PLA2G10 (phospholipase A2 group X)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 8399
• Gene name: Phospholipase A2 group X
• Gene symbol: PLA2G10
• Synonyms (NCBI Gene): GXPLA2, GXSPLA2, SPLA2, sPLA2-X
• Chromosome: 16
• Chromosome location: 16p13.12-p13.11
• Summary: This gene encodes a member of the phospholipase A2 family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature enzyme. This calciu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018251	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO) Show/Hide all (74)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	20844270
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001516	Process	Prostaglandin biosynthetic process	IEA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001669	Component	Acrosomal vesicle	ISS
GO:0002532	Process	Production of molecular mediator involved in inflammatory response	IEA
GO:0003847	Function	1-alkyl-2-acetylglycerophosphocholine esterase activity	IDA	16962371
GO:0004620	Function	Phospholipase activity	IEA
GO:0004620	Function	Phospholipase activity	ISS	20844270
GO:0004623	Function	Phospholipase A2 activity	IEA
GO:0004623	Function	Phospholipase A2 activity	TAS	9188469
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 32814053, 33961781
GO:0005543	Function	Phospholipid binding	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	9188469
GO:0005615	Component	Extracellular space	IDA	21805676
GO:0005764	Component	Lysosome	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0006658	Process	Phosphatidylserine metabolic process	IDA	12359733
GO:0006658	Process	Phosphatidylserine metabolic process	IEA
GO:0007411	Process	Axon guidance	IDA	15927955
GO:0009566	Process	Fertilization	IEA
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IC	18511424
GO:0010884	Process	Positive regulation of lipid storage	IMP	18511424
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019369	Process	Arachidonate metabolic process	NAS	18511424
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IDA	20844270
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IEA
GO:0031069	Process	Hair follicle morphogenesis	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032308	Process	Positive regulation of prostaglandin secretion	IMP	18511424
GO:0034374	Process	Low-density lipoprotein particle remodeling	IDA	12021277
GO:0034638	Process	Phosphatidylcholine catabolic process	IDA	12021277
GO:0036335	Process	Intestinal stem cell homeostasis	IEA
GO:0042116	Process	Macrophage activation	IEA
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0042632	Process	Cholesterol homeostasis	ISS	20844270
GO:0043030	Process	Regulation of macrophage activation	IMP	18511424
GO:0043249	Process	Erythrocyte maturation	IEA
GO:0046337	Process	Phosphatidylethanolamine metabolic process	IDA	12359733
GO:0046337	Process	Phosphatidylethanolamine metabolic process	IEA
GO:0046470	Process	Phosphatidylcholine metabolic process	IBA
GO:0046470	Process	Phosphatidylcholine metabolic process	IDA	12359733, 16146426, 16962371
GO:0046470	Process	Phosphatidylcholine metabolic process	IEA
GO:0046471	Process	Phosphatidylglycerol metabolic process	IBA
GO:0046471	Process	Phosphatidylglycerol metabolic process	IDA	12359733
GO:0046471	Process	Phosphatidylglycerol metabolic process	IEA
GO:0046473	Process	Phosphatidic acid metabolic process	IDA	12359733
GO:0046473	Process	Phosphatidic acid metabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IBA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IDA	12021277, 12359733, 16146426, 16962371
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IEA
GO:0050482	Process	Arachidonate secretion	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0051247	Process	Positive regulation of protein metabolic process	IMP	18511424
GO:0051607	Process	Defense response to virus	IDA	16146426
GO:0051977	Process	Lysophospholipid transport	IDA	15927955
GO:0062234	Process	Platelet activating factor catabolic process	IDA	16962371
GO:0090238	Process	Positive regulation of arachidonate secretion	IEA
GO:0090238	Process	Positive regulation of arachidonate secretion	ISS	20844270
GO:0090370	Process	Negative regulation of cholesterol efflux	IEA
GO:0090370	Process	Negative regulation of cholesterol efflux	ISS	20844270
GO:0141193	Process	Nuclear receptor-mediated signaling pathway	IDA	20844270
GO:0141193	Process	Nuclear receptor-mediated signaling pathway	IEA
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2000344	Process	Positive regulation of acrosome reaction	IEA
GO:2000344	Process	Positive regulation of acrosome reaction	ISS

Other IDs

• MIM: 603603
• HGNC: 9029
• e!Ensembl: ENSG00000069764

Protein

• UniProt ID: O15496
• Protein name: Group 10 secretory phospholipase A2 (EC 3.1.1.4) (Group X secretory phospholipase A2) (GX sPLA2) (sPLA2-X) (Phosphatidylcholine 2-acylhydrolase 10)
• Protein function: Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids (PubMed:12021277, PubMed:9188469). Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids with preference for p
• PDB: 1LE6 , 1LE7 , 4UY1 , 5G3M , 5OW8 , 5OWC , 6G5J
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00068	Phospholip_A2_1	44 → 150	Phospholipase A2	Domain

• Tissue specificity: TISSUE SPECIFICITY: Found in spleen, thymus, peripheral blood leukocytes, pancreas, lung, and colon (PubMed:9188469). Expressed in neuronal fibers in dorsal root ganglia and in peripheral tissues including stomach, white adipose tissue and prostate (at pr
• Sequence:

  MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPI
  AYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGP
  AENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD

• Sequence length: 165

Pathways

KEGG Pathway	Reactome Pathway
Glycerophospholipid metabolism	Acyl chain remodelling of PC
Ether lipid metabolism	Acyl chain remodelling of PS
Arachidonic acid metabolism	Acyl chain remodelling of PE
Linoleic acid metabolism	Acyl chain remodelling of PI
alpha-Linolenic acid metabolism	Acyl chain remodelling of PG
Metabolic pathways	Synthesis of PA
Ras signaling pathway
Vascular smooth muscle contraction
Pancreatic secretion
Fat digestion and absorption

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PLA2G2D 15 shared pathwaysGlycerophospholipid metabolism, Ether lipid metabolism, Arachidonic acid metabolism, Linoleic acid metabolism, alpha-Linolenic acid metabolism, Ras signaling pathway, Vascular smooth muscle contraction, Pancreatic secretion, Fat digestion and absorption, Acyl chain remodelling of PC, Acyl chain remodelling of PS, Acyl chain remodelling of PE +3 more Related via 15 shared pathways including Glycerophospholipid metabolism, Ether lipid metabolism. PLA2G2E 15 shared pathwaysGlycerophospholipid metabolism, Ether lipid metabolism, Arachidonic acid metabolism, Linoleic acid metabolism, alpha-Linolenic acid metabolism, Ras signaling pathway, Vascular smooth muscle contraction, Pancreatic secretion, Fat digestion and absorption, Acyl chain remodelling of PC, Acyl chain remodelling of PS, Acyl chain remodelling of PE +3 more Related via 15 shared pathways including Glycerophospholipid metabolism, Ether lipid metabolism. PLA2G1B 15 shared pathwaysGlycerophospholipid metabolism, Ether lipid metabolism, Arachidonic acid metabolism, Linoleic acid metabolism, alpha-Linolenic acid metabolism, Ras signaling pathway, Vascular smooth muscle contraction, Pancreatic secretion, Fat digestion and absorption, Acyl chain remodelling of PC, Acyl chain remodelling of PS, Acyl chain remodelling of PE +3 more Related via 15 shared pathways including Glycerophospholipid metabolism, Ether lipid metabolism. PLA2G5 15 shared pathwaysGlycerophospholipid metabolism, Ether lipid metabolism, Arachidonic acid metabolism, Linoleic acid metabolism, alpha-Linolenic acid metabolism, Ras signaling pathway, Vascular smooth muscle contraction, Pancreatic secretion, Fat digestion and absorption, Acyl chain remodelling of PC, Acyl chain remodelling of PS, Acyl chain remodelling of PE +3 more Related via 15 shared pathways including Glycerophospholipid metabolism, Ether lipid metabolism. PLA2G2F 15 shared pathwaysGlycerophospholipid metabolism, Ether lipid metabolism, Arachidonic acid metabolism, Linoleic acid metabolism, alpha-Linolenic acid metabolism, Ras signaling pathway, Vascular smooth muscle contraction, Pancreatic secretion, Fat digestion and absorption, Acyl chain remodelling of PC, Acyl chain remodelling of PS, Acyl chain remodelling of PE +3 more Related via 15 shared pathways including Glycerophospholipid metabolism, Ether lipid metabolism.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PLA2G2D	0	[]	15	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PS","Acyl chain remodelling of PE"]	0	[]
PLA2G2E	0	[]	15	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PS","Acyl chain remodelling of PE"]	0	[]
PLA2G1B	0	[]	15	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PS","Acyl chain remodelling of PE"]	0	[]
PLA2G5	0	[]	15	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PS","Acyl chain remodelling of PE"]	0	[]
PLA2G2F	0	[]	15	["Glycerophospholipid metabolism","Ether lipid metabolism","Arachidonic acid metabolism","Linoleic acid metabolism","alpha-Linolenic acid metabolism","Ras signaling pathway","Vascular smooth muscle contraction","Pancreatic secretion","Fat digestion and absorption","Acyl chain remodelling of PC","Acyl chain remodelling of PS","Acyl chain remodelling of PE"]	0	[]

Diseases Linked via Similar Genes

Crohn disease Linked via 2 of 5 related genesPLA2G2D, PLA2G5 Inflammatory bowel disease Linked via 2 of 5 related genesPLA2G2D, PLA2G5 Obesity Linked via 2 of 5 related genesPLA2G2D, PLA2G2F Attention deficit hyperactivity disorder Linked via 1 of 5 related genesPLA2G1B Bipolar disorder Linked via 1 of 5 related genesPLA2G1B

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Crohn disease	2	["PLA2G2D","PLA2G5"]
Inflammatory bowel disease	2	["PLA2G2D","PLA2G5"]
Obesity	2	["PLA2G2D","PLA2G2F"]
Attention deficit hyperactivity disorder	1	["PLA2G1B"]
Bipolar disorder	1	["PLA2G1B"]