RFC4 (replication factor C subunit 4)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5984
• Gene name: Replication factor C subunit 4
• Gene symbol: RFC4
• Synonyms (NCBI Gene): A1, MRMNS, RFC37
• Chromosome: 3
• Chromosome location: 3q27.3
• Summary: The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consistin

miRNA Show/Hide all (14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016352	hsa-miR-193b-3p	Microarray	20304954
MIRT024441	hsa-miR-215-5p	Microarray	19074876
MIRT026479	hsa-miR-192-5p	Microarray	19074876
MIRT1301602	hsa-miR-4528	CLIP-seq
MIRT1301603	hsa-miR-4699-3p	CLIP-seq
MIRT1301604	hsa-miR-520d-5p	CLIP-seq
MIRT1301605	hsa-miR-524-5p	CLIP-seq
MIRT1301606	hsa-miR-556-3p	CLIP-seq
MIRT1301606	hsa-miR-556-3p	CLIP-seq
MIRT1301602	hsa-miR-4528	CLIP-seq
MIRT1301603	hsa-miR-4699-3p	CLIP-seq
MIRT1301604	hsa-miR-520d-5p	CLIP-seq
MIRT1301605	hsa-miR-524-5p	CLIP-seq
MIRT1301606	hsa-miR-556-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003689	Function	DNA clamp loader activity	IBA
GO:0003689	Function	DNA clamp loader activity	IDA	12930902
GO:0005515	Function	Protein binding	IPI	9488738, 15655353, 16189514, 21516116, 23277426, 25416956, 28514442, 29892012, 30021884, 31515488, 32296183, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005663	Component	DNA replication factor C complex	IBA
GO:0005663	Component	DNA replication factor C complex	IDA	9488738
GO:0005663	Component	DNA replication factor C complex	IPI	9488738
GO:0005694	Component	Chromosome	IEA
GO:0006260	Process	DNA replication	IEA
GO:0006261	Process	DNA-templated DNA replication	IBA
GO:0006261	Process	DNA-templated DNA replication	IDA	9488738
GO:0006271	Process	DNA strand elongation involved in DNA replication	TAS	7774928
GO:0006281	Process	DNA repair	IBA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0017116	Function	Single-stranded DNA helicase activity	IDA	12930902
GO:0019899	Function	Enzyme binding	IEA
GO:0031390	Component	Ctf18 RFC-like complex	IDA	12930902
GO:0031391	Component	Elg1 RFC-like complex	IDA	23277426
GO:1900264	Process	Positive regulation of DNA-directed DNA polymerase activity	IDA	12930902

Other IDs

• MIM: 102577
• HGNC: 9972
• e!Ensembl: ENSG00000163918

Protein

• UniProt ID: P35249
• Protein name: Replication factor C subunit 4 (Activator 1 37 kDa subunit) (A1 37 kDa subunit) (Activator 1 subunit 4) (Replication factor C 37 kDa subunit) (RF-C 37 kDa subunit) (RFC37)
• Protein function: Subunit of the replication factor C (RFC) complex which acts during elongation of primed DNA templates by DNA polymerases delta and epsilon, and is necessary for ATP-dependent loading of proliferating cell nuclear antigen (PCNA) onto primed DNA.
• PDB: 6VVO , 7Z6H , 8UI7 , 8UI8 , 8UI9 , 8UII , 8UMT , 8UMU , 8UMV , 8UMW , 8UMY , 8UN0 , 8UNJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00004	AAA	74 → 202	ATPase family associated with various cellular activities (AAA)	Domain
  PF08542	Rep_fac_C	269 → 354	Replication factor C C-terminal domain	Domain

• Sequence:

  MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVA
  VLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVR
  EKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLIC
  NYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRK
  AITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEG
  HAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLS
  QNC

• Sequence length: 363

Pathways

KEGG Pathway	Reactome Pathway
DNA replication	Translesion synthesis by REV1
Base excision repair	Recognition of DNA damage by PCNA-containing replication complex
Nucleotide excision repair	Translesion Synthesis by POLH
Mismatch repair	Polymerase switching on the C-strand of the telomere
	Activation of ATR in response to replication stress
	PCNA-Dependent Long Patch Base Excision Repair
	Translesion synthesis by POLK
	Translesion synthesis by POLI
	Termination of translesion DNA synthesis
	HDR through Single Strand Annealing (SSA)
	HDR through Homologous Recombination (HRR)
	Processing of DNA double-strand break ends
	Presynaptic phase of homologous DNA pairing and strand exchange
	Gap-filling DNA repair synthesis and ligation in GG-NER
	Dual Incision in GG-NER
	Dual incision in TC-NER
	Gap-filling DNA repair synthesis and ligation in TC-NER
	Regulation of TP53 Activity through Phosphorylation
	Polymerase switching
	G2/M DNA damage checkpoint

Related Genes

Sort by: Blended Diseases Pathways Evidence source

RFC2 24 shared pathwaysDNA replication, Base excision repair, Nucleotide excision repair, Mismatch repair, Dual Incision in GG-NER, Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, HDR through Single Strand Annealing (SSA), HDR through Homologous Recombination (HRR), Processing of DNA double-strand break ends, Presynaptic phase of homologous DNA pairing and strand exchange, Regulation of TP53 Activity through Phosphorylation +12 more Related via 24 shared pathways including DNA replication, Base excision repair. RFC3 24 shared pathwaysDNA replication, Base excision repair, Nucleotide excision repair, Mismatch repair, Dual Incision in GG-NER, Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, HDR through Single Strand Annealing (SSA), HDR through Homologous Recombination (HRR), Processing of DNA double-strand break ends, Presynaptic phase of homologous DNA pairing and strand exchange, Regulation of TP53 Activity through Phosphorylation +12 more Related via 24 shared pathways including DNA replication, Base excision repair. RFC5 24 shared pathwaysDNA replication, Base excision repair, Nucleotide excision repair, Mismatch repair, Dual Incision in GG-NER, Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, HDR through Single Strand Annealing (SSA), HDR through Homologous Recombination (HRR), Processing of DNA double-strand break ends, Presynaptic phase of homologous DNA pairing and strand exchange, Regulation of TP53 Activity through Phosphorylation +12 more Related via 24 shared pathways including DNA replication, Base excision repair. RFC1 18 shared pathwaysDNA replication, Base excision repair, Nucleotide excision repair, Mismatch repair, Dual Incision in GG-NER, Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, HDR through Homologous Recombination (HRR), Translesion synthesis by REV1, Translesion synthesis by POLK, Translesion synthesis by POLI, Recognition of DNA damage by PCNA-containing replication complex +6 more Related via 18 shared pathways including DNA replication, Base excision repair. RPA2 21 shared pathwaysDNA replication, Nucleotide excision repair, Mismatch repair, Dual Incision in GG-NER, Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, HDR through Single Strand Annealing (SSA), HDR through Homologous Recombination (HRR), Processing of DNA double-strand break ends, Presynaptic phase of homologous DNA pairing and strand exchange, Regulation of TP53 Activity through Phosphorylation, G2/M DNA damage checkpoint +9 more Related via 21 shared pathways including DNA replication, Nucleotide excision repair.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
RFC2	0	[]	24	["DNA replication","Base excision repair","Nucleotide excision repair","Mismatch repair","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Single Strand Annealing (SSA)","HDR through Homologous Recombination (HRR)","Processing of DNA double-strand break ends","Presynaptic phase of homologous DNA pairing and strand exchange","Regulation of TP53 Activity through Phosphorylation"]	0	[]
RFC3	0	[]	24	["DNA replication","Base excision repair","Nucleotide excision repair","Mismatch repair","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Single Strand Annealing (SSA)","HDR through Homologous Recombination (HRR)","Processing of DNA double-strand break ends","Presynaptic phase of homologous DNA pairing and strand exchange","Regulation of TP53 Activity through Phosphorylation"]	0	[]
RFC5	0	[]	24	["DNA replication","Base excision repair","Nucleotide excision repair","Mismatch repair","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Single Strand Annealing (SSA)","HDR through Homologous Recombination (HRR)","Processing of DNA double-strand break ends","Presynaptic phase of homologous DNA pairing and strand exchange","Regulation of TP53 Activity through Phosphorylation"]	0	[]
RFC1	0	[]	18	["DNA replication","Base excision repair","Nucleotide excision repair","Mismatch repair","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Homologous Recombination (HRR)","Translesion synthesis by REV1","Translesion synthesis by POLK","Translesion synthesis by POLI","Recognition of DNA damage by PCNA-containing replication complex"]	0	[]
RPA2	0	[]	21	["DNA replication","Nucleotide excision repair","Mismatch repair","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Single Strand Annealing (SSA)","HDR through Homologous Recombination (HRR)","Processing of DNA double-strand break ends","Presynaptic phase of homologous DNA pairing and strand exchange","Regulation of TP53 Activity through Phosphorylation","G2\/M DNA damage checkpoint"]	0	[]

Diseases Linked via Similar Genes

Systemic lupus erythematosus Linked via 2 of 5 related genesRFC2, RFC5 Williams syndrome Linked via 1 of 5 related genesRFC2 Alzheimer disease Linked via 1 of 5 related genesRFC3 Astrocytoma Linked via 1 of 5 related genesRFC3 Central nervous system cancer Linked via 1 of 5 related genesRFC3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Systemic lupus erythematosus	2	["RFC2","RFC5"]
Williams syndrome	1	["RFC2"]
Alzheimer disease	1	["RFC3"]
Astrocytoma	1	["RFC3"]
Central nervous system cancer	1	["RFC3"]