogenic	rs2600447, rs1035947105, rs2475602035, rs2475515249, rs2475507533	RCV002280370 RCV003324872 RCV003324873 RCV003324874 RCV003324875	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (22)
ASTHMA	—	GWAS catalog	30929738	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILATERAL VESTIBULOPATHY	—	CTD, Disgenet CTD, Disgenet	30926972	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	38501904	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBELLAR ATAXIA	—	CTD, Disgenet CTD, Disgenet	30926972	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBELLAR ATAXIA, NEUROPATHY, AND VESTIBULAR AREFLEXIA SYNDROME	—	Disgenet, GenCC, HPO Disgenet, GenCC, HPO Disgenet, GenCC, HPO	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	18926688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY MOTOR AND SENSORY NEUROPATHIES	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY SENSORY AND MOTOR NEUROPATHY	—	CTD	30926972	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	CTD	19159907	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, LATE-ONSET	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	38965376	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RFC1-related disorder	Likely benign; Benign; Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
RFC2	0	[]	18	["DNA replication","Base excision repair","Nucleotide excision repair","Mismatch repair","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Homologous Recombination (HRR)","Translesion synthesis by REV1","Translesion synthesis by POLK","Translesion synthesis by POLI","Recognition of DNA damage by PCNA-containing replication complex"]	0	[]
RFC3	0	[]	18	["DNA replication","Base excision repair","Nucleotide excision repair","Mismatch repair","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Homologous Recombination (HRR)","Translesion synthesis by REV1","Translesion synthesis by POLK","Translesion synthesis by POLI","Recognition of DNA damage by PCNA-containing replication complex"]	0	[]
RFC4	0	[]	18	["DNA replication","Base excision repair","Nucleotide excision repair","Mismatch repair","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Homologous Recombination (HRR)","Translesion synthesis by REV1","Translesion synthesis by POLK","Translesion synthesis by POLI","Recognition of DNA damage by PCNA-containing replication complex"]	0	[]
RFC5	0	[]	18	["DNA replication","Base excision repair","Nucleotide excision repair","Mismatch repair","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Homologous Recombination (HRR)","Translesion synthesis by REV1","Translesion synthesis by POLK","Translesion synthesis by POLI","Recognition of DNA damage by PCNA-containing replication complex"]	0	[]
PCNA	1	["Colonic neoplasms"]	18	["DNA replication","Base excision repair","Nucleotide excision repair","Mismatch repair","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Homologous Recombination (HRR)","Translesion synthesis by REV1","Translesion synthesis by POLK","Translesion synthesis by POLI","Recognition of DNA damage by PCNA-containing replication complex"]	1	["CTD (Colonic neoplasms)"]

RFC1 (replication factor C subunit 1)

Bookmark This Gene