Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5321
Gene name	Phospholipase A2 group IVA
Gene symbol	PLA2G4A
Synonyms (NCBI Gene)	GURDPPLA2G4cPLA2cPLA2-alpha
Chromosome	1
Chromosome location	1q31.1
Summary	This gene encodes a member of the cytosolic phospholipase A2 group IV family. The enzyme catalyzes the hydrolysis of membrane phospholipids to release arachidonic acid which is subsequently metabolized into eicosanoids. Eicosanoids, including prostaglandi

SNP ID	Visualize variation	Clinical significance	Consequence
rs121434634	T>C	Pathogenic	Missense variant, coding sequence variant
rs121434635	G>A	Pathogenic	Missense variant, coding sequence variant
rs1557895416	G>C	Pathogenic	Coding sequence variant, missense variant
rs1557901999	AGTA>-	Pathogenic	Intron variant, splice donor variant
rs1571392612	->T	Pathogenic	Coding sequence variant, frameshift variant, intron variant

113 Show/Hide all (113)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022551	hsa-miR-124-3p	Microarray	18668037
MIRT028507	hsa-miR-30a-5p	Proteomics	18668040
MIRT047518	hsa-miR-10a-5p	CLASH	23622248
MIRT041616	hsa-miR-146b-5p	CLASH	23622248
MIRT052653	hsa-miR-449c-5p	CLASH	23622248
MIRT700778	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT700777	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT700776	hsa-miR-940	HITS-CLIP	23313552
MIRT700775	hsa-miR-3929	HITS-CLIP	23313552
MIRT700774	hsa-miR-4419b	HITS-CLIP	23313552
MIRT700773	hsa-miR-4478	HITS-CLIP	23313552
MIRT700772	hsa-miR-6783-5p	HITS-CLIP	23313552
MIRT700771	hsa-miR-5588-3p	HITS-CLIP	23313552
MIRT700770	hsa-miR-2114-5p	HITS-CLIP	23313552
MIRT700769	hsa-miR-5690	HITS-CLIP	23313552
MIRT700768	hsa-miR-6746-5p	HITS-CLIP	23313552
MIRT700767	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT700766	hsa-miR-1827	HITS-CLIP	23313552
MIRT700765	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT700764	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT700763	hsa-miR-1909-3p	HITS-CLIP	23313552
MIRT700762	hsa-miR-6722-3p	HITS-CLIP	23313552
MIRT700761	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT700760	hsa-miR-1207-5p	HITS-CLIP	23313552
MIRT700759	hsa-miR-4763-3p	HITS-CLIP	23313552
MIRT700758	hsa-miR-6771-5p	HITS-CLIP	23313552
MIRT700757	hsa-miR-665	HITS-CLIP	23313552
MIRT671771	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT671770	hsa-miR-4691-3p	HITS-CLIP	23824327
MIRT671769	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT671768	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT671767	hsa-miR-4284	HITS-CLIP	23824327
MIRT671766	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT671765	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT671764	hsa-miR-7977	HITS-CLIP	23824327
MIRT700778	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT700777	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT700776	hsa-miR-940	HITS-CLIP	23313552
MIRT700775	hsa-miR-3929	HITS-CLIP	23313552
MIRT700774	hsa-miR-4419b	HITS-CLIP	23313552
MIRT700773	hsa-miR-4478	HITS-CLIP	23313552
MIRT700772	hsa-miR-6783-5p	HITS-CLIP	23313552
MIRT700771	hsa-miR-5588-3p	HITS-CLIP	23313552
MIRT700770	hsa-miR-2114-5p	HITS-CLIP	23313552
MIRT700769	hsa-miR-5690	HITS-CLIP	23313552
MIRT700768	hsa-miR-6746-5p	HITS-CLIP	23313552
MIRT700767	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT700766	hsa-miR-1827	HITS-CLIP	23313552
MIRT700765	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT700764	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT700763	hsa-miR-1909-3p	HITS-CLIP	23313552
MIRT700762	hsa-miR-6722-3p	HITS-CLIP	23313552
MIRT700761	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT700760	hsa-miR-1207-5p	HITS-CLIP	23313552
MIRT700759	hsa-miR-4763-3p	HITS-CLIP	23313552
MIRT700758	hsa-miR-6771-5p	HITS-CLIP	23313552
MIRT700757	hsa-miR-665	HITS-CLIP	23313552
MIRT671771	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT671770	hsa-miR-4691-3p	HITS-CLIP	23824327
MIRT671769	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT671768	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT671767	hsa-miR-4284	HITS-CLIP	23824327
MIRT671766	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT671765	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT671764	hsa-miR-7977	HITS-CLIP	23824327
MIRT2594860	hsa-miR-1183	CLIP-seq
MIRT2594861	hsa-miR-1301	CLIP-seq
MIRT2594862	hsa-miR-145	CLIP-seq
MIRT2594863	hsa-miR-3180-5p	CLIP-seq
MIRT2594864	hsa-miR-362-5p	CLIP-seq
MIRT2594865	hsa-miR-3647-3p	CLIP-seq
MIRT2594866	hsa-miR-369-3p	CLIP-seq
MIRT2594867	hsa-miR-374a	CLIP-seq
MIRT2594868	hsa-miR-374b	CLIP-seq
MIRT2594869	hsa-miR-383	CLIP-seq
MIRT2594870	hsa-miR-433	CLIP-seq
MIRT2594871	hsa-miR-4660	CLIP-seq
MIRT2594872	hsa-miR-4676-5p	CLIP-seq
MIRT2594873	hsa-miR-4712-5p	CLIP-seq
MIRT2594874	hsa-miR-4714-3p	CLIP-seq
MIRT2594875	hsa-miR-4769-3p	CLIP-seq
MIRT2594876	hsa-miR-4772-5p	CLIP-seq
MIRT2594877	hsa-miR-4795-3p	CLIP-seq
MIRT2594878	hsa-miR-496	CLIP-seq
MIRT2594879	hsa-miR-500b	CLIP-seq
MIRT2594880	hsa-miR-501-5p	CLIP-seq
MIRT2594881	hsa-miR-5047	CLIP-seq
MIRT2594882	hsa-miR-505	CLIP-seq
MIRT2594883	hsa-miR-518a-5p	CLIP-seq
MIRT2594884	hsa-miR-527	CLIP-seq
MIRT2594885	hsa-miR-575	CLIP-seq
MIRT2594886	hsa-miR-579	CLIP-seq
MIRT2594887	hsa-miR-605	CLIP-seq
MIRT2594888	hsa-miR-633	CLIP-seq
MIRT2594889	hsa-miR-770-5p	CLIP-seq
MIRT2594890	hsa-miR-891b	CLIP-seq
MIRT2594860	hsa-miR-1183	CLIP-seq
MIRT2594862	hsa-miR-145	CLIP-seq
MIRT2594864	hsa-miR-362-5p	CLIP-seq
MIRT2594865	hsa-miR-3647-3p	CLIP-seq
MIRT2594869	hsa-miR-383	CLIP-seq
MIRT2594870	hsa-miR-433	CLIP-seq
MIRT2594872	hsa-miR-4676-5p	CLIP-seq
MIRT2594875	hsa-miR-4769-3p	CLIP-seq
MIRT2594876	hsa-miR-4772-5p	CLIP-seq
MIRT2594878	hsa-miR-496	CLIP-seq
MIRT2594879	hsa-miR-500b	CLIP-seq
MIRT2594880	hsa-miR-501-5p	CLIP-seq
MIRT2594883	hsa-miR-518a-5p	CLIP-seq
MIRT2594884	hsa-miR-527	CLIP-seq
MIRT2594885	hsa-miR-575	CLIP-seq
MIRT2594887	hsa-miR-605	CLIP-seq
MIRT2594890	hsa-miR-891b	CLIP-seq

80 Show/Hide all (80)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	11375391
GO:0000139	Component	Golgi membrane	IEA
GO:0001516	Process	Prostaglandin biosynthetic process	IDA	27642067
GO:0001516	Process	Prostaglandin biosynthetic process	IEA
GO:0001516	Process	Prostaglandin biosynthetic process	IMP	18451993
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IEA
GO:0004620	Function	Phospholipase activity	IEA
GO:0004622	Function	Phosphatidylcholine lysophospholipase activity	IDA	12672805, 16617059, 27642067
GO:0004622	Function	Phosphatidylcholine lysophospholipase activity	IEA
GO:0004623	Function	Phospholipase A2 activity	IDA	8702602
GO:0004623	Function	Phospholipase A2 activity	IEA
GO:0004623	Function	Phospholipase A2 activity	NAS	8381049
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	9430701, 9665851
GO:0005509	Function	Calcium ion binding	IEA
GO:0005544	Function	Calcium-dependent phospholipid binding	IBA
GO:0005544	Function	Calcium-dependent phospholipid binding	IDA	9665851
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IDA	11375391
GO:0005635	Component	Nuclear envelope	IEA
GO:0005737	Component	Cytoplasm	IDA	11375391
GO:0005737	Component	Cytoplasm	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	NAS	8381049
GO:0005829	Component	Cytosol	TAS
GO:0006071	Process	Glycerol metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006640	Process	Monoacylglycerol biosynthetic process	IDA	7794891
GO:0006650	Process	Glycerophospholipid metabolic process	IEA
GO:0006663	Process	Platelet activating factor biosynthetic process	IEA
GO:0006663	Process	Platelet activating factor biosynthetic process	NAS	9430701
GO:0006690	Process	Icosanoid metabolic process	NAS	9430701
GO:0006693	Process	Prostaglandin metabolic process	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0008374	Function	O-acyltransferase activity	IDA	7794891
GO:0009395	Process	Phospholipid catabolic process	IEA
GO:0010314	Function	Phosphatidylinositol-5-phosphate binding	IDA	12672805
GO:0010572	Process	Positive regulation of platelet activation	IMP	18451993
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019369	Process	Arachidonate metabolic process	IDA	7794891
GO:0019369	Process	Arachidonate metabolic process	IEA
GO:0019369	Process	Arachidonate metabolic process	TAS	19718435
GO:0019370	Process	Leukotriene biosynthetic process	IEA
GO:0019370	Process	Leukotriene biosynthetic process	IMP	18451993
GO:0032266	Function	Phosphatidylinositol-3-phosphate binding	IDA	12672805
GO:0032308	Process	Positive regulation of prostaglandin secretion	IEA
GO:0034478	Process	Phosphatidylglycerol catabolic process	IDA	9425121
GO:0034638	Process	Phosphatidylcholine catabolic process	IDA	7794891, 9425121, 12672805, 14709560, 17472963
GO:0034638	Process	Phosphatidylcholine catabolic process	IEA
GO:0036151	Process	Phosphatidylcholine acyl-chain remodeling	IDA	16617059
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0043032	Process	Positive regulation of macrophage activation	IEA
GO:0046456	Process	Icosanoid biosynthetic process	IEA
GO:0046475	Process	Glycerophospholipid catabolic process	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IBA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IDA	7794891, 9425121, 14709560, 16617059, 17472963
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IEA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IMP	18451993
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	TAS
GO:0047499	Function	Calcium-independent phospholipase A2 activity	IDA	12672805
GO:0050482	Process	Arachidonate secretion	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0052689	Function	Carboxylic ester hydrolase activity	IEA
GO:0070273	Function	Phosphatidylinositol-4-phosphate binding	IDA	12672805
GO:0071236	Process	Cellular response to antibiotic	IEA
GO:1902387	Function	Ceramide 1-phosphate binding	IDA	17472963

MIM	HGNC	e!Ensembl
600522	9035	ENSG00000116711

P47712

Protein name

Cytosolic phospholipase A2 (cPLA2) (Phospholipase A2 group IVA) [Includes: Phospholipase A2 (EC 3.1.1.4) (Phosphatidylcholine 2-acylhydrolase); Lysophospholipase (EC 3.1.1.5)]

Protein function

Has primarily calcium-dependent phospholipase and lysophospholipase activities, with a major role in membrane lipid remodeling and biosynthesis of lipid mediators of the inflammatory response (PubMed:10358058, PubMed:14709560, PubMed:16617059, P

PDB

1BCI , 1CJY , 1RLW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00168	C2	18 → 123	C2 domain	Domain
PF01735	PLA2_B	190 → 675	Lysophospholipase catalytic domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in various cells and tissues such as macrophages, neutrophils, fibroblasts and lung endothelium. Expressed in platelets (at protein level) (PubMed:25102815). {ECO:0000269|PubMed:25102815}.

Sequence

MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEV
PFIFNQVTEMVLEMSLEVCSCPDLRFSMALCDQEKTFRQQRKEHIRESMKKLLGPKNSEG
LHSARDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEE
LENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQSDNQASWIHRMIMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYRAPGVPRETE
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLSKPKA

Sequence length

749

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glycerophospholipid metabolism	phospho-PLA2 pathway
Ether lipid metabolism	Acyl chain remodelling of PC
Arachidonic acid metabolism	Acyl chain remodeling of CL
Linoleic acid metabolism	Acyl chain remodelling of PS
alpha-Linolenic acid metabolism	Acyl chain remodelling of PE
Metabolic pathways	Acyl chain remodelling of PI
MAPK signaling pathway	Acyl chain remodelling of PG
Ras signaling pathway	Hydrolysis of LPC
Phospholipase D signaling pathway	Synthesis of PA
Necroptosis	Arachidonic acid metabolism
Vascular smooth muscle contraction	ADP signalling through P2Y purinoceptor 1
VEGF signaling pathway	Platelet sensitization by LDL
Platelet activation	COPI-independent Golgi-to-ER retrograde traffic
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Glutamatergic synapse
Serotonergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Ovarian steroidogenesis
Oxytocin signaling pathway
Choline metabolism in cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Cytosolic phospholipase-A2 alpha deficiency associated bleeding disorder	Pathogenic	rs121434634, rs121434635, rs1557895416, rs1557901999, rs1571392612	RCV000009647 RCV000009648 RCV000766189 RCV000766190 RCV000995604	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (32)
Acute myeloid leukemia	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	15816863	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA, OCCUPATIONAL	—	CTD, Disgenet CTD, Disgenet	27504716	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	15301788	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLOOD PLATELET DISORDERS	—	CTD, Disgenet CTD, Disgenet	18451993	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	29059683	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	29059683	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	21119660	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	26192919, 37156999	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRYPTOGENIC MULTIFOCAL ULCEROUS STENOSING ENTERITIS	—	Disgenet, Orphanet Disgenet, Orphanet Disgenet, Orphanet	23268370, 23268370	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CURLING ULCER	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS	—	CTD, Disgenet CTD, Disgenet	18287786	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUODENAL ULCER	—	CTD, Disgenet CTD, Disgenet	18451993	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	GWAS catalog	22949513	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENERALISED EPILEPSY	—	GWAS catalog	22949513	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	31578528, 33356394	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	26192919, 37156999	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	35115687	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELODYSPLASTIC SYNDROME	—	GWAS catalog	31738830	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	18471798	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	37040585	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLA2G4A-related disorder	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOAFFECTIVE DISORDER	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	26198764	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL VESSEL STROKE	—	GWAS catalog	34031191	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	26192919	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (196)
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	29549312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	20112284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12048163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	21198294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	30249885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	19795129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	16151530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22832605	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	20464283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28993924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	10417811		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	CTD_human_DG	15816863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis With Dementia	Amyotrophic Lateral Sclerosis With Dementia	CTD_human_DG	15816863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Guam Form	Amyotrophic lateral sclerosis	CTD_human_DG	15816863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic Oligodendroglioma	Anaplastic Oligodendroglioma	BEFREE	16550607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	27436223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	23500889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11897617, 19965596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	15259375, 30665457, 31302596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24349530	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25893499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	24086722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17672871, 18665843, 24204651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	17672871, 18665843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma, Occupational	Asthma	CTD_human_DG	27504716		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	10501211, 10838595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	10501211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	16529861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11897617, 19965596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	11897617, 21293878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	15301788		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	28724385		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	12895207, 20038946		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	12895207, 20038946		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	20038946	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	19139100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet-type bleeding disorder	CTD_human_DG	18451993		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	20211985, 21119660, 28383549, 29307829, 30992473		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	21119660		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	20211985, 21119660, 37773865	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	17672871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	37060021	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30829552, 31569627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11897617, 15294900, 26779633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19918789, 25786242, 30328712, 31347609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	22378731, 31092728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	22378731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	22916143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	19237603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	21421277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28215748, 29112675		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30829552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30829552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	16966336, 18636547, 31492557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	18636547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	25893499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28649002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	22832605	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26548451, 26828067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	30065566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15788676, 15975962, 22728329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	15788676, 15975962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15975962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12048163, 12832097, 15975962, 16467083, 22358383, 22728329, 25365190, 9858896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20635443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	31492557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Convulsions in the newborn	Convulsions	BEFREE	30092488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21293878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	21293878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26192919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	7590434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptogenic multifocal ulcerous stenosing enteritis	Cryptogenic Multifocal Ulcerous Stenosing Enteritis	ORPHANET_DG	23268370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cryptogenic multifocal ulcerous stenosing enteritis	Cryptogenic Multifocal Ulcerous Stenosing Enteritis	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Curling Ulcer	Gastric ulcer	CTD_human_DG	18451993		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic Fibrosis	BEFREE	20413542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cytosolic phospholipase-A2 alpha deficiency associated bleeding disorder	Cytosolic Phospholipase-A2 Alpha Deficiency Associated Bleeding Disorder	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Degenerative polyarthritis	Arthritis	LHGDN	15259375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	18471798, 20090528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28108057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	CTD_human_DG	18287786		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	28107559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	11897617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12765847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	12765847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	CTD_human_DG	18451993		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Duodenal Ulcer	Duodenal Ulcer	BEFREE	25102815		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Duodenal Ulcer	Duodenal Ulcer	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	23157623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	24455696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	23268370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31661303		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibrosis, Liver	Liver Fibrosis	BEFREE	28623940, 30541965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	31648019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	22916143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30360807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34131250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30360807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	21293878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	34946532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29342227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12874281	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	26922534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	24953535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inborn Errors of Metabolism	Inborn Errors Of Metabolism	CTD_human_DG	18451993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile Neuroaxonal Dystrophy	Neuroaxonal Dystrophy	BEFREE	20886109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	26192919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	30065566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	30196971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33536020, 34502319, 36046688, 37367830, 38022627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	17976189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17178883, 26081696, 28649002, 31516757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28649002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	24349530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	21703211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	15294900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	10749741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31347609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	12895207		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	12895207		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	12895207		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	12895207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28108057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20211985, 21119660, 28383549, 29307829, 30992473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	21119660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19918789, 25786242, 30328712, 31347609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30160795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16182442, 23646189, 26143945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12819026, 15878913, 23793291, 28347252, 31569627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30829552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15788676, 15975962, 22728329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	21119660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	21119660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	21119660		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19747926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28108057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	23936085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	11897617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	11897617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	15118355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	34946532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	19218359, 21746963, 31813625		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	31738830		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	21293878, 22378731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	22378731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	20211985	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12048163, 12927514, 15027116, 15788676, 15975962, 18722548, 21198294, 23936085, 24244531, 27757783, 28649002, 30249885, 30992473		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	19855947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15950779, 26162318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegeneration with brain iron accumulation (NBIA)	Nephropathy with Pretibial Epidermolysis Bullosa and Deafness	BEFREE	20886109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29232493, 31238788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15540987, 18025046, 21198294, 9169405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11897617, 29893858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	11897617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	18471798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31003849, 31404800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31003849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	24188450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24721622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30160795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic Cyst	BEFREE	31009406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic cyst	Pubtator	31009406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PHOSPHOLIPASE A2, GROUP IVA, DEFICIENCY OF	DEFICIENCY OF PHOSPHOLIPASE A2	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	7646998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	7646998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	24188450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16182442, 23646189, 26143945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19088022, 23646189, 35089606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	LHGDN	18562188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19966781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22358383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29229740, 29342227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	CTD_human_DG	10881173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	21391979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15259375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20112284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	18562188		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizoaffective Disorder	Schizoaffective Disorder	PSYGENET_DG	18562188		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	11353443, 11807411, 12759552, 15041036, 15276701, 15519500, 15999343, 16181776, 17629734, 18562188, 19560328, 30103930, 31207866, 8873778, 8888134, 9323323, 9689723, 9800222 View all (3 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15041036, 18562188		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15999343, 16181776, 17629734, 18562188, 19560328		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	10627477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21198294, 9247974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30071514, 30249885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31661303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	21293878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	30132177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	30251689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcer of esophagus	Ulcer Of Esophagus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	23145155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	26398624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30829552	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	36890149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	16550607		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
PLA2G4D	[]	29	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]
PLA2G4F	[]	28	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]
PLA2G4B	[]	28	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]
JMJD7-PLA2G4B	[]	28	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]
PLA2G4E	[]	27	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","MAPK signaling pathway","Ras signaling pathway","Phospholipase D signaling pathway","Necroptosis","Vascular smooth muscle contraction","VEGF signaling pathway","Platelet activation"]	[]

PLA2G4A (phospholipase A2 group IVA)

Save This Analysis