IL1B (interleukin 1 beta)

Gene

• Entrez ID: 3553
• Gene name: Interleukin 1 beta
• Gene symbol: IL1B
• Synonyms (NCBI Gene): IL-1, IL1-BETA, IL1F2, IL1beta
• Chromosome: 2
• Chromosome location: 2q14.1
• Summary: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an impo

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1143627	G>A	Risk-factor	5 prime UTR variant, upstream transcript variant, genic upstream transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005830	hsa-miR-204-5p	Microarray	21282569
MIRT005951	hsa-miR-21-5p	Luciferase reporter assay, Microarray, qRT-PCR	21131358
MIRT733144	hsa-miR-155-5p	qRT-PCR	31766503
MIRT733149	hsa-miR-34a-5p	qRT-PCR	31766503
MIRT733150	hsa-let-7c-5p	qRT-PCR	31766503
MIRT734896	hsa-miR-362-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33459949
MIRT735074	hsa-miR-221-5p	Luciferase reporter assay, qRT-PCR, ELISA	33201565
MIRT735665	hsa-miR-340-5p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	32712318
MIRT733150	hsa-let-7c-5p	qRT-PCR	34198264
MIRT735818	hsa-miR-149-5p	qRT-PCR	34198264
MIRT735818	hsa-miR-149-5p	qRT-PCR	36250208
MIRT755648	hsa-miR-124-3p	Luciferase reporter assay, Western blotting, qRT-PCR	38146363
MIRT755847	hsa-miR-105-5p	qRT-PCR	34824551
MIRT1064204	hsa-miR-3682-5p	CLIP-seq
MIRT2247568	hsa-miR-3942-3p	CLIP-seq
MIRT2247569	hsa-miR-4670-3p	CLIP-seq
MIRT2247570	hsa-miR-4683	CLIP-seq
MIRT2437793	hsa-miR-124	CLIP-seq
MIRT2437794	hsa-miR-1256	CLIP-seq
MIRT2437795	hsa-miR-185	CLIP-seq
MIRT2437796	hsa-miR-2682	CLIP-seq
MIRT2437797	hsa-miR-3064-5p	CLIP-seq
MIRT2437798	hsa-miR-3134	CLIP-seq
MIRT2437799	hsa-miR-3147	CLIP-seq
MIRT2437800	hsa-miR-3160-3p	CLIP-seq
MIRT1064204	hsa-miR-3682-5p	CLIP-seq
MIRT2437801	hsa-miR-3684	CLIP-seq
MIRT2437802	hsa-miR-3714	CLIP-seq
MIRT2437803	hsa-miR-3910	CLIP-seq
MIRT2437804	hsa-miR-3945	CLIP-seq
MIRT2437805	hsa-miR-4253	CLIP-seq
MIRT2437806	hsa-miR-4259	CLIP-seq
MIRT2437807	hsa-miR-4306	CLIP-seq
MIRT2437808	hsa-miR-4313	CLIP-seq
MIRT2437809	hsa-miR-4428	CLIP-seq
MIRT2437810	hsa-miR-449c	CLIP-seq
MIRT2437811	hsa-miR-4514	CLIP-seq
MIRT2437812	hsa-miR-4520a-3p	CLIP-seq
MIRT2437813	hsa-miR-4534	CLIP-seq
MIRT2437814	hsa-miR-4644	CLIP-seq
MIRT2247570	hsa-miR-4683	CLIP-seq
MIRT2437815	hsa-miR-4692	CLIP-seq
MIRT2437816	hsa-miR-4766-5p	CLIP-seq
MIRT2437817	hsa-miR-4768-3p	CLIP-seq
MIRT2437818	hsa-miR-488	CLIP-seq
MIRT2437819	hsa-miR-506	CLIP-seq
MIRT2437820	hsa-miR-940	CLIP-seq
MIRT2437821	hsa-miR-943	CLIP-seq
MIRT2550936	hsa-miR-1178	CLIP-seq
MIRT2437793	hsa-miR-124	CLIP-seq
MIRT2437794	hsa-miR-1256	CLIP-seq
MIRT2550937	hsa-miR-1291	CLIP-seq
MIRT2550938	hsa-miR-149	CLIP-seq
MIRT2437795	hsa-miR-185	CLIP-seq
MIRT2550939	hsa-miR-24	CLIP-seq
MIRT2437796	hsa-miR-2682	CLIP-seq
MIRT2550940	hsa-miR-299-3p	CLIP-seq
MIRT2437797	hsa-miR-3064-5p	CLIP-seq
MIRT2550941	hsa-miR-3065-5p	CLIP-seq
MIRT2550942	hsa-miR-3121-3p	CLIP-seq
MIRT2437798	hsa-miR-3134	CLIP-seq
MIRT2437799	hsa-miR-3147	CLIP-seq
MIRT2437800	hsa-miR-3160-3p	CLIP-seq
MIRT2550943	hsa-miR-3174	CLIP-seq
MIRT2550944	hsa-miR-328	CLIP-seq
MIRT1064204	hsa-miR-3682-5p	CLIP-seq
MIRT2437801	hsa-miR-3684	CLIP-seq
MIRT2437802	hsa-miR-3714	CLIP-seq
MIRT2437803	hsa-miR-3910	CLIP-seq
MIRT2550945	hsa-miR-3937	CLIP-seq
MIRT2437804	hsa-miR-3945	CLIP-seq
MIRT2437805	hsa-miR-4253	CLIP-seq
MIRT2437806	hsa-miR-4259	CLIP-seq
MIRT2550946	hsa-miR-4284	CLIP-seq
MIRT2550947	hsa-miR-4300	CLIP-seq
MIRT2437807	hsa-miR-4306	CLIP-seq
MIRT2437808	hsa-miR-4313	CLIP-seq
MIRT2437809	hsa-miR-4428	CLIP-seq
MIRT2550948	hsa-miR-4446-3p	CLIP-seq
MIRT2550949	hsa-miR-4450	CLIP-seq
MIRT2550950	hsa-miR-4492	CLIP-seq
MIRT2550951	hsa-miR-4498	CLIP-seq
MIRT2437810	hsa-miR-449c	CLIP-seq
MIRT2550952	hsa-miR-4505	CLIP-seq
MIRT2437811	hsa-miR-4514	CLIP-seq
MIRT2437812	hsa-miR-4520a-3p	CLIP-seq
MIRT2437813	hsa-miR-4534	CLIP-seq
MIRT2437814	hsa-miR-4644	CLIP-seq
MIRT2550953	hsa-miR-4645-5p	CLIP-seq
MIRT2550954	hsa-miR-4648	CLIP-seq
MIRT2550955	hsa-miR-4652-3p	CLIP-seq
MIRT2550956	hsa-miR-4654	CLIP-seq
MIRT2550957	hsa-miR-4667-5p	CLIP-seq
MIRT2550958	hsa-miR-4673	CLIP-seq
MIRT2247570	hsa-miR-4683	CLIP-seq
MIRT2437815	hsa-miR-4692	CLIP-seq
MIRT2550959	hsa-miR-4700-5p	CLIP-seq
MIRT2550960	hsa-miR-4731-5p	CLIP-seq
MIRT2437816	hsa-miR-4766-5p	CLIP-seq
MIRT2437817	hsa-miR-4768-3p	CLIP-seq
MIRT2550961	hsa-miR-4769-5p	CLIP-seq
MIRT2437818	hsa-miR-488	CLIP-seq
MIRT2550962	hsa-miR-495	CLIP-seq
MIRT2437819	hsa-miR-506	CLIP-seq
MIRT2550963	hsa-miR-663b	CLIP-seq
MIRT2550964	hsa-miR-762	CLIP-seq
MIRT2550965	hsa-miR-920	CLIP-seq
MIRT2437820	hsa-miR-940	CLIP-seq
MIRT2437821	hsa-miR-943	CLIP-seq
MIRT2550937	hsa-miR-1291	CLIP-seq
MIRT2550938	hsa-miR-149	CLIP-seq
MIRT2550939	hsa-miR-24	CLIP-seq
MIRT2550941	hsa-miR-3065-5p	CLIP-seq
MIRT2550943	hsa-miR-3174	CLIP-seq
MIRT2550944	hsa-miR-328	CLIP-seq
MIRT1064204	hsa-miR-3682-5p	CLIP-seq
MIRT2437801	hsa-miR-3684	CLIP-seq
MIRT2550945	hsa-miR-3937	CLIP-seq
MIRT2550946	hsa-miR-4284	CLIP-seq
MIRT2437808	hsa-miR-4313	CLIP-seq
MIRT2550948	hsa-miR-4446-3p	CLIP-seq
MIRT2550949	hsa-miR-4450	CLIP-seq
MIRT2550950	hsa-miR-4492	CLIP-seq
MIRT2550951	hsa-miR-4498	CLIP-seq
MIRT2550952	hsa-miR-4505	CLIP-seq
MIRT2550955	hsa-miR-4652-3p	CLIP-seq
MIRT2550957	hsa-miR-4667-5p	CLIP-seq
MIRT2550959	hsa-miR-4700-5p	CLIP-seq
MIRT2550960	hsa-miR-4731-5p	CLIP-seq
MIRT2550962	hsa-miR-495	CLIP-seq
MIRT2550963	hsa-miR-663b	CLIP-seq
MIRT2550964	hsa-miR-762	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AHR	Unknown	23349129
CEBPB	Activation	17386941
CEBPB	Unknown	10383163;10801783
E2F1	Unknown	17707233
HMGA1	Unknown	15901130
HSF1	Repression	10328874
IRF8	Activation	17386941
JUN	Unknown	11306276
JUNB	Unknown	11306276
KLF4	Repression	22449968
NFIL3	Repression	8547328
NFKB1	Activation	12686724;14960579;8413223;8679226;9878621
NFKB1	Unknown	10080875;10963848;16433741;17707233;18285351;20336759;9058643
NFKBIA	Repression	15228586
REL	Activation	8413223
RELA	Activation	12686724;14960579;8021507;8413223;8679226;9878621
RELA	Unknown	10080875;10963848;16433741;17707233;18285351;20336759;9058643
SIRT1	Unknown	21245135
SPI1	Activation	17386941
SPI1	Unknown	10801783
STAT1	Activation	17386941
SUGP1	Activation	9878621
YY1	Unknown	22467534

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001660	Process	Fever generation	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0002711	Process	Positive regulation of T cell mediated immunity	IC	1919436
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	1919436, 19727662, 28331908, 32719155, 33246504
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	IMP	2989698
GO:0005125	Function	Cytokine activity	TAS	28720735
GO:0005149	Function	Interleukin-1 receptor binding	IEA
GO:0005149	Function	Interleukin-1 receptor binding	NAS	1919436
GO:0005178	Function	Integrin binding	IDA	29030430
GO:0005515	Function	Protein binding	IPI	15030775, 15817483, 32272059
GO:0005576	Component	Extracellular region	IDA	20041150
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	1919436
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	33377178, 33883744
GO:0005615	Component	Extracellular space	IDA	12483741
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	IMP	3493774
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	TAS	9218611
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IDA	10748004, 19727662
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	NAS	1919436
GO:0006954	Process	Inflammatory response	TAS	28720735
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	9218611, 10786823
GO:0007254	Process	JNK cascade	IEA
GO:0007267	Process	Cell-cell signaling	TAS	2989698
GO:0007566	Process	Embryo implantation	TAS	16720713
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	25204733
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	3493774
GO:0009743	Process	Response to carbohydrate	IEA
GO:0010573	Process	Vascular endothelial growth factor production	IDA	12794819
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IDA	12958148
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IEA
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	ISS
GO:0010628	Process	Positive regulation of gene expression	IDA	25327529
GO:0010628	Process	Positive regulation of gene expression	IDA	11090614, 21559518, 23817958, 26687115, 29384235
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IGI	29384235
GO:0010641	Process	Positive regulation of platelet-derived growth factor receptor signaling pathway	IDA	16477012
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IDA	25204733
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IDA	19032770
GO:0010829	Process	Negative regulation of D-glucose transmembrane transport	IEA
GO:0010829	Process	Negative regulation of D-glucose transmembrane transport	ISS	16865359
GO:0014805	Process	Smooth muscle adaptation	NAS	16477012
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	10748004
GO:0019904	Function	Protein domain specific binding	IPI	16575408
GO:0030141	Component	Secretory granule	IEA
GO:0030213	Process	Hyaluronan biosynthetic process	IDA	15100360
GO:0030335	Process	Positive regulation of cell migration	IDA	25204733
GO:0030593	Process	Neutrophil chemotaxis	IEA
GO:0030949	Process	Positive regulation of vascular endothelial growth factor receptor signaling pathway	IC	12958148
GO:0031394	Process	Positive regulation of prostaglandin biosynthetic process	IGI	29384235
GO:0031622	Process	Positive regulation of fever generation	IEA
GO:0031622	Process	Positive regulation of fever generation	ISS
GO:0031982	Component	Vesicle	IEA
GO:0032308	Process	Positive regulation of prostaglandin secretion	IEA
GO:0032308	Process	Positive regulation of prostaglandin secretion	ISS
GO:0032496	Process	Response to lipopolysaccharide	IDA	19193853
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	20027291
GO:0032729	Process	Positive regulation of type II interferon production	IDA	10653850, 20027291
GO:0032743	Process	Positive regulation of interleukin-2 production	IMP	2989698
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IGI	29384235
GO:0032755	Process	Positive regulation of interleukin-6 production	TAS	16865359
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	19524870
GO:0033092	Process	Positive regulation of immature T cell proliferation in thymus	IBA
GO:0033198	Process	Response to ATP	IEA
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	IDA	15100360
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	NAS	19281832
GO:0035234	Process	Ectopic germ cell programmed cell death	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	1919436
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IDA	10748004
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	25327529, 26020802
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	10383454, 12958148, 19727662
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	18201371
GO:0043409	Process	Negative regulation of MAPK cascade	IEA
GO:0043409	Process	Negative regulation of MAPK cascade	ISS	16865359
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	10748004
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IDA	8383325
GO:0045766	Process	Positive regulation of angiogenesis	IDA	25204733
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045766	Process	Positive regulation of angiogenesis	ISS
GO:0045833	Process	Negative regulation of lipid metabolic process	IEA
GO:0045833	Process	Negative regulation of lipid metabolic process	ISS	16865359
GO:0045840	Process	Positive regulation of mitotic nuclear division	IMP	2989698
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	15100360
GO:0045917	Process	Positive regulation of complement activation	IGI	29384235
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046330	Process	Positive regulation of JNK cascade	ISS
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IEA
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	ISS	16865359
GO:0046827	Process	Positive regulation of protein export from nucleus	NAS	19281832
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048143	Process	Astrocyte activation	IEA
GO:0050691	Process	Regulation of defense response to virus by host	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IGI	29384235
GO:0050767	Process	Regulation of neurogenesis	ISS
GO:0050768	Process	Negative regulation of neurogenesis	TAS	20018408
GO:0050796	Process	Regulation of insulin secretion	IDA	8383325
GO:0050805	Process	Negative regulation of synaptic transmission	IEA
GO:0050805	Process	Negative regulation of synaptic transmission	ISS
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	33377178
GO:0050900	Process	Leukocyte migration	IEA
GO:0050995	Process	Negative regulation of lipid catabolic process	IDA	19032770
GO:0050996	Process	Positive regulation of lipid catabolic process	IEA
GO:0050996	Process	Positive regulation of lipid catabolic process	ISS	16865359
GO:0050999	Process	Regulation of nitric-oxide synthase activity	IDA	15899045
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IDA	18373975
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	16477012
GO:0060252	Process	Positive regulation of glial cell proliferation	IGI	1752215
GO:0060355	Process	Positive regulation of cell adhesion molecule production	NAS	19281832
GO:0070164	Process	Negative regulation of adiponectin secretion	IEA
GO:0070164	Process	Negative regulation of adiponectin secretion	ISS	16865359
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IBA
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IDA	25204733
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	19727662
GO:0070487	Process	Monocyte aggregation	IDA	15100360
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IDA	2950091, 9065432, 9430229, 10854325, 14625308, 20485341
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IDA	1919436, 2950091, 10383454, 12958148, 19727662, 25327529, 28331908, 32719155, 33377178
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IEA
GO:0070555	Process	Response to interleukin-1	IDA	29441883
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071466	Process	Cellular response to xenobiotic stimulus	IDA	19158679
GO:0071639	Process	Positive regulation of monocyte chemotactic protein-1 production	IDA	19524870
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:0097398	Process	Cellular response to interleukin-17	IEA
GO:0150078	Process	Positive regulation of neuroinflammatory response	TAS	26753638
GO:1900745	Process	Positive regulation of p38MAPK cascade	IEA
GO:1900745	Process	Positive regulation of p38MAPK cascade	ISS
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	18390750
GO:1902680	Process	Positive regulation of RNA biosynthetic process	IDA	29384235
GO:1903140	Process	Regulation of establishment of endothelial barrier	IDA	25816133
GO:1903530	Process	Regulation of secretion by cell	IEA
GO:1903597	Process	Negative regulation of gap junction assembly	IDA	11090614
GO:1905075	Process	Positive regulation of tight junction disassembly	IDA	18390750
GO:2000556	Process	Positive regulation of T-helper 1 cell cytokine production	IDA	10653850
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IDA	10748004

Other IDs

• MIM: 147720
• HGNC: 5992
• e!Ensembl: ENSG00000125538

Protein

• UniProt ID: P01584
• Protein name: Interleukin-1 beta (IL-1 beta) (Catabolin)
• Protein function: Potent pro-inflammatory cytokine (PubMed:10653850, PubMed:12794819, PubMed:28331908, PubMed:3920526). Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and
• PDB: 1HIB, 1I1B, 1IOB, 1ITB, 1L2H, 1S0L, 1T4Q, 1TOO, 1TP0, 1TWE, 1TWM, 21BI, 2I1B, 2KH2, 2NVH, 31BI, 3LTQ, 3O4O, 3POK, 41BI, 4DEP, 4G6J, 4G6M, 4GAF, 4GAI, 4I1B, 5BVP, 5I1B, 5MVZ, 5R7W, 5R85, 5R86, 5R87, 5R88, 5R89, 5R8A, 5R8B, 5R8C, 5R8D, 5R8E, 5R8F, 5R8G, 5R8H, 5R8I, 5R8J, 5R8K, 5R8L, 5R8M, 5R8N, 5R8O, 5R8P
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02394	IL1_propep	1 → 103	Interleukin-1 propeptide	Family
  PF00340	IL1	147 → 264	Interleukin-1 / 18	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in activated monocytes/macrophages (at protein level). {ECO:0000269|PubMed:15192144}.
• Sequence:

  MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
  FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
  SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
  KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
  SQAENMPVFLGGTKGGQDITDFTMQFVSS

• Sequence length: 269

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTHRACOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Antisynthetase syndrome	Affects; association; Benign; other	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, GOUTY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASBESTOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET'S SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES, TRAUMATIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHOPULMONARY DYSPLASIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CALCINOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL DISC DEGENERATIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Affects; association; Benign; other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC PROGRESSIVE EXTERNAL OPHTHALMOPLEGIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease, susceptibility to, 2	not provided	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTL CARIES-SMOOTH SURF	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOMYOSITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF EYE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DRY EYE SYNDROMES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Affects; association; Benign; other	ClinVar Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ESSENTIAL HYPERTENSION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer susceptibility after h. pylori infection	risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRITIS, ATROPHIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK MALIGNANT NEOPLASIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE PROLAPSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOLYTIC-UREMIC SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEREMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC POLYMYOSITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IL1B-related disorder	Likely benign; Affects; association; Benign; other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERVERTEBRAL DISC DEGENERATION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATOCONUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISABILITIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS, CUTANEOUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS, VISCERAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELAS SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MERRF SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL MYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOSITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUTROPENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC ATROPHY, HEREDITARY, LEBER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROPHARYNX CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS, POSTMENOPAUSAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYMYOSITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYMYOSITIS OSSIFICANS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PYOGENIC ARTHRITIS, PYODERMA GANGRENOSUM AND ACNE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PYOGENIC ARTHRITIS, PYODERMA GANGRENOSUM, AND ACNE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIGEMINAL NEURALGIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URTICARIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AA amyloidosis	AA amyloidosis	BEFREE	15257727, 19026124, 26819362, 29578360, 30476289		★☆☆☆☆ Found in Text Mining only
Acne	Acne	BEFREE	23884315, 24157462, 28193081, 28588486, 29964032, 30155445		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	23884315, 28193081, 28588486, 29964032, 30155445		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	10950380		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	BEFREE	25223242		★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	18675847		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	20709104, 22768033, 27608541, 30320614		★☆☆☆☆ Found in Text Mining only
Acute encephalopathy	Encephalopathy	BEFREE	31709864		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	24819208, 9264377		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	1351762, 8417962, 9013854		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	1700730		★☆☆☆☆ Found in Text Mining only
Acute otitis media	Otitis media	BEFREE	24718616		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	11331456, 18815552, 23418608, 24072654, 25730036, 26125871, 28828564, 29303910, 29393354, 29511434, 29517628, 29779831, 29859191, 29890468, 30144357, 30716587, 31606729, 9637544		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	28343272, 29490936, 29717364, 8193361, 8589272		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12730860, 28356927, 30032820, 7635448		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17006606		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	19028472		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	29208671		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24487386, 30121641, 31143511, 7657294		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	22819319		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	19028472		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	19028472		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	19028472		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	21160427		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	16775170		★☆☆☆☆ Found in Text Mining only
Adrenal Cortex Diseases	Adrenal Cortex Diseases	BEFREE	29782315		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	9007702		★☆☆☆☆ Found in Text Mining only
Adrenal Hyperplasia Congenital	Congenital adrenal hyperplasia	Pubtator	26657940	Associate	★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	15730917, 19086955, 22902304, 28722826, 30186412, 31849082		★☆☆☆☆ Found in Text Mining only
Adrenomyeloneuropathy	Adrenomyeloneuropathy	BEFREE	28722826		★☆☆☆☆ Found in Text Mining only
Adult Learning Disorders	Learning Disorders	CTD_human_DG	21290410		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10753855, 11529470, 1883481, 2887587, 7628587		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	17265504, 27098789, 27803134, 30367666, 9865793		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	CTD_human_DG	19035492		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	23221073, 24012762, 26760997, 28438165, 29454857, 30288946, 30685605, 31379825		★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	21290410		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	10328654, 10872952, 12974682, 14974822, 17335371, 18723088, 19184295, 20059418, 20335539, 21593780, 23996710, 24352581, 25330301, 26038188, 26263533, 29395573, 30206230, 30285894, 31557327		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	14533660, 28558302, 28694089, 29115624, 30127914, 31096432, 31548841, 31740004		★☆☆☆☆ Found in Text Mining only
Alloimmunisation	Alloimmunisation	BEFREE	29845661		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	10077728, 11703512, 12190641, 23542780, 23584371, 8573920		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	10077728, 11703512, 12190641, 23584371, 8573920		★☆☆☆☆ Found in Text Mining only
Alopecia universalis	Alopecia	BEFREE	30666488		★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	37833889	Associate	★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	BEFREE	10934117		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	17266442, 23640035		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10716257, 12050157, 15201366, 15377701, 17563722, 18830724, 20184726, 21368376, 21509504, 21992747, 22498095, 22832605, 23199001, 24359497, 25197660, 26626881, 26937653, 26939933, 28100246, 28539126, 28943632, 28984607, 30336198, 31455413, 33101286, 34209408, 35523454, 36031604, 36142143, 36326669, 39880323	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	11483667, 21741294, 30741672, 37679689, 38599243	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	18675847		★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	22498095, 28765037, 31693761		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	16053468, 28053004		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	18675847		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	18675847		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	18675847		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	16785446, 24966375, 25096614, 25438464, 26202697, 27927236, 28336494, 28501482, 28669260, 29437698, 29477641, 29578360, 29782315, 29967321, 30981749, 31057541, 31175888, 31383341, 31775905		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	25438464	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	28812775		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	25311268, 27880990, 28170441, 28831083, 28856541, 29575052, 31596526		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	28437540, 32246039, 35627142	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	21062492	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	24604706, 28740254, 30550885, 30861996, 31362031		★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	25860946	Stimulate	★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	28064547		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	24036988		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	15257727, 16634833, 23451225, 26946405, 28438835		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	18781863		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	37934948	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	23451225	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	3264697	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	11001897, 33776989, 34627079, 36969226	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	24551209, 25548984, 33741688	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia, Diamond-Blackfan	Anemia	BEFREE	7691319		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	11001897, 25595815, 31448710, 31498653		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	35909487	Associate	★☆☆☆☆ Found in Text Mining only
Aneurysm, Dissecting	Aortic Aneurysm	BEFREE	30169834		★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	29554212	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	31257469, 35942210	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	10475771	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	18299273	Associate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	31415103		★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	31236065	Associate	★☆☆☆☆ Found in Text Mining only
Angiolymphoid hyperplasia	Angiolymphoid Hyperplasia	BEFREE	1954381		★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	17460270		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	30026598, 30326340		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	11145849, 11752505, 12468823, 15309690, 16206345, 16650794, 17259653, 17899305, 18484691, 18525349, 19930406, 20062062, 20652271, 21962386, 22285486, 22312160, 23928854, 29200018, 30322951, 30922195		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	LHGDN	18484691		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	37894839	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28578701, 29224225, 29363544, 31588122, 31609478		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	CTD_human_DG	25392278		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia	Anorexia	BEFREE	27375005, 27897393, 28212946		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia Nervosa	Anorexia	BEFREE	31398429		★☆☆☆☆ Found in Text Mining only
Anterior Cruciate Ligament Injuries	Anterior cruciate ligament injury	Pubtator	26762166	Associate	★☆☆☆☆ Found in Text Mining only
Anterior uveitis	Uveitis	BEFREE	30297336		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	CTD_human_DG	20005085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	25785264	Associate	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	29730433		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	25249351, 26891860, 28413930, 30504920, 32377159	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28189098, 28353360, 28373688, 28521881, 28866071, 28931410, 28969939, 29775877, 30425562, 30447911, 30504920, 31195034		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28189098, 28353360, 28373688, 28521881, 28866071, 28931410, 28969939, 29775877, 30425562, 30447911, 30504920, 31195034		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	32377159	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	25200056		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	34202072	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	17321344, 24618883	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	20348247	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	37445606	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	16268484, 23288154, 24618883, 26352243, 26941015, 28446225, 28912363, 29217508, 29472233, 29884291, 29976759, 31651935, 7966813		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Thoracic	Aortic Aneurysm	BEFREE	25200056		★☆☆☆☆ Found in Text Mining only
Aortic valve disorder	Aortic Valve Disease	BEFREE	30700131		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic valve disease	Pubtator	34935306	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	21241861	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	23735716	Associate	★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	7522519		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	24336024	Associate	★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	29151018		★☆☆☆☆ Found in Text Mining only
Arachnoid Cysts	Arachnoid cysts	Pubtator	31743616	Associate	★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10685360, 11073843, 14575520, 15654265, 16169330, 16487030, 16804330, 18268038, 19574724, 20651286, 21380730, 21411094, 21451572, 22681257, 22796220, 24190014, 24733347, 25216946, 25265644, 25936371, 26139463, 26185250, 26381780, 27692470, 27834690, 28260724, 28323859, 28394319, 28420489, 28589926, 28855077, 29073957, 29198612, 29257205, 29352570, 29371126, 29395573, 29425936, 29584915, 29588192, 29793629, 29880500, 29937375, 29960988, 30038218, 30071524, 30219977, 30320614, 30413028, 30583923, 30588602, 30698710, 30702995, 30761006, 30832770, 30881312, 30894604, 31011929, 31237148, 31415103, 31429763, 31437850, 31518877, 31629987, 31664319, 9863542		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriosclerosis	Arteriosclerosis	Pubtator	3491091, 3526909	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriovenous Malformations, Cerebral	Cerebral arteriovenous malformation	BEFREE	21768915		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	10741403, 11007768, 11039768, 11094434, 12009331, 12220548, 1386092, 14871456, 16710471, 16947381, 17195213, 17609389, 17853003, 18060042, 19010066, 19035520, 19824913, 20226838, 2026869, 21135226, 21357261, 21937456, 22449076, 22573549, 23341540, 23689131, 24277153, 25867281, 27206713, 27833025, 28249243, 28375155, 28457885, 28587618, 28645307, 29408684, 29753098, 29761402, 29941463, 30471320, 30552177, 30565030, 30691120, 30831463, 31155798, 31267533, 31298290, 31350760, 31426853, 31599092, 31614911, 31764352, 8507220, 8886998, 9317160		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	11714393, 16846531, 18346273, 2156847, 21835002, 22687048, 26577823, 30131320, 35095831	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	17393419, 33480001	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	18392953		★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Gouty arthritis	Pubtator	23738004, 26462562, 28458315, 28797095, 28915828, 29214547	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Gouty arthritis	Pubtator	35470716	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	18945879, 7858264	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	20740673	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	15851489, 17324969, 18576390, 19248102, 22281427, 28286780, 29928998, 31958219, 33452871, 34257378	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	28935693	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	10857783, 11714393, 11851889, 16918024, 22509827, 29434599, 33300400, 38124740, 7693825, 8245502	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16728461, 19661441, 27542294, 28245522	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Reactive	Reactive arthritis	Pubtator	10524675	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10366101, 10976082, 11083259, 11168012, 11171698, 11219391, 11219394, 11406522, 11714393, 11966774, 12115161, 12139733, 12528110, 12571842, 12632414, 12651614, 12695561, 12847684, 12937131, 1420999, 14872485, 15077295, 15248214, 15476200, 15880345, 16052586, 16311048, 16436009, 16802346, 16947382, 17223662, 17593860, 17697361, 17963503, 17968879, 18311795, 18576312, 19714631, 19824913, 20604932, 2075829, 20935210, 21129157, 21225692, 21749686, 21953341, 22590509, 22749729, 23055831, 23335987, 24286242, 24374632, 24434549, 24552146, 24989895, 25436214, 25452308, 25484525, 25729037, 26149185, 26314565, 26385789, 26448682, 26516624, 27736946, 27824863, 28114971, 28316377, 28532672, 28569167, 29410669, 29536646, 29554943, 29768427, 29784872, 30058700, 30272996, 30897288, 30911117, 30975731, 31061532, 31376255, 31498070, 31992083, 32131874, 32365786, 32678069, 32908449, 33101286, 33162829, 33300400, 33605409, 33977746, 34664888, 35432723, 35776431, 36439145, 36929812, 37174663, 39321281, 39394168, 7867645, 8163935, 8325995, 9041934, 9764613, 9797555, 9832620	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10733472, 12810425, 14680510, 15972956, 16728461, 22275154, 24351865, 25164131, 26095630, 26339358, 28245522, 3264697, 32868411, 34290266, 35470716, 35955467, 37202736, 37386795	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12296865	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	23738004, 27001429, 28167912, 28797095, 29056937, 29214547, 29482609, 29852732, 30228306, 30637441, 30739483, 31745884		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	12890860, 18484691, 27188858, 27619557, 28245522, 29193391, 30524287, 9548075		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	LHGDN	16918024		★☆☆☆☆ Found in Text Mining only
ARTHROGRYPOSIS, DISTAL, TYPE 2B	Sheldon-Hall syndrome	BEFREE	28948356		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	15341921, 19010066, 27188858, 29766025, 29785089, 7492245, 9135824		★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	BEFREE	8473757		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asphyxia	Asphyxia	Pubtator	29931509	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11027520, 12644720, 12938145, 1374772, 14764429, 18763028, 18926055, 19473523, 19801525, 20082309, 20671916, 20689814, 21252117, 23377347, 23602199, 23614732, 23855553, 24275925, 24568840, 24582314, 24588865, 24654313, 25217662, 25278425, 25950204, 27007676, 27130862, 27155035, 27188427, 27702673, 27725186, 27982737, 27992959, 28011059, 28252317, 28262817, 28356505, 28528200, 28716529, 28861755, 29031476, 29034996, 29103994, 29279058, 30306746, 30422895, 30675924, 30682452, 30888839, 31066119, 31550242, 31676759, 31703379, 31727692, 8703481		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	11704539, 16203992, 18492738, 18774390, 18780949, 19473523, 19710636, 24136334, 24654313, 25616863, 28011059, 30998987, 32842623, 32900903, 33506909, 34916261, 35570583, 36572355, 39465738	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	11898000		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	19842845	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	24641287, 27155035, 31903716, 33515711, 35572500	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	9176529		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	Pubtator	10037734, 12767055, 17121800, 18297103, 40565357	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10654577, 10713367, 11814314, 1407609, 14603252, 16405508, 1732280, 1937574, 2022738, 21732076, 23164507, 2646146, 2783391, 29734739, 30101649, 7593467, 8074713, 8283050, 8552275, 8627304, 8817534, 8903854		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	22818222, 2646146	Stimulate	★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	32554850	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	10489901		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	32554850	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10590238, 10790428, 15383152, 16613759, 17351655, 19092239, 19347053, 19574724, 20184726, 20805419, 22768033, 23484124, 24063019, 24190014, 24665821, 25185259, 25936371, 27207962, 28135700, 30894604, 32276737, 33936102, 34343257, 34427537, 34439835, 35052452, 35137664, 35385050, 35509837, 36633253, 37339167, 37505165, 37880698, 39515317, 9423716, 9428650	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10685360, 11073843, 14575520, 15654265, 16169330, 16487030, 16804330, 18268038, 19574724, 20651286, 21380730, 21411094, 21451572, 22681257, 22796220, 24190014, 24733347, 25216946, 25265644, 25936371, 26139463, 26185250, 26381780, 27692470, 27834690, 28260724, 28323859, 28394319, 28420489, 28589926, 28855077, 29073957, 29198612, 29257205, 29352570, 29371126, 29395573, 29425936, 29557210, 29584915, 29588192, 29793629, 29880500, 29937375, 29960988, 30038218, 30071524, 30219977, 30320614, 30413028, 30583923, 30588602, 30591286, 30698710, 30702995, 30761006, 30832770, 30881312, 30894604, 31011929, 31237148, 31415103, 31429763, 31437850, 31518877, 31629987, 31664319, 9863542		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	19228941		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	20637088	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	21214658, 23713812, 26056004, 29595637, 30930414, 31584315, 31623508		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	29595637	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32383373, 38551417	Associate	★☆☆☆☆ Found in Text Mining only
ATRIAL SEPTAL DEFECT 1	Atrial Septal Defect	BEFREE	29214007, 30404814, 31551826		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	29214007, 30404814, 31551826		★☆☆☆☆ Found in Text Mining only
Atrioventricular Septal Defect	Atrioventricular septal defect	BEFREE	27396555		★☆☆☆☆ Found in Text Mining only
Atrioventricular Septal Defect	Atrioventricular septal defect	Pubtator	27396555	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	16120761, 23995914	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	15365221, 28664398		★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	23313575		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	19211157, 23497090, 26392128, 27957319, 31554204, 32129578, 39481220	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	32677958	Stimulate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	23497090, 25912394, 26392128, 26728085, 29137272, 29178897, 29214007, 30149804, 30404814, 30971960, 31125917, 31551826, 31554204		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	28070266		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	10498633, 29692782, 30735937, 8076766		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	11127488, 11380474, 15192144, 16380445, 19793334, 20498357, 23382179, 24890729, 30761138, 30894604, 30902060, 33776573	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11727511, 12220548, 12763679, 15088297, 17867984, 18418395, 20370570, 20414049, 20465500, 21163704, 21304099, 21380730, 22124790, 22878044, 22878274, 23382179, 23464866, 23651166, 23689131, 24446657, 25017970, 25917106, 26142671, 26164496, 27043286, 27603301, 27926540, 28041873, 28207428, 28495184, 28587079, 29415894, 29454070, 29549805, 29571080, 29633070, 29692782, 29802240, 29915579, 30014358, 30042333, 30045523, 30182366, 30358982, 30442668, 30586442, 30659328, 30728750, 30761138, 30827881, 30894604, 30902060, 30995499, 31292215, 31345729, 31382910, 31584126, 31746138, 31830463, 31848486, 8330041		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	36929812	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	1572693, 20929277		★☆☆☆☆ Found in Text Mining only
Autoinflammatory disorder	Autoinflammatory Disease	BEFREE	20173777, 20861596, 21480187, 22723549, 23087183, 24953660, 27187378, 27998728, 29633070, 29712770, 29766377, 30175395, 30466770		★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	28812775		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	39712014	Stimulate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26448050, 28343296, 28624051, 28665182, 28765925, 28912867, 29257269, 29399101, 29568888, 30029514, 30034795, 30272262, 30430645, 31210286, 31805184		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	10618692, 10870116		★☆☆☆☆ Found in Text Mining only
Balkan Nephropathy	Balkan Nephropathy	BEFREE	11427627, 17907045		★☆☆☆☆ Found in Text Mining only
Barber Say syndrome	Barber Say Syndrome	BEFREE	28273882		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	11889061, 26688097, 35328735	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	23806268, 27448962, 27807078, 29208671, 30998992		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	12730545, 15679582, 17211678, 17960403, 21418526, 23211828, 23464866, 23633568, 23928854, 24252048, 24267724, 24422572, 27603301, 27775096, 27981463, 28335798, 28523576, 28693405, 29806793, 30148652, 30547891, 30799530		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	15679582, 17960403		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	24105615, 28166214, 36226612	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	24135410, 24749687, 33957967	Stimulate	★☆☆☆☆ Found in Text Mining only
Benign Meningioma	Benign Meningioma	BEFREE	26840621		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	22467534		★☆☆☆☆ Found in Text Mining only
Bernard-Soulier Syndrome	Bernard Soulier Syndrome	BEFREE	28273882		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	29947343	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	LHGDN	14985387		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	15318032, 19125864, 19488045, 25855618, 28416092		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	15318032, 17239488, 19125864, 19488045, 25855618		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	19125864, 19488045, 33348197, 33667413	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	26257203, 30575805	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	29032575	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	28129679		★☆☆☆☆ Found in Text Mining only
Birdshot Chorioretinopathy	Birdshot chorioretinopathy	Pubtator	18941541	Associate	★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	28592436, 28984997		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15679809, 16698387, 19489682, 22895549, 27698389, 29684419, 29945448		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	1533785, 1932751, 8417962		★☆☆☆☆ Found in Text Mining only
Blau syndrome	Blau syndrome	Pubtator	25829188	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	11737511, 20059417, 31416821		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	20417488, 31416821	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	10050719, 11600466, 20935210, 21401926, 28682145, 33605409, 9864174	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	12869004, 27148834, 28361334, 28499891, 28962646, 28968889, 30324232, 31780258		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	15287939	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	11600466	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	9886334	Associate	★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	27991924		★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	9807705	Associate	★☆☆☆☆ Found in Text Mining only
Brachydactyly Type D	Brachydactyly	Pubtator	28504607	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Abscess	Brain Abscess	BEFREE	26187330		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	26166618, 9143252	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	26661157	Associate	★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	17335802	Associate	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	29196212		★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	29931509	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Injuries Traumatic	Brain injuries	Pubtator	21676422, 30596792, 31173307	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	15737438, 15756928, 17394460, 9236716		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	BEFREE	28780000, 31794744		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Brain ischemia	Pubtator	30539420	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Brain ischemia	Pubtator	9207638	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	8008165, 8297651		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	29734739		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12385002, 16319982, 16358261, 16464738, 17010072, 17510310, 1832651, 19267917, 19333723, 20437198, 21310944, 21731759, 21971413, 22595751, 22750628, 22818022, 23378578, 23927563, 24598028, 24670917, 24705025, 24716804, 25928089, 26362269, 26696367, 26745120, 27197202, 27207649, 27609180, 27786298, 27893337, 28143606, 28212736, 28405519, 28551814, 29047186, 29719585, 30012670, 30075885, 30075887, 30154549, 30217872, 30245970, 30324661, 30545915, 30641908, 30670488, 31007849, 31281724, 31297985, 31552036, 31676788, 31685946, 9257189		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16298037, 17516992, 28212736		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12201223, 15187102, 16464738, 17261184, 17385677, 17670913, 21057224, 21310944, 21486440, 23083134, 23378578, 23530106, 23991131, 24670917, 25928089, 26362269, 26448179, 26696754, 26745120, 27072893, 28143606, 28947144, 30641908, 30814616, 31297985, 31838945, 32098891, 32778144, 33846813, 34092579, 34272498, 34282169, 35045088, 36207349, 36499741, 36674955, 36922898, 37116152, 37556419, 37762557, 9885238	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	20418110, 32244518, 38263420	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bright Disease	Bright Disease	CTD_human_DG	10910440, 9403216		★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial hyperreactivity	Pubtator	23737648	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	10515411	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	25822228		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	24750386, 36561744	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	LHGDN	15539764		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	16813970, 19097983, 21178818, 28753596, 29941233, 30862773, 30969811, 31354700, 31354715		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	CTD_human_DG	16813970		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	30969811	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brooke-Spiegler syndrome	Brooke-Spiegler Syndrome	BEFREE	28273882		★☆☆☆☆ Found in Text Mining only
Brucellosis	Brucellosis	Pubtator	20404074	Stimulate	★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	31507596		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	9878621		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	9878621	Stimulate	★☆☆☆☆ Found in Text Mining only
Bursitis	Bursitis	BEFREE	21484857		★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	11076651, 17359523, 33047901	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	36610524	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Calcinosis	Calcinosis	Pubtator	36780769	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Calcinosis	Calcinosis	Pubtator	39313278	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Calcinosis cutis	Calcinosis cutis	BEFREE	27164190		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16610058, 16884377, 19904560, 20473875, 21988351, 23359190, 23383347, 23935506, 23995914, 24878968, 26158864, 27340011, 30010986, 31222982, 35395492, 36674955	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12620381, 27340011		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	12081561	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	31031757	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	23083134	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12651617, 15196593, 15967798, 16521194, 1660018, 17054948, 20467172, 21512226, 22302133, 24966965, 26757951, 27821810, 28427195, 29568203, 29802240, 29940792, 30794626, 31798276, 33466191, 34076990, 37208599, 39256453, 40139029, 8041631, 8639772	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34435646	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	21486440	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15679809, 16698387, 19489682, 22895549, 27698389, 29684419, 29945448		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	17356794		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16126303, 17361014, 17596594, 18757527, 19723873, 20035239, 21252117, 22160576, 22467534, 22951596, 23762239, 23784458, 25428391, 28212736, 28855077, 29408308, 29425646, 30832375, 31115506, 31503012, 31649305, 7635448, 8869967, 9204981		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	34638541	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24884871, 29224225, 35395492, 37914939, 38018872, 39260693, 39273323	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	1739130, 23342250, 24969107, 26323562, 32469992, 34433833, 35257717, 7656270	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18294286, 24768357	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	12171950	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22450746, 23383347	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	1739130	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	17307204		★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	19028472		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	19028472		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12538625, 14504049, 17141301, 18329282, 27035425, 30642295, 30697874, 8175024		★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	14973050		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	17002905, 17336407, 31689135, 8696938		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	26323562, 31057540	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	18654018, 38551417	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	34713710	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	22447464	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	19811434, 23382313, 28212578, 30942391, 31546610, 8624580		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	10685360, 21411094, 21814463, 23995233, 24458711, 25653183, 28478836, 28603178, 28939513, 29198612, 29310992, 29588192, 29764192, 29904899, 30097758, 30209355, 30834550, 31077280, 31127805, 31296155, 31612215, 31707836, 31738140, 9889413		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24086545, 26516624, 28105927, 32658258, 33172487, 34667241, 36012132, 36035865, 37821269	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	35008765, 36316672	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	29151018		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	25441669, 26195278, 32927275	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	33319833	Stimulate	★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	25813875, 28666239		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	10806046, 12810425, 15641077, 17097317, 18205922, 20955562, 21352802, 21682898, 21854562, 22249478, 23241445, 24034344, 24211233, 24831018, 24857974, 24873879, 24916039, 25092378, 26577823, 26762166, 26934732, 27669541, 28256567, 31434236, 3264773, 33161770, 34051811, 34116684, 34261061, 34502384, 36799502	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	28692119, 29444596, 29483929, 30219053, 34990303, 36859270	Stimulate	★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	1954381, 34686774	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	29542353, 29660334, 29956729		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	39959181	Associate	★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	27725770, 30597172		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	15936309, 16133447, 18346907, 23658628, 29543397, 31809599		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	LHGDN	18346907		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	35216089, 37047806, 37455655	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	35354862	Stimulate	★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	29203364		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	27730688, 35833818	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	10529471, 21919908, 28602833, 28672984, 28780000, 29567761, 30466781, 30628668, 31192907, 9099804		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	24063019, 24782217, 26592822, 31183363, 31480765, 32223966, 32782321, 35856366, 35862251, 36089763, 37268894	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	33378050, 33678651, 36089763	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	11527622, 18541658, 22266275, 29931509, 31779506		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	29931509	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	31364129		★☆☆☆☆ Found in Text Mining only
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	28868047		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	CTD_human_DG	10950380		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	BEFREE	11137152, 15539626, 16131798, 24190014, 25917615, 27856349, 28263009, 28751018, 28844626, 29131464, 29161722, 29310992, 29669581, 29788103, 30120034, 30465612, 31061403, 31535638, 31644666, 31727174, 31822249		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	LHGDN	15539626, 16131798		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	17332449		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	30664615	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17297261, 18333945, 21424904, 23935506, 24712845, 24905619, 25893807, 25925136, 31222982, 7594609		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	25893807, 30691208		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	17297261, 18333945, 21424904, 22193459, 23935506, 24712845, 24905619, 25893807, 25925136, 31222982, 7594609, 8959334		★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	31057540	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	1355757, 22337081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	18069763, 37507547	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	11413121	Associate	★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	18940468		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	18940468		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	29145837, 29643332		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	35196362	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	30039470		★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	28789951		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholesteatoma	Cholesteatoma	BEFREE	23440434, 25416861, 31254133, 8725537		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	33627146, 36837507	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	11352241, 11732857, 15316669, 15743474, 16391840, 16949904, 17328062, 19052845, 21378032, 21468922, 22840054, 24295650, 25270538, 25760020, 25823818, 27082436, 28447732, 28744712, 29434766, 30380653, 31260663, 31261155, 31683926, 9125252		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	24472657, 24901233, 25823818	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	27548143, 30380653	Stimulate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	17295899		★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	28031321, 29309764		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	15257727, 30894604, 31586435, 33246119, 35964023, 7790026, 8325995	Associate	★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	24550444, 27702670, 27785664, 8243611		★☆☆☆☆ Found in Text Mining only
Chronic Infantile Neurological, Cutaneous, and Articular Syndrome	Neurological, Cutaneous And Articular Syndrome	BEFREE	12483741, 14872505, 15476236, 16255047, 16899778, 17763411, 18609262, 21538043, 22723549, 23226210, 25302486, 26245468, 28118536, 28687790, 29766377, 29956067, 30388107		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	12722027, 15286433, 15925866, 15954918, 16088107, 16766392, 20551628, 8573006		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	15717635, 15925866, 22795294, 28178330, 29241624, 29371912, 29436520, 29659957, 29793629, 31002427, 31191559		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	29446321		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10618692, 10870116, 18271063, 2258703, 29156691, 8457468		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	27783593, 31434702		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	11001075, 15994259, 16919984, 18579366, 20082309, 20522791, 21814463, 24504887, 25174605, 25966220, 26864305, 27516147, 27883019, 27898728, 28006950, 28252317, 28262817, 28315490, 28490868, 29078843, 29137224, 29329680, 29443743, 29616282, 29804489, 29872287, 29990691, 30230590, 30380761, 31066258, 31601004, 31727692		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	15766560, 19096964		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic osteomyelitis	Osteomyelitis	BEFREE	30949508		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	10589805, 10711605, 11073323, 11669477, 11669478, 14974822, 15664906, 15966908, 16907768, 17711477, 17823082, 18541658, 19659894, 20490394, 20934174, 21848614, 22344672, 22348697, 23220433, 23241110, 23592003, 24612355, 24690098, 25252591, 25710474, 25741583, 26263533, 27068409, 27992569, 28557642, 28559203, 28691886, 28912468, 29065749, 29752711, 30142580, 30422379, 30755190, 30939298, 30982982, 8526804, 9379326, 9689617, 9797049		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	LHGDN	12362317, 15966908, 16945028, 18433382, 18980523		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	15664906, 18541658, 21198766, 22124068, 23592003, 24612355, 24690098, 25098998, 25530681, 25710474, 28341818, 30760334, 30922293, 33869630	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	16428799	Inhibit	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	28341818, 33638191	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic progressive external ophthalmoplegia	Progressive External Ophthalmoplegia	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Prostatitis with Chronic Pelvic Pain Syndrome	Prostatitis With Chronic Pelvic Pain Syndrome	BEFREE	30900284, 30927681		★☆☆☆☆ Found in Text Mining only
Chronic recurrent multifocal osteomyelitis	Recurrent multifocal osteomyelitis	Pubtator	25061439	Associate	★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	BEFREE	29867314		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	7523818		★☆☆☆☆ Found in Text Mining only
Ciliary Motility Disorders	Ciliary dyskinesia	Pubtator	29116124	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	14986816, 18331250, 24751829, 27730688		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	25388157		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	35262594	Stimulate	★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	16824509		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	28534174		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	27876639, 30586550, 31416745, 31731189		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	36455873	Stimulate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	23199001, 29196629, 35950445	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	10723681, 18492028, 23636052, 24550444, 26588861, 26590314, 27105524, 27553076, 27693323, 27893428, 27966619, 28069814, 28155620, 28188801, 28193514, 28383063, 28390705, 28487310, 28605639, 28614718, 28694747, 28695925, 28726741, 28731213, 28796256, 29444435, 29471245, 29518435, 29963998, 30127744, 30318564, 30396035, 30415241, 30487795, 30548286, 30559669, 30578631, 30611671, 30654310, 30662948, 30779979, 30823406, 30901677, 31175857, 31351364, 31525963, 31632588, 31634391, 31749791		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	CTD_human_DG	23810507, 24548422		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	Pubtator	29922282	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis Ulcerative	Ulcerative colitis	Pubtator	1427374, 20509889, 21129005, 26530134, 32871953, 33299870, 33359089, 33409535, 34717557, 35876170, 37078344, 38070204, 7586694, 9737666	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	18160345, 30029674, 30369485, 30583612, 31584460, 39647286, 9099934, 9414973	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis, Collagenous	Colitis	BEFREE	23566938		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10408390, 12096923, 16158955, 16326073, 16373718, 17086498, 22415590, 23174018, 24157941, 28797636, 29062241, 29932233, 31088266, 31407335, 31838134, 8425199		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	15059925, 18987561, 19028472		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	15063730, 17394066, 23174018, 30563955, 36127676, 37274872	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	BEFREE	23174018		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Polyps	Colonic polyps	Pubtator	38297356	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16006751, 17611673, 19863607, 20846456, 24194923, 24446182, 24557062, 24737547, 24859972, 25778902, 26109419, 27922186, 28157220, 28243990, 29736218, 29803656, 30180922, 30328795, 30547011, 30583087, 30650375, 30823406, 30862187, 30979739, 31272064, 31366457, 9042431		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10408390, 15188028, 19701245, 23174018, 24194923, 24859972, 25745771, 26075243, 26208990, 27264420, 28157220, 29096354, 29188362, 29719581, 30563955, 30598580, 34066976, 34083590, 34293235, 35687912, 36299603, 38376276, 39456247, 39766795	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12727794, 17611673		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22415590, 25875151, 32947866, 33832346	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33236127	Inhibit	★☆☆☆☆ Found in Text Mining only
Comedone	Comedone	BEFREE	30442066		★☆☆☆☆ Found in Text Mining only
Complement deficiency disease	Complement Component Deficiency	BEFREE	19717455		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	28027970, 29803661, 30911280, 31002731		★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	16824509		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	28298306, 28761430		★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	31434236	Associate	★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	19064791, 19092239, 29932521		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	31533404		★☆☆☆☆ Found in Text Mining only
Congenital neutropenia	Congenital Neutropenia	BEFREE	3264774		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11568062, 19329498, 21503626, 21811191, 24247107, 24531812, 28072632, 28232838, 28472396, 29141858, 29167166, 29182005, 29471939, 29549570, 29565745, 29584915, 29683921, 29904899, 30010800, 30033595, 30586730, 30860934, 30968846, 31105751, 31127805, 31415103, 31612215, 31672943		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	15135663		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Constipation	Constipation	Pubtator	33717115	Associate	★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	LHGDN	18416755		★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	BEFREE	31468302, 8930475		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23342250, 25453823, 27799249, 28915570, 31816951, 31820316, 9736430		★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal disease	Pubtator	1951636	Stimulate	★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	28584076, 30156862		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal neovascularization	Pubtator	30156862	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal Ulcer	BEFREE	23750216		★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal ulcer	Pubtator	23750216	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	14644395, 16470016, 17827818, 18716798, 20206549, 24422572, 27834690, 28142118, 28247937, 28916975, 29188498, 29588315, 30219977, 31051227, 31294625		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	11527622, 12551827, 14644395, 15051633, 16470016, 17827818, 18716798, 19142372, 20070880, 20206549, 21840356, 22780915, 24422572, 24530664, 26345772, 26505399, 27078871, 27521249, 27834690, 28181534, 28247937, 28478836, 28532406, 28916975, 29067980, 29310992, 29395365, 29588315, 30219977, 30961613, 31294625, 31469975		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	11527622, 17827818, 20184726, 20206549, 22738689, 22780915, 24244322, 24699044, 24736319, 25551602, 26304941, 26505399, 26926996, 29067980, 30961613, 31093510, 31411246, 32039564, 34320932, 35978364, 36646016	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	30333306, 30392493, 33029103, 33504180, 33731531	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	27461004, 29121163, 33660877, 34850451, 34861059, 34873417, 35282820	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	39344313	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	14644395, 16470016, 17827818, 18716798, 19053923, 20070881, 20206549, 23029154, 24422572, 27834690, 28247937, 28478836, 28916975, 29588315, 30219977, 31294625		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	15379752, 18716798		★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	25253465	Stimulate	★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	35866040, 39465738	Associate	★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	17881264	Inhibit	★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	26120586, 8610106	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	21442077, 29808007, 30249264		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	33780352	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	10192196, 10380697, 12468823, 15803022, 16503465, 18942751, 20509889, 21406388, 22817402, 22960943, 24412990, 24581881, 24776844, 25299544, 26481854, 28452812, 28523573, 29345374, 29358708, 30455704, 31002701, 31694333, 7543040, 7586694, 7809109, 7841354, 8899101, 9246063, 9414973		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	10389698, 16186640, 18157816, 20509889, 21129005, 21228771, 21797848, 26215868, 28166214, 29408806, 29517712, 29521042, 31694333, 33767696, 34629811, 35190924, 35529850, 39181275, 7586694, 7809109	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	18160345, 23658649, 30583612, 9414973	Stimulate	★☆☆☆☆ Found in Text Mining only
Cryopyrin-Associated Periodic Syndromes	Cryopyrin-Associated Periodic Syndromes	BEFREE	16344627, 16532456, 16931648, 18668535, 19180500, 19364880, 20069137, 20074280, 20074281, 20140476, 20353899, 20966753, 21109514, 22288581, 22288582, 22335455, 22891689, 23143333, 23223423, 23253918, 23684246, 23703389, 24084736, 24144430, 24671001, 24773462, 25217959, 25596455, 25730877, 25883259, 25963520, 26140469, 26161132, 26243511, 26245468, 26312542, 27036377, 27068928, 27134254, 27351923, 27441656, 27707729, 28079503, 28148962, 28586272, 28686751, 28692792, 29130929, 29378952, 29610014, 29633070, 29869008, 29956067, 30338413, 30352992, 31077002, 31185077, 31194989		★☆☆☆☆ Found in Text Mining only
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	9534885		★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	30239962		★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic neutropenia	Pubtator	37934948	Associate	★☆☆☆☆ Found in Text Mining only
Cyclical vomiting syndrome (disorder)	Cyclical Vomiting Syndrome	BEFREE	28682429		★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	19431193, 24853301	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	10515411, 24098711, 24885494, 31532390	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic fibrosis	Pubtator	12221127, 12507912, 18815075, 19431193, 21658316, 21731057, 22649552, 28982193, 29239766, 32118580	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic Fibrosis	BEFREE	19431193, 20837493, 21731057, 24853301, 24977480, 25648527, 26972847, 27799352, 28982193, 29437698, 30076968, 31454256, 31524632, 31524633, 31715090, 8703481, 8804325, 9614386		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic fibrosis	Pubtator	35315363	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystinosis	Cystinosis	BEFREE	24525029		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	25596528, 30196377, 30869827, 30989724		★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	24146927	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	36045687	Associate	★☆☆☆☆ Found in Text Mining only
Deafness Autosomal Recessive 63	Deafness	Pubtator	30641908	Stimulate	★☆☆☆☆ Found in Text Mining only
Deficiency of mevalonate kinase	Deficiency Of Mevalonate Kinase	BEFREE	25107911, 27068928, 27723279		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10229398, 10384145, 10600505, 10643716, 10679109, 10806046, 11007768, 11083263, 11238664, 11285370, 11352237, 11728217, 11920402, 12209512, 12374621, 12671514, 1386092, 1458286, 14724685, 15190266, 15316669, 16934183, 17122966, 17216674, 17532232, 17604656, 17640966, 17853003, 17963503, 18195133, 18392912, 18508030, 18802112, 19010066, 19094210, 19151976, 19264156, 19333945, 19428335, 19733643, 20131253, 20131257, 20592454, 20799933, 20870807, 21219853, 21352802, 21371079, 21506092, 21523343, 21682898, 21798287, 21830213, 21854562, 21920358, 22143922, 22201856, 22249478, 22252645, 22294637, 22576756, 22840054, 22890185, 22933232, 22939867, 23216199, 23277489, 23396231, 23406982, 23438438, 23452206, 23611898, 23780780, 23838114, 23845519, 23965695, 24107356, 24132152, 24145861, 24295650, 24318839, 24591481, 24767790, 24767864, 24886859, 24975507, 25065588, 25116078, 25158232, 25193704, 25252624, 25385442, 25400736, 25424126, 25637445, 25728492, 25917063, 26015264, 26045743, 26233477, 26238767, 26285913, 26344001, 26391061, 26400621, 26404854, 26409848, 26450708, 26521740, 26521743, 26586481, 26707272, 26774733, 26821827, 26854724, 26934732, 26945831, 26997368, 27023516, 27052304, 27063559, 27067395, 27082319, 27082728, 27146654, 27152662, 27206713, 27247228, 27433031, 27463229, 27515563, 27555113, 27635406, 27654963, 27669541, 27734234, 27739057, 27743553, 27863298, 27863411, 27907835, 27930985, 28054591, 28110479, 28165497, 28168658, 28169456, 28213268, 28225075, 28236026, 28237856, 28245522, 28254683, 28256567, 28276100, 28323859, 28343378, 28356485, 28389425, 28422402, 28447732, 28482921, 28492224, 28548679, 28586061, 28627596, 28643466, 28659793, 28666239, 28677145, 28688942, 28695367, 28724217, 28728848, 28744712, 28744817, 28756519, 28765925, 28801211, 28806392, 28814877, 28831668, 28851291, 28858724, 28910961, 28915439, 28915567, 28933476, 28934732, 28942223, 28952621, 28968958, 28977876, 28987943, 29061447, 29128509, 29163027, 29165387, 29166937, 29168867, 29179489, 29196456, 29207603, 29216915, 29236314, 29243030, 29245931, 29247798, 29257269, 29257281, 29257341, 29291551, 29323744, 29339024, 29356224, 29393346, 29393494, 29444596, 29473075, 29483929, 29484338, 29524885, 29554943, 29604191, 29663159, 29682561, 29691435, 29709011, 29710527, 29749508, 29763932, 29766025, 29785089, 29806884, 29898779, 29913390, 29928231, 29929535, 29949137, 29996115, 30005876, 30015238, 30050432, 30087236, 30110204, 30119184, 30121673, 30140293, 30140415, 30172103, 30174601, 30184535, 30205322, 30233731, 30257325, 30261492, 30270563, 30273917, 30276528, 30280200, 30280295, 30311500, 30312659, 30316071, 30324848, 30340603, 30340925, 30341166, 30380653, 30390341, 30391743, 30462647, 30486657, 30504721, 30535473, 30542285, 30542428, 30548658, 30550885, 30551412, 30557884, 30562742, 30568481, 30582416, 30582743, 30584213, 30612087, 30635030, 30679644, 30691048, 30692016, 30707846, 30761007, 30776647, 30784197, 30828764, 30832871, 30842121, 30847744, 30854734, 30861996, 30896805, 30903650, 30922413, 30930294, 30938722, 30939166, 30942801, 31053150, 31055848, 31068673, 31078342, 31121225, 31137797, 31162482, 31191517, 31198977, 31201586, 31201921, 31210280, 31214026, 31214838, 31227976, 31228458, 31237151, 31253047, 31261155, 31262076, 31270213, 31285423, 31291980, 31293216, 31306979, 31307784, 31330080, 31364719, 31368822, 31372032, 31383786, 31404098, 31431607, 31434236, 31452704, 31454155, 31464310, 31468982, 31484919, 31486753, 31496660, 31497826, 31521691, 31539804, 31563117, 31592908, 31631977, 31637891, 31673109, 31683926, 31686786, 31712854, 31735077, 31742919, 31775901, 31790972, 31809639, 31814175, 31814906, 31819369, 31823179, 31831175, 31836142, 31837574, 31840428, 7564267, 7622181, 9125252, 9616438		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	15077300, 17532232, 18224250, 18392912, 18799084		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	21954917		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	21905285, 24446526, 29350052, 30944150, 31413130		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	26946964, 27816188, 29669581		★☆☆☆☆ Found in Text Mining only
Delusions	Delusions	BEFREE	15236409		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	11031691, 12909295, 16226351, 16297587, 17622713, 19013689, 21509504, 21614008, 8498837		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	12965265		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	18631256, 20336759, 21509504, 21968104, 35950445	Associate	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	16226351, 26577108, 30280789		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	27733565	Associate	★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	28445497		★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	21261944, 25476976, 30803280, 36569197	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dental Caries	Dental caries	Pubtator	37957648	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	10483047, 19016479, 19629761, 22580182, 22921153, 22990943, 23276701, 25315113, 26074461, 26750863, 26934083, 27608541, 27845194, 28120908, 28189098, 28203105, 28285256, 28353360, 28416811, 28486969, 28670290, 28948716, 28969939, 29247999, 29427595, 29434743, 29445283, 29471232, 29787856, 30104698, 30217534, 30616482, 30651860, 30682501, 30695093, 30703351, 30711869, 30711897, 30967802, 30978658, 31057373, 31101054, 31170723, 31296155, 31604142		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	18063307, 29856741	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	23852407, 24598699, 26891860, 30994834, 32495042, 35964023	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	24218043, 25151093, 25286107, 25315113, 26002078		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	17610667, 35964023	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	27138824, 29856741	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	17908936, 21881584, 22653747, 24996260, 27020408, 27139015, 28191908, 28323859, 28912118, 28957335, 29203183, 29312598, 29515113, 29698775, 29744290, 30120937, 30132896, 30240702, 30937919		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	20631729, 22427475, 30286163, 31049964, 34070943, 36736455	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	32896640, 34678092	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	34916261	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	15304089	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	28812775, 29723367, 29993193, 8930475		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	12828754, 15356430, 19477321, 20631729, 22322004, 23253688, 26894419, 27348082, 27554821, 27604144, 28191908, 28365521, 29353040, 30223113, 30240702, 30643810, 30937919, 31292344		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	LHGDN	15560757		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	CTD_human_DG	18249437		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Irritant	Dermatitis	BEFREE	8930475		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	11069448, 17908936, 24599175, 25688670, 25739051, 27604144, 28588486, 29857000, 30277862, 31515542		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338, 22533443		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	BEFREE	17265504, 27098789, 30367666, 9865793		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	Pubtator	17265504, 19035492, 24288551, 27803134	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	LHGDN	19035492		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	CTD_human_DG	19035492		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	Pubtator	27098789	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	19035492		★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	CTD_human_DG	19035492		★☆☆☆☆ Found in Text Mining only
Developmental Dysplasia of the Hip	Developmental dysplasia of the hip	Pubtator	25578529	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17097645, 18315433, 19820020, 20856927, 21205020, 21558879, 23486342, 24192345, 24424289, 25526310, 28142150, 28403363, 28772214, 28942141, 29490310, 29544870, 29548899, 29589071, 29605608, 29885882, 30016155, 30043856, 30054234, 30216538, 30521849, 30552892, 30832770, 31222667, 31404587, 31803484, 31835423		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	24055273, 24262292	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28846666, 33120759, 34235813, 38326276, 39518962	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	15141093, 16464741, 16864906, 21205020, 21715349, 24782217, 26268591, 27489152, 27749914, 28739185, 28854426, 29484768, 29513874, 34054346, 35851422, 39511203	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17097645, 18315433, 19820020, 20173777, 20856927, 21205020, 21558879, 23486342, 24192345, 24424289, 25526310, 27655512, 28000874, 28142150, 28403363, 28659798, 28741143, 28772214, 28942141, 29310992, 29422835, 29490310, 29544870, 29548899, 29589071, 29605608, 29844328, 29885882, 29925283, 30016155, 30043856, 30054234, 30118750, 30216538, 30355945, 30521849, 30550811, 30552892, 30651825, 30832770, 31222667, 31404587, 31747350, 31773666, 31773714, 31803484, 31835423		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25352747, 26604209, 28164132, 31244210, 33958662	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	10967112, 16464741, 26692253, 27575603, 28325643, 29941940, 31900242, 32221364, 36929812, 9923604	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	12410803, 16864906, 17100770, 20153491, 26636339, 29484768	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	29189980	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18664535, 21289232, 25098998, 26095630, 27904654, 29947343, 36351983	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19541594, 23086037, 23110196, 23484124, 27624102, 27749914, 28325643, 29752628, 30139387, 30894604, 32470060, 32561825, 32806763, 35281591, 35954211, 37047308, 37556419, 37914804, 39511203	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10671304, 1353022, 16464741, 1698309, 17595242, 18029454, 18648765, 1996407, 20173777, 20483667, 21705657, 24462878, 26341894, 26904692, 27253397, 27583982, 27706611, 28123635, 28289409, 28325643, 28390953, 28458159, 28619001, 29189980, 29257900, 29367588, 29452961, 29484768, 29504185, 29589071, 29941940, 30261504, 30273227, 30387830, 31054482, 31322069, 31497226, 31554783, 7578987, 7926295, 8906850, 9178025		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	16864906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15286433, 17069782, 17595242, 19541594, 20074280, 20173777, 20483667, 20588114, 20835230, 21205020, 21289232, 21538043, 22288582, 22521751, 22681257, 23086037, 24477584, 24520123, 24839897, 24969107, 25095741, 25216251, 25491100, 25526310, 25676395, 26095630, 26156202, 26448147, 26576766, 27624102, 27684566, 27726910, 27749914, 27909015, 27918955, 28058779, 28092375, 28302726, 28325643, 28500395, 28532406, 28559203, 28620993, 28699485, 28703484, 28794498, 28970837, 29151018, 29155303, 29228585, 29256638, 29323730, 29398906, 29420997, 29474443, 29478918, 29525039, 29588192, 29752628, 29851525, 29928231, 29943819, 29953655, 29957442, 30042685, 30311584, 30422379, 30459597, 30762811, 30887556, 30971430, 31014937, 31101061, 31105125, 31191559, 31222667, 31362031, 31513665		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	15286433, 17069782		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	20173777		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	33323459	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	31652822		★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic ketoacidosis	Pubtator	17335802	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	32723296, 38027201	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34219868, 35663044, 38206700	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15286433, 24839897, 27706238, 28726774, 28798291, 29475133, 29514038, 30212710, 30417374, 30571313, 31022160, 31044637, 31191559, 31281543		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	15286433		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	30317449, 31642797		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	37197158	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	24991184, 27288252, 28283331, 28767589, 28852447, 28964802, 29170525, 29434227, 29571734, 29584759, 30007476, 30535867, 31379825		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	25352747, 28726778	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	27509144, 33683746, 33958662, 34343639, 38084838, 38222451	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	37895018	Stimulate	★☆☆☆☆ Found in Text Mining only
Diffuse Cerebral Sclerosis of Schilder	Schilder disease	Pubtator	19125864	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	3052447		★☆☆☆☆ Found in Text Mining only
Diffuse Scleroderma	Scleroderma	BEFREE	30277862		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	30685605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	30339978, 30813952		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	29589594		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	28252221		★☆☆☆☆ Found in Text Mining only
dowling-degos disease	Dowling-Degos Disease	BEFREE	30155445, 31140325		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	15290893, 21712624, 23866266, 28816027, 29137441, 30902060		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	21712624, 27396555, 33206953	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	30902060	Stimulate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	22128229, 34048779	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	23665202, 25701684		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dry Eye Syndromes	Dry eye syndrome	Pubtator	27489152, 32476816	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Duodenal Ulcer	Duodenal Ulcer	BEFREE	10562576, 12105837, 16164697, 16550552, 18807132, 19804405, 22759516, 22917539, 9407330		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	10562576, 11531943, 14632761, 17453104, 21445336	Associate	★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	LHGDN	12105837, 16550552		★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren Contracture	BEFREE	8320323		★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	8320323	Associate	★☆☆☆☆ Found in Text Mining only
Dysbiosis	Dysbiosis	Pubtator	35794610	Associate	★☆☆☆☆ Found in Text Mining only
Dysbiosis	Dysbiosis	Pubtator	39456258	Stimulate	★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	37717172	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	26462152	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	15654265, 30535619, 31671940		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	31480765	Associate	★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	29642561		★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	BEFREE	26937653		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	29906710		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	12044341, 18069648, 22947907, 25879409		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	12828754, 15356430, 19477321, 20631729, 22322004, 23253688, 26894419, 27348082, 27554821, 27604144, 28191908, 28365521, 28468973, 29353040, 30223113, 30240702, 30643810, 30937919, 31292344		★☆☆☆☆ Found in Text Mining only
Eczema, Infantile	Eczema	CTD_human_DG	18249437		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	34439789	Associate	★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	33936110	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	23940760, 23971732, 27903802, 28173746, 28342868, 29712570		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	23940760, 28342868	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	24330827, 26166618	Stimulate	★☆☆☆☆ Found in Text Mining only
Encephalocele	Encephalocele	Pubtator	17688691	Associate	★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	28187038		★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	20087638		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	37762557	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	1832651, 27397068, 27770434, 28659656, 31695408		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	11285034	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	1832651		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	12161505, 21640344, 22888172, 23171678		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	10694276, 11665666, 11804955, 12372465, 1371258, 15472211, 17482186, 17644810, 17678915, 17997749, 18710704, 18930197, 19757173, 20137818, 21272866, 21958553, 22509941, 22537218, 22841820, 22888172, 23053311, 23269356, 26817396, 27371899, 27397068, 27593876, 27766701, 27987338, 28074436, 28322132, 28992341, 29040578, 29332562, 29669463, 30096622, 30326781, 30367890, 30632819, 30773096, 31408162, 31507610		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Endometriosis	Endometriosis	Pubtator	11665666, 1371258, 17548071, 21640344, 24133591, 27117373, 31408162, 32240297, 36028805, 36233009, 37164275, 39458478	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Endometriosis	Endometriosis	LHGDN	17678915		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Endometriosis	Endometriosis	Pubtator	17678915, 33395071, 36469254, 37095705	Stimulate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Endometriosis	Endometriosis	Pubtator	35130311	Inhibit	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Enteritis	Enteritis	BEFREE	31831090		★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	24732104, 34418984	Stimulate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	28658176, 28770467, 34269788	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	21281963, 31499011		★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	28104354		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	36591238, 37972740	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis Bullosa	BEFREE	2175579		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Dystrophic epidermolysis bullosa	Pubtator	37161592	Stimulate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex	Epidermolysis bullosa	Pubtator	34536484	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsies Partial	Partial epilepsy	Pubtator	39259090	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	12927051, 16860990, 19162013, 22578659, 24515998, 24754437, 25366750, 26902320, 28716963, 28941295, 29201182, 29363732, 29426321, 30031401, 30303442, 30326332, 30922332, 31208341, 31234194, 31258675, 31698971, 31722723		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	25366750, 31948324, 32219137, 32782321, 36089763, 39259090	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	12790892, 14510824, 36929812	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Generalized	Epilepsy	BEFREE	30140987		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	10805326, 11422336, 11955925, 12790892, 14510824, 18281914, 19066720, 22708826, 23270518, 25903737, 29590637, 30514296		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	LHGDN	14510824, 18281914		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	16824509		★☆☆☆☆ Found in Text Mining only
Epiphyseal dysplasia multiple 1	Epiphyseal dysplasia	Pubtator	29483929	Stimulate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	12538625, 8175024		★☆☆☆☆ Found in Text Mining only
Erdheim-Chester Disease	Erdheim-Chester Disease	BEFREE	29910817		★☆☆☆☆ Found in Text Mining only
Erythema Nodosum	Erythema nodosum	BEFREE	21418526		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	18396210, 21912958, 23726808, 30728854		★☆☆☆☆ Found in Text Mining only
Esophageal Diseases	Esophageal Diseases	BEFREE	14750640		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	18396210, 21912958, 23726808, 30728854		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32527212	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	14750640, 21451212, 30123073		★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	LHGDN	17241868		★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	32947843, 33941087	Stimulate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	25945941	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Tremor	Tremor	BEFREE	31092216		★☆☆☆☆ Found in Text Mining only
Essential Tremor	Essential tremor	Pubtator	31092216	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	21988351		★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	33299659	Associate	★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	29947568		★☆☆☆☆ Found in Text Mining only
Exudative retinopathy	Exudative retinopathy	BEFREE	27364629		★☆☆☆☆ Found in Text Mining only
Eye Neoplasms	Eye neoplasms	Pubtator	10469047	Associate	★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	17353161	Associate	★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	31221509	Stimulate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	10850859		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	18675847		★☆☆☆☆ Found in Text Mining only
Familial cold urticaria	Cold urticaria	BEFREE	14872505, 15541451, 16981288, 17300660, 17320940, 18258152, 18668535, 18668591, 29282807		★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	16230348, 36553511	Associate	★☆☆☆☆ Found in Text Mining only
Familial Hemiplegic Migraine	Hemiplegic Migraine	BEFREE	31331109		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	29527701		★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Familial mediterranean fever	Pubtator	16785446, 36624531	Associate	★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Familial mediterranean fever	Pubtator	26161132	Stimulate	★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	31628913		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	19473116, 21715349		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	19473116, 21715349		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP C	Fanconi Anemia	BEFREE	28539126		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	36189286, 37373402	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	24695489, 30211444		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	24716593	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	27730688, 39179677	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	25512222	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	27730688, 30794626	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	15318095, 24861026, 25989356, 26573228, 27730688, 28167322, 28306139, 28730512, 30102772, 30103942, 30668625, 30700851, 30794626, 31101239		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	11955925, 12431777, 15916853, 16159520, 16876005, 18281914, 19055487, 19135625, 19232478, 19854014, 20486195, 22160471, 22622830, 22911481, 24399675, 24515998, 24668705, 26500244, 26813462, 26902320, 27240522, 28296777, 29727742, 29808330, 30656683, 31321958, 31591845		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	LHGDN	11955925		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	17222831		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	2250017		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27940204, 28167322, 29129819, 29390144, 29556199, 30875826, 31301646		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	16860990, 26671983, 29162878, 29382328		★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	29162878	Associate	★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	20345941	Associate	★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	30921378, 9263995		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	1322431		★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	19473116, 21715349		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	21212632	Associate	★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	9234795	Associate	★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	LHGDN	18940468		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	15672946, 17006606, 23029430, 30066836		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	CTD_human_DG	11376495		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric ulcer	Gastric ulcer	BEFREE	15885804, 20979650, 24192345, 24224878, 29243969		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric ulcer	Gastric ulcer	LHGDN	19102413		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastritis	Gastritis	BEFREE	16405550, 17295877, 18385937, 20332462, 20659236, 22415887, 23995914, 25292060, 25867766, 28151895, 28356927, 28946145, 30382864, 9038658		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	LHGDN	18047563		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	20979650, 22714811, 23995914, 25292060, 26517486	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	12528938, 15247172, 19861615, 26158864, 27340011	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	12105837, 12854083, 15247172, 16405550, 19448967, 20631624, 22079592, 27340011		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastritis, Atrophic	Gastritis	LHGDN	12105837, 15289894		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastritis, Atrophic	Gastritis	CTD_human_DG	19448967		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastritis, Atrophic	Gastritis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	16120761, 20385987, 25910374, 25910560	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	15236174, 19342859, 23020284, 23806268, 25910374		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	15481335, 19322919		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Hemorrhage	Gastrointestinal hemorrhage	Pubtator	39194098	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	23174018		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	23174018	Associate	★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	BEFREE	28327177		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	10400826, 26486234	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	35886988	Stimulate	★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	27105586, 28043870, 29852521		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	16824509		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	11840449, 29731755		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	29731755, 8083354	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	37703805	Stimulate	★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	16356833		★☆☆☆☆ Found in Text Mining only
Gilbert Disease	Gilbert syndrome	Pubtator	28389660	Associate	★☆☆☆☆ Found in Text Mining only
Gilbert Disease (disorder)	Gilbert Disease	BEFREE	26926838		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	20399384, 31231976		★☆☆☆☆ Found in Text Mining only
Gingival Diseases	Gingival diseases	Pubtator	31743516	Associate	★☆☆☆☆ Found in Text Mining only
Gingival Recession	Gingival Recession	BEFREE	11895546		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	15830637, 16953820, 20528961, 22324464, 28367892, 29577710, 29608211, 29896253, 30903320		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	LHGDN	18454664		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	28367892, 34193520	Associate	★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	37986309	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	17460270, 26396484, 31379825		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	LHGDN	17563722		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	26120586	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	20565898, 23800300, 30465622	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	26120586	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	12913327, 17149369, 17460270, 20565898, 23800300, 26120586, 29179746, 30465622		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10349844, 10571418, 18819934, 19074142, 1937574, 20865400, 24457964, 24621265, 25054228, 25088200, 25409926, 25987130, 26794430, 28736425, 29734739, 7501271, 8120140, 8175759, 8512018		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	10349844, 11078722, 1711536, 18694480, 1974176, 24457964, 25054228, 25409926, 28012022, 29559295, 31282108, 40725140	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	CTD_human_DG	16356833		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	33652086	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	BEFREE	10349844, 10571418, 18819934, 19074142, 1937574, 20865400, 23220408, 24457964, 24621265, 25054228, 25088200, 25409926, 25987130, 26794430, 28736425, 29734739, 7501271, 8175759, 8512018		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	16356833		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10571418, 10930016, 11435921, 16964394, 18802741, 19029777, 21473956, 23034897, 25054228, 25311416, 29414774, 29486949, 29769161, 30712887, 31300060, 31653130, 7814977, 8008165		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19029777, 22752645, 25054228, 29414774, 29769161, 30015880, 31300060, 32358484, 34124933, 7680776, 8869149	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	27776252		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	CTD_human_DG	10910440, 9403216		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	BEFREE	21623661, 28469165, 8455368, 9186886, 9263995		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	Pubtator	8455368, 9263995	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis IGA	Iga nephropathy	Pubtator	11849463, 17191083, 30029622	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	28801211	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	9263995	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	30709661, 9263995	Associate	★☆☆☆☆ Found in Text Mining only
Glucagonoma	Glucagonoma	BEFREE	31130919		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	30550932		★☆☆☆☆ Found in Text Mining only
Gluten intolerance	Gluten intolerance	BEFREE	30240467		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	30288946		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	30616602	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	BEFREE	14661113		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	Pubtator	22762240, 26462562, 30761138, 35505381, 36123941	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	CTD_human_DG	26462562		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	Pubtator	28797095	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft vs Host Disease	Graft-versus-host disease	Pubtator	23792271, 30142416, 35486633	Stimulate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	29142307, 7867645	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	16019479, 22469882, 28483765, 29142307, 30487251, 31533918, 7787751, 8136279, 8496391		★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	BEFREE	29080744		★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	10685804, 8455368		★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	20133696	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	23386602	Stimulate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease, Chronic, X-Linked	Granulomatous Disease	BEFREE	8243611		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	11422195, 16025481, 17964974, 19793334, 1993363, 30814438, 33912135, 34790822	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves Disease	BEFREE	16025481, 17964974, 19793334, 20116409, 20671275, 24446657, 24465880, 24956560, 29454070, 30814438, 31399042, 8954062		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	27340508	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	19117935, 33488522, 33542676, 34383782, 35980936, 36521376, 37989267	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	23633206	Stimulate	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	29699061	Stimulate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	25114117, 25954926, 29704819, 31379477, 31805552		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	25114117, 31805552		★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	10652212, 2258703		★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	15236409		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	31845094, 9246063		★☆☆☆☆ Found in Text Mining only
Hamman-Rich syndrome	Hamman-Rich syndrome	BEFREE	10934117		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	1572693, 20929277, 25310146, 29764904, 29877208, 30814438, 9020075		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	17115419, 34790822	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	29877208, 30814438	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	31325403, 31452775		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	32736506, 36342298	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	26392121	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	28501927	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	17884346, 17948066, 29176403, 29549570, 29588192, 30216298, 31503012		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	27733811, 35463659, 36255356, 37268894	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11568062, 19329498, 21503626, 21811191, 24247107, 24531812, 28072632, 28232838, 28472396, 29141858, 29167166, 29182005, 29471939, 29549570, 29565745, 29584915, 29683921, 29904899, 30010800, 30033595, 30586730, 31105751, 31127805, 31415103, 31612215, 31672943		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	15135663		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	24247107, 28072632, 29683921, 31059043, 31612215, 36303443, 37968611	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	35409075	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure Systolic	Heart failure	Pubtator	36303443	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	15135663		★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	CTD_human_DG	21335463		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart valve disease	Cardiac valvular disease	BEFREE	29548280		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Valve Diseases	Heart valve disease	Pubtator	29548280	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HELLP Syndrome	HELLP Syndrome	BEFREE	12044341		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	31710248		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	28483765, 28495184, 30144561, 31775389, 8417962		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	29032148		★☆☆☆☆ Found in Text Mining only
Hematoma	Hematoma	Pubtator	37038178	Associate	★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	1378450	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	12135770, 24989888, 8359910	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	25174507	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	12135770, 29983334, 9840908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	CTD_human_DG	15384034		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemophilia A	Hemophilia	BEFREE	16380445		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	21362111	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia b	Pubtator	26516624	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	31217347	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhoids	Hemorrhoid	Pubtator	39766795	Associate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	14760799, 26842496		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	26757951	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	31170723		★☆☆☆☆ Found in Text Mining only
Hepatic Fibrosis, Congenital	Congenital Hepatic Fibrosis	BEFREE	29140564		★☆☆☆☆ Found in Text Mining only
Hepatic Veno-Occlusive Disease	Hepatic veno-occlusive disease-immunodeficiency syndrome	BEFREE	8136279		★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	21526159	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	16521194, 32532356	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	24025329	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	16521194, 37208599	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	23633957, 32532356	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	30679661	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	16425360, 32532356	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	18063307, 22302133, 23633957	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	18752326, 21488946, 30018721, 7657294		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	20942594, 22139496		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	40214068	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	36553538	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Autoinflammatory Diseases	Autoinflammatory Disease	BEFREE	19877056, 24422572, 29869008		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	36318106	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	15492468, 19584167, 22414649		★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	29795355, 30355945		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	1558977		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	11376556		★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	27982551, 28656364, 29222824, 30136871, 30528824, 30854183, 31422449, 31454821		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	36248794	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	LHGDN	18647218		★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	25889448, 30134914, 9355965		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	1358770, 15954918, 30006785, 8573006		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	1700619, 26406983, 38489975	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	15954918, 24360910, 27049565, 30006785, 8573006		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	25798846	Stimulate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	33679692	Associate	★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	32484253	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	28716226, 31491504		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	29043426		★☆☆☆☆ Found in Text Mining only
Hyperalgesia	Hyperalgesia	Pubtator	35040478	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperandrogenism	Hyperandrogenism	Pubtator	23116196	Associate	★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	Pubtator	2212010	Associate	★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	8287365, 8421076		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	20070881, 28420489, 28906356, 28915536, 29522534		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	19004443		★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	BEFREE	19004443		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperemia	Hyperemia	CTD_human_DG	8846404		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	BEFREE	17595242, 20018749, 21270263, 23486342, 26095630, 27339277, 28639050, 28939513, 28942141, 28970837, 28972154, 29402837, 29753610, 29851525, 30114628, 30175447, 30216538, 30314265, 30419339, 30657854, 30703289, 31101061, 31476928, 31616304, 31713299, 31784615		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	18599614, 23484124, 27731349	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	27294162	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	28193546, 30130426, 31629034		★☆☆☆☆ Found in Text Mining only
Hyperimmunoglobulinemia D	Hyperimmunoglobulinemia	BEFREE	24422572, 26819362, 27270401		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	23484124	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	26407807, 28092375, 28485095, 8196555		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	20385541		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	17043800, 28137856, 28143622, 29409499, 29764192		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	19004443		★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	10070569, 14617515, 9529979	Associate	★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	31411059	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	12528110	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	25312962	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	1458689, 20417488	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19309436, 24782217, 29774543, 33652665, 37675573	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	23153648, 31703702	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11840488, 19249142, 21840356, 23153648, 24877626, 24947882, 27986554, 27986660, 28092664, 28906356, 28915536, 29143938, 29167166, 29968152, 30672138, 30700522, 30857409, 31319406, 31320452, 31427987, 31719823, 7946395		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	17611547		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	27292124, 27659729, 27847271		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	BEFREE	26722554, 28797095, 29232321, 29518608, 30761138, 31059009, 31790902		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	35505381, 36123941	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	15297440		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoglycemia	Hypoglycemia	LHGDN	15297440, 19236331		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoglycemia	Hypoglycemia	CTD_human_DG	1884014		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoinsulinaemia (disorder)	Hypoinsulinemia	BEFREE	30216538		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	19793334	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12050157, 15334456, 17456758, 22866899, 25185259, 25510649, 25861162, 26974319, 27058421, 27408996, 29941940, 30415294, 32033172, 32778144, 33136275, 34240756	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	1373333, 21263749, 22294296, 24457964, 26696754, 30255592, 30468453, 30704983, 31935962, 36824025, 37735391, 37753073, 7528138, 8901607	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17372675	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia-Ischemia, Brain	Ischemic Encephalopathy	BEFREE	11376856		★☆☆☆☆ Found in Text Mining only
Hypoxia-Ischemia, Brain	Ischemic Encephalopathy	LHGDN	16181755		★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	11376856, 28780000, 29931509, 31142341		★☆☆☆☆ Found in Text Mining only
Ichthyosis	Ichthyosis	Pubtator	27554821	Stimulate	★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Ichthyosis Bullosa Of Siemens	BEFREE	12631663		★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	28658584		★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	31698971		★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	10886238		★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	7705373		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	26840075, 28828907, 31734320, 31774487		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	10934117, 11790645, 19117745, 20082309, 22059992, 23755232, 28115235, 30988425, 31611754, 8473757, 9186988		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	11980586, 22059992, 23755232, 30619270, 30988425, 32750409	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	26743485, 34220810, 36791050	Stimulate	★☆☆☆☆ Found in Text Mining only
IgA Deficiency	Selective immunoglobulin a deficiency	Pubtator	9263995	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	10867534, 11158399, 11793861, 11849463, 19280228, 24592969, 27542871, 28117341, 28875388, 9186886, 9327339		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune System Diseases	Immune System Diseases	BEFREE	20004775, 28621240, 29601597, 8894434		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	24105615, 3264291	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	17483707, 19317746, 27210424, 27329949, 29499727, 29785672, 30679324		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	20353899, 26986868, 27864558, 28733486, 30760333, 3264774		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	17593876, 25589773, 27289225, 27876639, 27909728, 28157092, 28416092, 29304864, 29325450, 29610037, 29689568, 29968150, 30026058, 30092220, 30524241, 30560481, 30586550, 30711897, 30843525, 31158431, 31162953, 31416745		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	18420712, 22436237		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	9865793		★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	18484169		★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	25257527		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	23375040	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	28974117	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	27981463, 29199855		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10192196, 10380697, 11220627, 11600466, 12297725, 15223609, 1587185, 16109659, 16638698, 19643686, 20697295, 22960943, 23211301, 25466956, 26590314, 27043286, 27417569, 27508514, 27833025, 28155620, 28243990, 28420941, 28452812, 28798075, 29200737, 29324356, 29515025, 29910080, 30455704, 30825545, 30894054, 30901677, 31139196, 31187350, 31191826, 31353906, 31417161, 31487960, 31632367, 7543040, 7586694, 7729636, 7841354, 8440073, 8440434, 8899101, 9219791, 9246063, 9414973, 9536946, 9568467, 9771403		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	10337015, 11600466, 20509889, 23800789, 29434599, 31417161, 36647737, 7586694, 9536946, 9665472, 9771403	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35022690	Inhibit	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35190924, 39487408, 9414973	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	17908936, 21160041, 21881584, 24996260, 27020408, 27139015, 28191908, 28323859, 28912118, 28957335, 29203183, 29312598, 29515113, 29744290, 30120937, 30132896, 30240702		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	11342531	Stimulate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	24055273, 24918199, 24969107, 26718495, 29947343, 37047241	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	10871193, 11024034, 28947919, 29953508, 31130919, 9832444		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	25124963		★☆☆☆☆ Found in Text Mining only
INTERLEUKIN 1 RECEPTOR ANTAGONIST DEFICIENCY	INTERLEUKIN 1 RECEPTOR ANTAGONIST DEFICIENCY	BEFREE	22127713, 23917160		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	29410669		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	15077300, 15308963, 16436110, 20661932, 24551286, 25476526, 26200140, 26341894, 26877238, 27146654, 27253397, 27391542, 27488379, 27583982, 28123635, 28224704, 28296211, 28458159, 28646230, 29319363, 30155445, 30251693, 30261465, 30412851, 30468453, 30729381, 30785069, 30875127, 31427974, 31772145, 31773668		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	16775326	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	17760968, 20661932, 20690185, 24551286, 25209447, 25284686, 26877238, 27391542, 30076336, 30261504, 31056946, 31140325, 32705171, 33652921, 33764282, 34974796, 35042389, 35578687, 35624126, 35652184, 35689566, 35707832, 35964023, 36193061, 37329158, 38041147, 38217540, 39390000	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	26668319, 36578051	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral disc disease	Intervertebral disc disease	Pubtator	21837414, 24551286, 26774625, 27146654, 27512095, 31056946, 35613904	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	23014739	Stimulate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	26341894, 27253397, 27583982, 28123635, 28458159, 28498809, 28619001, 30261504, 30273227, 30387830, 31497226, 31554783		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Displacement	Intervertebral disc displacement	Pubtator	23014739	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	15229109, 15247172, 20473875, 23995914, 29142307	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	26349656, 29393276, 30590313, 30761127		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	25745771	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal polyposis	Pubtator	38297356	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	20495422		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	37752552	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	19092239	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Hemorrhages	Intracranial hemorrhage	Pubtator	19092239, 29932521	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Hypertension	Intracranial hypertension	Pubtator	21676422	Stimulate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30139338		★☆☆☆☆ Found in Text Mining only
Intravascular hemolysis	Intravascular Hemolysis	BEFREE	30389578, 31099890		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	31281724		★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	BEFREE	23451225		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	12631663, 19844779, 23028414, 25630611, 26366730, 29324356, 30854791, 31353906, 31366385, 31487960, 31576093, 31632367, 9246063		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	12631663	Stimulate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	15247174, 23028414, 24667736, 33441166, 37404119	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	15036607, 15539626, 17114844, 19786079, 22417897, 22744645, 22858724, 24063019, 24991091, 26156202, 26592822, 26718002, 26823694, 27323153, 29145255, 29567761, 30453020, 30542472		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	34970793, 35673992	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	39394477	Stimulate	★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	16824509		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	12794844, 15170937, 17324969, 18613829, 22124790, 24295199, 27717726, 28296284, 29426067, 29922038, 29968152		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	8286744, 8417962		★☆☆☆☆ Found in Text Mining only
Juvenile Neuronal Ceroid Lipofuscinosis	Neuronal Ceroid Lipofuscinosis	BEFREE	23919525		★☆☆☆☆ Found in Text Mining only
Juvenile polyposis syndrome	Polyposis Syndrome	BEFREE	22568934, 28637910, 30168623		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	BEFREE	29848388, 31829244		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10859633, 11001912, 15572586, 29244209, 29597230, 8283061		★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	24037056, 28963928		★☆☆☆☆ Found in Text Mining only
Kearns-Sayre syndrome	Kearns Sayre Syndrome	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	22503230, 25741769, 28926773, 29359350, 29862167, 29891552, 30211745, 31078922		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	Pubtator	25741769, 28573109	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	19043479, 23289806, 23592922, 24322806, 26200829		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoconus	Keratoconus	LHGDN	19043479		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoconus	Keratoconus	Pubtator	19043479, 23592922	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoconus	Keratoconus	Pubtator	29021606	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratocystic Odontogenic Tumor	Keratocystic Odontogenic Tumor	BEFREE	22582837		★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar	Palmoplantar keratoderma	BEFREE	30484821		★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	21992747		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	17258699		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	15286433, 29387201, 29605608, 29793629, 29913457, 29968152, 30922667, 31151077, 31616439		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	16436009, 24701032, 28359253, 31509231, 8455368	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	34118858	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	12136897, 15286433, 16174285		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	15954918, 37439962	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	18496552, 26659566, 26824356, 28688148, 30250284, 30700847		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	12722027, 15925866, 15954918, 16088107, 16766392, 20551628, 31322212, 8573006		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	LHGDN	15925866		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	32123166	Associate	★☆☆☆☆ Found in Text Mining only
Lambert-Eaton Myasthenic Syndrome	Lambert-Eaton Myasthenic Syndrome	BEFREE	31236596		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31312615		★☆☆☆☆ Found in Text Mining only
Laryngomalacia	Laryngomalacia	BEFREE	31631681		★☆☆☆☆ Found in Text Mining only
LAURIN-SANDROW SYNDROME	Laurin-Sandrow syndrome	BEFREE	29602073		★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	CTD_human_DG	21290410		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disorders	Learning Disorders	CTD_human_DG	21290410		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disturbance	Learning Disorders	CTD_human_DG	21290410		★☆☆☆☆ Found in Text Mining only
Left ventricular systolic dysfunction	Ventricular Systolic Dysfunction	BEFREE	21811191, 29565745		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	15135663		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	17222831	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	34256950	Inhibit	★☆☆☆☆ Found in Text Mining only
Leishmaniasis Cutaneous	Leishmaniasis	Pubtator	32766167	Associate	★☆☆☆☆ Found in Text Mining only
Leishmaniasis Mucocutaneous	Leishmaniasis	Pubtator	8443970	Associate	★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	Leopard syndrome	Pubtator	17114844	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	19618085, 28166214, 32372760	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	23283470	Stimulate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	26610735, 28511777		★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	34168371	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10383163, 2172158, 2331674, 23564444, 2887587, 7819135, 8912861, 9359411, 9652729		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11264180, 1700730, 1835893, 1932751, 20607236, 22370360, 25847448, 2887587, 33121233, 3316474, 7730146, 7867645, 8286744	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	2258703	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	1932751, 2175219, 3316474	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10515888, 12689943, 1373331, 1835893, 23616009, 2522658, 2665849, 28084439, 33121233, 3316474, 34857894, 3498521, 8400299, 8541550, 8805932, 9312169	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	38118408	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	8286744, 8839857	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	15304040, 2435815, 28343272, 30237268, 8193361	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11489472, 1434798, 16298825, 1699903, 1835893, 1918169, 1961022, 2207323, 23564444, 2478222, 26932518, 2788173, 27928589, 28355571, 29773641, 30181021, 30674535, 3261773, 3316474, 7629564, 7705959, 7967742, 8043435, 8319777, 8361209, 8400299, 8907269		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12031914		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	8417962		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	10753855, 11529470, 1883481, 2887587, 7628587		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	26372424		★☆☆☆☆ Found in Text Mining only
Leukostasis	Leukostasis	BEFREE	27474370		★☆☆☆☆ Found in Text Mining only
Lichen planus follicularis	Lichen planopilaris	BEFREE	29542810		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	15900573, 17435127, 18225559, 24561215, 26462152, 29542209		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	22288582		★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	9263995		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	11278855	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	24085323	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12500190, 1384466, 14515140, 15073122, 15196593, 16172101, 16521194, 1696948, 17054948, 18331250, 1846631, 18603357, 21457438, 2156928, 2172789, 22361279, 24751829, 25331966, 27092311, 27557564, 28011478, 28027970, 29248877, 29568203, 29802240, 29940792, 30556857, 30586675, 30794626, 30925457, 31379842, 31439713, 7687632, 8630420, 9594023		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15073122		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	14986816, 18331250, 20087638, 24751829, 27730688, 30236988		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	39179677	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	19278365	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	11056661, 19604266, 26554784, 29434599, 30600293, 34367180	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	1772964	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	38228248	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	19278365		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	1772964	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	29969462, 33469074	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	30133944, 30776150	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	38146363	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	25080058, 30206980		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	30776150, 34551597	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	1772964	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	25562161, 26481639, 28953903, 29366909, 31030090, 31676068		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10496524, 1384466, 14515140, 15196593, 1696948, 1846631, 2156928, 2172789, 25331966, 31044438, 7687632, 8630420, 9594023		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	12751042		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	26301107	Associate	★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	12790892	Associate	★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	17563722		★☆☆☆☆ Found in Text Mining only
Luft Disease	Luft Disease	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	11241561, 19097983, 19431193, 24853301, 25329476, 25858413, 26066058, 29233668, 29676014, 29703138, 30095747, 31467293, 31562126, 31715090		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	16858010, 19431193, 23153648, 24853301, 25329476	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	24696530	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	36255321	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases, Interstitial	Lung Diseases	BEFREE	16636934, 25963521, 9186988		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	28223794, 31499011		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	14961572, 16126303		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	15048152, 29408308	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	18757527, 18801189, 19723873, 20035239, 22923190, 25597281, 25910707, 26968871, 29408308, 31941995, 32924180, 34205482, 36149146, 37147350, 37985999, 38188678, 8144399, 9353425	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	22369883, 28212736		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	23762239, 36097589	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	28629997		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	11727511, 14623950, 20805419, 22841963, 24992143, 28396236, 29611775		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	35356994	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	14672899, 16436009, 19479852, 20334681, 20434119, 20805419, 25109676, 26182076, 27110576, 27488002, 28153882, 28564495, 29930551, 30466076, 32871918, 34596026, 35084314, 36740569, 36929812	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23315075, 25548434, 28286780, 29550813, 32868411, 39818255	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	11115160, 11727511, 14623950, 20805419, 22841963, 24992143, 28396236, 29611775		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10643707, 11727511, 11958432, 12111633, 14623950, 14672899, 14872281, 15088297, 15470475, 17335370, 18069935, 18613829, 20805419, 22196362, 22235789, 22841963, 23435013, 23722873, 23747396, 24055697, 24992143, 26005048, 27231253, 27488002, 28153882, 28396236, 28649995, 29032148, 29422069, 29611775, 29892303, 29930551, 30551949, 30854270, 31110478, 7653184		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	15470475		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	11422212, 29032148, 29874961, 29884703, 30316188, 30388519		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	16408116, 31509231, 36610524, 37099456	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	39224582	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	11727511, 14623950, 20805419, 22841963, 24992143, 28396236, 29611775		★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	BEFREE	20399512		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16203990	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16464738, 32851926	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	31400073		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	8400299, 8417962, 9013854		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18038187, 2331674, 7691638		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	38489975	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	16596202		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	31139332, 31534633		★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Lymphomatoid Papulosis	BEFREE	20682698		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	CTD_human_DG	1884014		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	2258703	Associate	★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	29922038, 29977033, 31710506		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	25978536, 27733811, 33510953, 34202702	Associate	★☆☆☆☆ Found in Text Mining only
Macular Edema, Cystoid	Cystoid macular edema	BEFREE	24319335		★☆☆☆☆ Found in Text Mining only
Macular retinal edema	Macular edema	BEFREE	24319335		★☆☆☆☆ Found in Text Mining only
Majeed syndrome	Majeed Syndrome	BEFREE	23087183, 28031477		★☆☆☆☆ Found in Text Mining only
Majeed syndrome	Majeed syndrome	Pubtator	23087183, 33314777	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	10483047, 12700687, 19629761, 20044070, 21465264, 25422961, 27054346, 28122130, 28263786, 28384542, 28599834, 29069253, 29587166, 29895759, 30069019, 31100612, 31629608, 31693974, 7506108		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	17700577, 19629761, 20044070, 22683764, 25422961		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	29882480		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	7689482		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	25054228, 28736425, 31653130		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	31325403, 31452775		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	24431405, 26689911, 2787682		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16298037, 17516992, 28212736		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16319982, 16358261, 17010072, 17510310, 1832651, 19267917, 19333723, 20437198, 21310944, 21731759, 21971413, 22595751, 22750628, 22818022, 23378578, 23927563, 24598028, 24670917, 24705025, 24716804, 25928089, 26362269, 26696367, 26745120, 27197202, 27609180, 27786298, 27893337, 28143606, 28212736, 28405519, 28551814, 29047186, 29719585, 30012670, 30075885, 30075887, 30154549, 30217872, 30245970, 30324661, 30545915, 30641908, 30670488, 31007849, 31281724, 31297985, 31552036, 31676788, 31685946, 9257189		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	1832651, 27397068, 27770434, 28659656, 31695408		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	18396210, 21912958, 23726808, 30728854		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	18940468		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	17356794		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16126303, 17361014, 17596594, 18757527, 20035239, 21252117, 22160576, 22467534, 22951596, 23762239, 23784458, 25428391, 28212736, 28855077, 29408308, 29425646, 30832375, 31115506, 31503012, 31649305, 8869967		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	22369883, 28212736		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	15900573, 17435127, 18225559, 24561215, 26462152, 29542209		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	30191960		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	14504049, 17141301, 18329282, 27035425, 30642295, 30697874		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11076651, 16209712, 19251436, 22313544, 22819319, 28970361, 29224225, 29363544, 30530635, 30760333, 31609478		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pharynx	Malignant Pharyngeal Neoplasm	BEFREE	23867201		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12598651, 14673956, 18174250, 19474090, 22850906, 22895549, 23192657, 24240026, 25103771, 25374200, 26477312, 26504029, 27991924, 29527701, 29617729, 30900284, 31600936, 31730277		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	27604144		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10746728, 11686480, 12105837, 12115538, 12530098, 12854083, 12883469, 15175940, 15233701, 15481335, 15551344, 15570075, 15658613, 15800325, 15851404, 15927855, 16103427, 16114018, 16143884, 16211343, 16985030, 17006981, 17096351, 17196954, 17201881, 17235630, 17287896, 17596959, 18688641, 18807132, 18949424, 19031173, 19861615, 20332462, 20405297, 21246243, 21523770, 21649724, 22414649, 22714811, 24023501, 24557417, 24626561, 25172489, 25258120, 26632693, 26870992, 27076787, 27215350, 27460807, 28558708, 30094865		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	15492468, 19584167, 22414649		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31499272		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15679809, 16698387, 19489682, 22895549, 27698389, 29684419, 29945448		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12530098, 12598651, 14984963, 1559228, 15688413, 16358261, 16405550, 16489061, 16698387, 17006606, 17006981, 17141301, 18225559, 18617366, 18688641, 18940468, 19513556, 19904560, 20956527, 21519029, 21653279, 21912958, 22030090, 22467534, 22580886, 22644784, 22923190, 23049925, 23174018, 23481102, 23935506, 24157941, 24402773, 24487386, 24550720, 24561215, 24571667, 24747159, 24905619, 25276792, 25324197, 25453823, 25987130, 27133472, 27206676, 27270586, 27630154, 27658048, 27786298, 27797827, 27807078, 27810076, 27919820, 27922186, 27935337, 28000894, 28093282, 28153032, 28212736, 28216434, 28238855, 28355571, 28397014, 28483765, 28639101, 28645612, 28724217, 28735823, 28790030, 28839362, 28855077, 28903357, 29207019, 29363544, 29440174, 29441940, 29584915, 29940792, 30012670, 30042333, 30121641, 30180922, 30217872, 30322551, 30530635, 30538296, 30628094, 30674535, 30728854, 30760333, 30829675, 30872392, 30945288, 30995499, 31231372, 31325403, 31396219, 31410060, 31499272, 31503012, 31552036, 31611973, 31639457, 31672283, 31830463, 31849516, 7769852, 8231032		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	22467534		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17297261, 18333945, 21424904, 23935506, 24712845, 24905619, 25925136, 31222982, 7594609		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10408390, 16158955, 16373718, 22415590, 23174018, 24157941, 28797636, 29062241, 29932233, 31088266, 31407335, 31838134, 8425199		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	15059925, 18987561, 19028472		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	15925866		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16298037, 17516992, 28212736		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16298037, 17516992, 28212736		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21057224, 23704896, 29320557, 29986606		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16298037, 17516992, 28212736		★☆☆☆☆ Found in Text Mining only
Mandibulofacial Dysostosis	Mandibulofacial Dysostosis	BEFREE	30280214		★☆☆☆☆ Found in Text Mining only
Maple Syrup Urine Disease	Maple Syrup Urine Disease	BEFREE	29740775		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	37445606	Stimulate	★☆☆☆☆ Found in Text Mining only
Marginal ulcer	Marginal Ulcer	CTD_human_DG	19448967		★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	17965063		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	15613280		★☆☆☆☆ Found in Text Mining only
Megaconial Myopathies	Megaconial Myopathies	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
MEGALENCEPHALIC LEUKOENCEPHALOPATHY WITH SUBCORTICAL CYSTS	Megalencephalic Leukoencephalopathy With Subcortical Cysts	BEFREE	22311026		★☆☆☆☆ Found in Text Mining only
Meibomian gland dysfunction	Meibomian Gland Dysfunction	BEFREE	26204109, 31741858		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	BEFREE	31693974		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	27810076		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10358197, 12598651, 1372901, 1450672, 14522922, 15383566, 16489061, 17906119, 1883481, 20099279, 21954434, 22850568, 25205101, 27810076, 28450382, 29032405, 30078841, 31586032, 3262428, 7648437, 8097520, 8314311, 8576096, 9247562		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16100443, 16675961, 17141217, 20181932, 22850568, 25484078, 30149677, 31099111, 31591149, 32098891, 35669782, 36707938	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16675961		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	2017372, 21954434	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	36707938, 38052629	Associate	★☆☆☆☆ Found in Text Mining only
MELAS Syndrome	MELAS Syndrome	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory Disorders	Memory Disorders	CTD_human_DG	21290410		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory dysfunction	Memory Disorders	BEFREE	29292385, 29875474		★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere disease	Pubtator	35322136, 39622350	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	26840621, 31653130		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	10483047, 19629761, 22580182, 22921153, 22990943, 23276701, 25315113, 26074461, 26750863, 26934083, 27608541, 27845194, 28189098, 28203105, 28285256, 28353360, 28416811, 28486969, 28670290, 28948716, 28969939, 29247999, 29427595, 29434743, 29445283, 29471232, 29787856, 30104698, 30217534, 30616482, 30651860, 30682501, 30695093, 30703351, 30711869, 30711897, 30967802, 31057373, 31101054, 31170723, 31296155, 31604142		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	24218043, 25151093, 25286107, 25315113, 26002078		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	14681906, 26074461, 27894002, 28373688, 28599834, 28751020, 28970252, 30504920		★☆☆☆☆ Found in Text Mining only
Mental Disorders, Severe	Mental Disorders	BEFREE	28815548		★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	BEFREE	10471494		★☆☆☆☆ Found in Text Mining only
MERRF Syndrome	MERRF Syndrome	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesial temporal lobe epilepsy with hippocampal sclerosis	Mesial temporal lobe epilepsy with hippocampal sclerosis	BEFREE	28675059		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	23937860		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	25757056, 2787682, 32530527, 33085641	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	17097645, 20178882, 25651569, 27068928, 28092375, 28963928, 31111559, 31355683, 31488830		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	23484124, 28592801, 31383786, 31735077	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	17634253, 29067980	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	21289232, 22357188, 26516848	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	17634253, 18191048, 18716798, 27133472, 28268030, 28324042, 30006351, 30338401, 30576798, 31738140		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	2040010		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	23536554, 24680871		★☆☆☆☆ Found in Text Mining only
Mevalonate Kinase Deficiency	Mevalonate kinase deficiency	Pubtator	12384940, 27377765	Stimulate	★☆☆☆☆ Found in Text Mining only
Mevalonate Kinase Deficiency	Mevalonate kinase deficiency	Pubtator	18684863, 25107911, 33525735	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	30199767	Associate	★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	25257527		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	30971286		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	31214186, 39187749	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	19996595, 21252552, 23199001, 28982375, 29957442, 30541566, 31120807		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	11476790, 11756575, 15866604, 29017513		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	29339024, 36891303, 37635488	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	31106593, 32554850, 33804447, 34216617, 36361846, 36890588, 36982291	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Myopathies	Mitochondrial myopathy	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	10871782, 27266875		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	29408464		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	10626139, 23527164, 2665838, 29214791, 8015336, 9864174		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	LHGDN	16487028		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	19016479, 26891860, 30121550, 30260294, 30504920		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	26891860, 32377159	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	30504920	Inhibit	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	20473875, 23315075, 29018115, 30363691, 35269619	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	18225559		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	18225559, 26462152	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	10559138	Inhibit	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	26861126		★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	26861126		★☆☆☆☆ Found in Text Mining only
Muckle-Wells Syndrome	Muckle-Wells Syndrome	BEFREE	14872505, 17763411, 18668535, 19180500, 21360513, 21967869, 23253918, 24150829, 28216434, 29968152		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	10233729	Stimulate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	15900570, 20600450, 21279638, 26941015, 27455075, 27694492, 28069066, 28108813, 28148962, 28400731, 29360808, 29721174, 30447136, 30996002, 31471109, 31611559, 31758701		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	20081319, 21048327, 23298273, 28069066, 31093510, 34174887, 35699824, 36536067, 38273388	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10050719, 10848780, 22540426, 22567049, 2297574, 25469832, 26146985, 2783861, 30211233, 33963182, 39268982, 9864174, 9886334	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10626139, 16487028, 17926179, 21347685, 22540426, 2297574, 2665838, 2785413, 28962646, 29440174, 31409628, 7510989, 8015336, 9864174		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	15287939	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	16487028, 17926179		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10685855, 10814801, 10871782, 11311293, 11498264, 12020968, 12161036, 14664464, 18322311, 19876593, 20192980, 20876102, 22406096, 23052182, 23594042, 25173940, 25458313, 25937052, 26531703, 27023227, 27032392, 27266875, 27432634, 27827809, 27878760, 28486971, 28583987, 28856541, 28922099, 29126030, 29358392, 29378262, 29615953, 29789522, 29803222, 30658261, 31231388, 31736980, 9357444, 9413274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	12775358		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	12775358, 18322311, 20661655, 24098530, 28623311, 30409508, 33203651, 33766068, 35648256	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	CTD_human_DG	15210533, 25458313		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	25704169, 35158367	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	33318307	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	24098530	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Acute Fulminating	Multiple Sclerosis	CTD_human_DG	15210533, 25458313		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	25586466, 28273784		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	29194448		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	28129679, 29194448, 30451963	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	28987470, 29194448, 31306657		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	11777547, 20942939, 28458152, 9521608, 9916896		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10697556, 27693669, 28159737, 31727865, 7522519, 7837815		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	11122147, 37420006, 8839858	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	34335093	Inhibit	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	22906243		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	11775253, 1533785, 1961020, 2043482, 28501737		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	29445180		★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	15135663		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	10475771, 31257469	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	11527622, 15336915, 15539626, 20070880, 20178882, 21199393, 21380730, 26823694, 28111350, 28906356, 29136949, 29169754, 29310992, 29440071, 29588315, 29800789, 30010800, 30112065, 30353660, 30542472, 30586730, 30918936, 30930410, 31077280, 31175933, 31393855, 31469975, 31621911, 31645662, 31652822, 31666455, 31672943		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	11527622, 22768033, 26505348, 27864235, 27967213, 33847684, 34799616, 35005769, 35231061, 35432334, 39809140	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	11743230, 15883752, 16310260		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	15539626		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	11133172, 26269588, 28142118, 29188498, 31051227, 8696938		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	12841341, 28232838, 28400731, 29904899, 30257377, 30673858, 31099056, 31217849, 31336248, 8624580		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	38521068	Stimulate	★☆☆☆☆ Found in Text Mining only
Myofibrillar Myopathy	Myofibrillar myopathy	BEFREE	15159477		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	LHGDN	15159477		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	BEFREE	9184656		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	CTD_human_DG	9184656		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis	Myositis	BEFREE	10886238, 17265504, 24757153, 31306657, 8557829		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	10886238, 15731288, 22577940	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	18420712	Associate	★☆☆☆☆ Found in Text Mining only
Myotonia Fluctuans (disorder)	Myotonia Fluctuans	BEFREE	26707272		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	25080058, 28164132	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	33172487, 33287713, 38271857	Stimulate	★☆☆☆☆ Found in Text Mining only
Nakajo syndrome	Nakajo Syndrome	BEFREE	22288582		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	11418661, 11892044, 12752325, 12775240, 17891050, 24668571, 30661312		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	33785041, 39191825	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	10197635, 1325786, 21154765, 26918942, 30817119		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	10929762, 28732079, 37925811	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28207826	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	10929762	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	24982891	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrosis	Necrosis	Pubtator	26245468, 38115314, 8298133	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	21258263, 28013313, 28278201, 28770467, 29784900, 30465999, 31314571, 31386261, 31786582		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10233685, 10496524, 10552343, 10871749, 11059695, 11212256, 11606496, 11985788, 12077278, 12147202, 12524080, 12530098, 12598651, 1315829, 1372901, 14522922, 14961572, 15297440, 15570075, 15930287, 16158955, 16358261, 16489061, 16565972, 18289837, 18396210, 19251436, 1968360, 20099279, 20956527, 21041719, 21277871, 21365246, 21519029, 21664353, 21668942, 21847358, 21954434, 21978632, 21988351, 22082565, 22228447, 22293948, 22850568, 23023398, 23110168, 23167961, 23270518, 23342250, 23823704, 24297791, 24356814, 24403855, 24550720, 25205101, 25453823, 25694534, 25725098, 25846650, 25915587, 25928089, 25965265, 25987130, 2605216, 26460957, 26718030, 26840621, 26918942, 27086490, 27207649, 27340011, 27388564, 27609180, 27658048, 27786298, 27797827, 27799249, 27810076, 27826041, 27871154, 27935337, 27991924, 28000894, 28075192, 28093282, 28259911, 28359729, 28410227, 28450382, 28458638, 28514756, 28522598, 28551814, 28606052, 28855077, 28881825, 28914439, 28927416, 28962646, 29109725, 29124765, 29150554, 29194906, 29197088, 29207019, 29356862, 29363544, 29415982, 29550799, 29554943, 29716544, 29844827, 29953655, 29996878, 30012670, 30032820, 30042333, 30154549, 30226596, 30253391, 30254191, 30324661, 30454900, 30460760, 30496733, 30530635, 30545915, 30545920, 30586442, 30670488, 30679700, 30760333, 30862187, 30890189, 30945288, 30963725, 30979739, 30998992, 31023180, 31044438, 31054317, 31105699, 31173626, 31217433, 31297985, 31310330, 31405895, 31410060, 31439615, 31439870, 31442303, 31446120, 31530543, 31552036, 31562254, 31609478, 31649305, 31662289, 31678414, 31715292, 31741709, 31849516, 3263853, 7726369, 8125795, 8396466, 8479752, 9007702, 9247562, 9924696		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	22467534		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	22975019, 26842496, 29032148		★☆☆☆☆ Found in Text Mining only
Nephrocalcinosis	Nephrocalcinosis	BEFREE	29241624		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	17258699		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	LHGDN	17258699		★☆☆☆☆ Found in Text Mining only
NEPHROLITHIASIS, CALCIUM OXALATE	Nephronophthisis	BEFREE	18186699		★☆☆☆☆ Found in Text Mining only
Nephronophthisis	Nephronophthisis	BEFREE	31676329		★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	9263995	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	23382978, 31115030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	35837376	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	7705373		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	11032886	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	15950779, 28285151, 31611307		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11032891, 15950779, 20716963, 22982182, 23507189, 23940760, 27957686, 30545920, 8074713, 8125147		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	11282550, 33246119, 9459616	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	16705810	Stimulate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	21308746, 25197660, 31119842, 32377159	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	17428507, 18279308, 18760325, 28153028, 30021215, 30217534, 30658261, 31098954, 31119842, 31604142		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	21988351		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	21988351, 9007702		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	26840621		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	28174515, 29497397, 29703264		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	29372388, 29922458, 30961664		★☆☆☆☆ Found in Text Mining only
Neuropathy, Painful	Neuropathy	BEFREE	29372388		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	CTD_human_DG	1884014		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutropenia	Neutropenia	Pubtator	9325020	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutrophilia (disorder)	Neutrophilia	BEFREE	21593174, 24874501, 27155035, 29103994, 29361942, 30095600, 31400073, 31552036, 7628587, 8421076		★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	27810076		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	30817119		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24861026, 26573228, 27730688, 28245087, 29665983, 30328321, 30460863, 30824190, 30983887, 31044438, 31480575, 31551515		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	14961572, 16126303, 16452236, 16489061, 18757527, 19461122, 20529668, 22796605, 24958470, 26141218, 26439031, 26791086, 28930110, 29734739, 30032820, 30922080		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	15318095, 24861026, 27730688, 30794626		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	15236409, 30220520, 30836740, 30967316		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	16968396, 18239554, 18573495, 19398847, 19666082, 23484124, 24006511, 24141239, 24782217, 24918199, 26516848, 27907186, 28105927, 28515391, 28592801, 29244802, 30504920, 30661603, 30823632, 30894604, 31551515, 31988533, 32176045, 33183332, 34296200, 35894174, 35931812, 36572355, 37047308	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17174563, 18191048, 18573495, 18716798, 19398847, 19666082, 19808894, 21660081, 24458711, 24520123, 24586913, 25182023, 25216251, 25526310, 25626736, 26516848, 27726910, 27840174, 28224704, 28324042, 28515391, 28527691, 28659656, 28704429, 29244802, 29588192, 29769704, 29791847, 30002491, 30328795, 30350467, 30504920, 30670753, 30728854, 30894604, 31042669, 31191559, 31488830, 31507607, 31522568, 31551515		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23110196, 24262292, 29548899, 30287405, 31787760, 32469992, 33504180, 35301059	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	31272370	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	32545403	Associate	★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	30594753		★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	30930743		★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	11600466	Associate	★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	16868967, 36646016	Stimulate	★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Neuropathy Ischemic	Optic neuropathy	Pubtator	21418620	Stimulate	★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	28258409		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	39516476	Associate	★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	30191960		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	30191960	Associate	★☆☆☆☆ Found in Text Mining only
OSSIFICATION OF THE POSTERIOR LONGITUDINAL LIGAMENT OF SPINE	Ossification Of The Posterior Longitudinal Ligament Of Spine	BEFREE	12195069		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	16257277, 21917472		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10806046, 11083263, 11083278, 11352237, 11714393, 12507586, 12801479, 12937131, 14962956, 15077300, 15176972, 15880595, 16311048, 16492401, 16679036, 16757188, 17177994, 17386086, 17532232, 17945513, 18417374, 18438860, 18547825, 18562219, 18565252, 19264156, 20131257, 20515435, 20517696, 20955562, 21219853, 21400477, 21506092, 21671260, 21682898, 21871094, 22249478, 22294637, 23780780, 23840483, 24107356, 24132152, 24238405, 24831018, 24873879, 25312962, 25400736, 25407789, 26577823, 26762166, 27082319, 27143365, 27146654, 27271770, 27356492, 27364595, 27449198, 27515563, 27555113, 27669541, 27863411, 28237856, 28256567, 28343378, 28373981, 28688942, 28692119, 28801211, 28912428, 29128509, 29292760, 29339024, 29444596, 29683034, 29898779, 30380653, 30504721, 30861996, 30903650, 30922413, 30983879, 31053150, 31055848, 31253047, 31434236, 31592908, 31637891, 31683926, 31735077, 31775901, 32062610, 32468015, 32616761, 32753846, 32757662, 32767318, 32878268, 32948212, 33094798, 33118610, 33435956, 33495946, 33573620, 33677475, 33804447, 33834880, 33916321, 33926561, 34024891, 34078001, 34082824, 34116684, 34140036, 34143208, 34198264, 34209473, 34425806, 34497153, 34502384, 34560673, 34769349, 34796909, 34846578, 34990303, 35168589, 35196925, 35260041, 35322736, 35352613, 35459188, 35484291, 35647200, 35723551, 35733134, 35993243, 36157214, 36540014, 36830751, 36901745, 36915153, 36949500, 37098630, 37269815, 37312219, 37316888, 37443777, 37723556, 37853395, 38203564, 39189559, 39342381, 39684628, 40076528, 40170451, 9616438, 9682783	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	15731292, 21352802, 21717421, 25432384, 30186872, 31017304, 31383786, 31915516, 32037864, 32072994, 32380078, 33675175, 34448795, 35328777, 35955467, 36253872, 37507717	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Hip	Osteoarthritis	Pubtator	15077300, 17532232, 21671260, 33407301	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	21717421, 23216199, 32059658, 34073132, 34992344, 37573584, 39809203	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	32912331, 40211184	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	12115182, 19733643, 21146623, 21671260, 26791034		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	LHGDN	12115182		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	15190266, 19151976, 21146623, 21245324, 21523343, 21717421, 23602982, 23827951, 26045743, 27980229, 28964890, 29424905, 30106112, 30510442, 30585984, 30653843, 30688539, 31144313, 31840428		★☆☆☆☆ Found in Text Mining only
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	21954917		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	31026065		★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	20935210	Associate	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	12749050, 28682145, 29723617, 29912021		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	28682145, 30949508, 32454789, 38401466	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	10052770, 10678408, 11329621, 11453239, 12546099, 12562360, 12869004, 16126903, 17209795, 17954336, 18166103, 18640288, 21449691, 22101928, 22392845, 25466887, 28509407, 28697211, 29061958, 29490310, 29571257, 30422379, 30619321, 30737274, 30747500, 31389012, 31846839, 9089489, 9763149		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	10750554, 12568735, 16550727, 23160916, 28121926		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	11600466, 15176972, 20940514, 29521042, 29745905, 35791093, 36553538, 39596387	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	37038178	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	10330423, 10678408, 9763149		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Postmenopausal	Osteoporosis	CTD_human_DG	9032749		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	10691855, 24878968, 35326493, 40616392	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	11485304, 24190483, 24878968, 2521862, 2786815, 28000894, 28926924, 29441940, 30977354, 3493322, 9661070, 9973598		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	9057843	Stimulate	★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	24652041, 31176023, 9781987		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	LHGDN	12101072		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	31821259, 8052085		★☆☆☆☆ Found in Text Mining only
Ovarian adenocarcinoma	Ovarian adenocarcinoma	BEFREE	15870720		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian cysts	Pubtator	21722895	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	37883761	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	31332247		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	14504049, 17141301, 18329282, 27035425, 30642295, 30697874		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25376541, 26357657, 31902257, 31924656, 33921111, 35935940, 37644468, 9262967	Associate	★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	29550485, 30196377		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11076651, 16209712, 19251436, 22313544, 22819319, 28970361, 29224225, 29363544, 30530635, 30760333, 31609478		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	29228654, 29308316, 7638732		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11076651, 16094523, 18571585, 19671674, 29224225, 30794864, 31609478, 37914939, 39260693	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	14726611, 18789941, 22415665, 25120736, 9637544		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	16038043		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	25730036, 28935577, 39372399, 9334358	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	34599510	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Alcoholic	Pancreatitis	Pubtator	24835349	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	29436604		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	15917409, 18789941, 22819319, 27846147, 28854965, 31506423		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	LHGDN	18789941		★☆☆☆☆ Found in Text Mining only
Panniculitis	Panniculitis	BEFREE	22288582, 27840174		★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	28810554		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23215728, 27533309		★☆☆☆☆ Found in Text Mining only
Papilloma Choroid Plexus	Choroid plexus papilloma	Pubtator	9003063	Associate	★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic syndrome	Pubtator	2212010	Associate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	22335964	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	10212304, 25329911, 27735031, 30813952, 31915018, 36301901, 36768317, 38485911, 40133863	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	12052540, 15834859, 17458495, 17562931, 20427258, 20880267, 23383169, 25329911, 27356916, 27640071, 27776205, 28060896, 28769786, 28856541, 29097764, 29478949, 29540296, 29572994, 29786071, 30041526, 30063943, 30344306, 30400118, 30554092, 30658122, 30813952, 30815845, 31205938, 31535638, 31704453		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	LHGDN	12070246, 17562931		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	20427258, 28943632, 30813952, 31455413, 31828965, 33577043, 37773866	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	28247334, 31455413		★☆☆☆☆ Found in Text Mining only
Paroxysmal Extreme Pain Disorder	Paroxysmal extreme pain disorder	Pubtator	30949508	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	31099890		★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	10685804, 8455368		★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	30484821, 31001258, 31507596, 35140724	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid, Benign Mucous Membrane	Mucous membrane pemphigoid	LHGDN	11448121		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	31211854	Associate	★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile neoplasm	Pubtator	37763742	Stimulate	★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	15236174, 16211343, 20659236, 25910560, 29243969, 31586635, 31602227		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	11531943, 12528938, 19030199, 26601827	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peptic Ulcer	Peptic Ulcer	BEFREE	15885804, 17201881, 19448967, 20586862, 26601827, 29456060, 9407330		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peptic Ulcer	Peptic Ulcer	CTD_human_DG	19448967		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periapical Periodontitis	Periapical periodontitis	Pubtator	21419289, 35300329	Associate	★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	22788685, 29066283, 29306532, 31356689		★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	29384263		★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	BEFREE	28633474, 29910817, 30852700, 31437316		★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	Pubtator	35658515	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	10052770, 10599909, 10685360, 10711605, 10983602, 11145356, 11737511, 11846849, 12546098, 12598547, 14514232, 14723749, 14974822, 15903175, 16945028, 17458052, 17960403, 18315433, 18541658, 20335539, 20490394, 21035110, 21414132, 2141875, 21449691, 22348697, 23079986, 23241110, 23650922, 24460370, 27655512, 27665233, 27734498, 28282558, 28404906, 28691886, 29360244, 29577711, 29752711, 30206230, 30445239, 30903320, 31557327, 31701554, 9379326, 9797049, 9846737		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	17100776, 18541658, 19118102, 19405838, 24460370, 35665507, 36429405, 39337647, 9605989	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	37175429	Inhibit	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	10397510, 10685360, 10711606, 10872952, 11073323, 11332522, 11453239, 11737511, 12795791, 12974682, 14584862, 15068111, 16441737, 16470016, 16881809, 16931944, 16953820, 17335370, 17378887, 17458053, 17960403, 18052703, 18166103, 18723088, 19563289, 19792847, 20027454, 20490394, 2053589, 21035110, 21054222, 2141875, 21672595, 21712624, 22324464, 22348697, 22795294, 23079986, 23592003, 23650922, 23940616, 24011303, 24818754, 24843315, 26445016, 26449434, 26576766, 26909953, 27283324, 27541081, 27858556, 28252166, 28285126, 28286291, 28351517, 28358286, 28472719, 28621056, 28691886, 28777039, 28851350, 28985543, 29129647, 29184853, 29571257, 29608211, 29882262, 29895944, 30355945, 30737274, 30779140, 30944162, 30945296, 31161648, 31324923, 31389012, 31473995, 31560804, 31680324, 31739483, 31769563, 31848404, 8526804, 8809309, 9049801, 9089489		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	16542362, 20059421, 22926406, 35665507	Stimulate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	LHGDN	18052703		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	18723088, 19405838, 23046796, 24690098, 24843315, 25483140, 25861162, 28341818, 29023524, 30944162, 31978095, 32618013, 33638191, 35810010, 35844512, 36316672, 36429405, 37090158, 37240180, 37396744, 38206700, 39266981	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	27734498, 29169069, 30773823, 31274724		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30961664		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30961664		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	29169069		★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	28791669, 28873458, 31316105		★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	25228544	Stimulate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	23392590, 23760290, 37149550	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	38114999	Stimulate	★☆☆☆☆ Found in Text Mining only
Peroxisomal ACYL-COA oxidase deficiency	Peroxisomal Acyl-CoA Oxidase Deficiency	BEFREE	22508517		★☆☆☆☆ Found in Text Mining only
Peroxisome Biogenesis Disorder, Complementation Group D	Zellweger Syndrome	BEFREE	8243611		★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	31733276		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	29084332		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	10654577		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	29128802		★☆☆☆☆ Found in Text Mining only
PLCG2-associated antibody deficiency and immune dysregulation	Antibody Deficiency And Immune Dysregulation	BEFREE	27442322		★☆☆☆☆ Found in Text Mining only
Pleoconial Myopathies	Pleoconial myopathy	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Pleocytosis	CSF pleocytosis	CTD_human_DG	1884014		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	31639457		★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	CTD_human_DG	11181422		★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	28825161		★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	30088980		★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	30088980		★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	BEFREE	29425654		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	31134465, 31141402, 31319406		★☆☆☆☆ Found in Text Mining only
Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy	Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy	Pubtator	19125864	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	16965825, 20963558, 23375040, 28405733, 28485095, 28949260, 29359480, 29859385, 30272163, 30546347, 30963410, 31005728, 31139895, 31298309, 31722718, 31781027		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	19909950, 23375040, 32785222, 35551681	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31902257	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	22965887	Associate	★☆☆☆☆ Found in Text Mining only
Polymyalgia Rheumatica	Polymyalgia rheumatica	Pubtator	8083354	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	17265504, 22324944		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis	Polymyositis	Pubtator	17265504	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis	Polymyositis	Pubtator	27098789	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis	Polymyositis	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis Ossificans	Polymyositis Ossificans	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis, Idiopathic	Polymyositis	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Polyostotic fibrous dysplasia	Polyostotic Fibrous Dysplasia	BEFREE	29783158		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28676988, 28681202, 29328883, 30030056, 30271153, 30653780, 30711869, 30777365		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	7769852		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	1351762, 8417962, 9013854		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	8417962		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	8137887		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	11031691, 12909295, 16226351, 16297587, 17622713, 19013689, 21509504, 21614008, 8498837		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	18675847		★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	17460270		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	19604266, 31231399, 8076766, 8706330		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	18573422	Stimulate	★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	23710539, 27773452	Associate	★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	3264774		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	10925316, 22906243		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	11492971		★☆☆☆☆ Found in Text Mining only
Prolidase Deficiency	Prolidase deficiency	Pubtator	38088248	Associate	★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	28271611, 29084332, 31421026		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	31659187, 7843589		★☆☆☆☆ Found in Text Mining only
PROPERDIN DEFICIENCY, X-LINKED	Properdin Deficiency, X-Linked	BEFREE	29783158		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11774033, 12598651, 14673956, 18174250, 18752500, 19474090, 22850906, 22895549, 23192657, 25103771, 25374200, 26477312, 26504029, 27991924, 29527701, 29617729, 30900284, 31600936, 31730277		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18446056, 19474090, 22859398, 23342084, 25103771, 28663562, 31600936, 33050597, 34070682, 34350063	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31348843	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	9792142	Inhibit	★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	30900284		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	26160272	Associate	★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	29550485, 30196377		★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	38489975	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11518726, 11851889, 12763679, 12890860, 16460958, 17591951, 20631729, 21242515, 21881584, 2191038, 2258628, 23171454, 23435685, 24665164, 25305315, 27604144, 27887936, 28266627, 28323859, 28422993, 28696418, 28857172, 29441952, 29535706, 29744290, 30120937, 30393369, 30571969, 30574739, 30760013, 31231388, 31427775, 31509228, 7744320, 8245502, 9058835		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	11851889, 16567387, 29434599, 30301277, 30998987, 31509228, 33300400, 34279540, 38115636	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	25330301	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	7744320		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	11851889		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	15236409, 30220520, 30836740, 30967316		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	29803226	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Pulmonary alveolar proteinosis	Pubtator	28233860	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	29484482		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	20808962	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	34238983	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Cystic Fibrosis	Pulmonary Cystic Fibrosis	BEFREE	19431193		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	12952260, 15994259, 16280439, 17626109, 18579366, 19279357, 21421749, 24975928, 26722511, 30034228, 31601004, 32669843, 32698440, 32842623, 34511895, 35064606, 35583006, 37194062, 37928768, 40161396	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26317628, 27524865, 27883019, 28490868, 31534438, 35534521, 36097589	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	34483727	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	11796828, 15579628, 25749497, 28006950, 28814068, 29329251		★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	24582314, 27007676, 28528200		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	15677771, 19633559, 23526221, 28677920, 29278701, 29623041, 30042768, 30092543, 31126962, 31611754		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	17266442, 23640035		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	33832291, 34220810	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	9840908		★☆☆☆☆ Found in Text Mining only
Pustular psoriasis	Pustular Psoriasis	BEFREE	23291100, 27105586, 30157880, 30643810		★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	7744320		★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	24903614, 25501066	Stimulate	★☆☆☆☆ Found in Text Mining only
Pyogenic arthritis pyoderma gangrenosum and acne	Pyogenic arthritis-pyoderma gangrenosum-acne syndrome	Pubtator	14595024	Associate	★☆☆☆☆ Found in Text Mining only
Pyogenic arthritis pyoderma gangrenosum and acne	Pyogenic arthritis-pyoderma gangrenosum-acne syndrome	Pubtator	30131320	Stimulate	★☆☆☆☆ Found in Text Mining only
Pyogenic Arthritis, Pyoderma Gangrenosum and Acne	Pyogenic Arthritis, Pyoderma Gangrenosum And Acne	BEFREE	16931648, 27464597, 28588486, 29742056, 30131320		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyogenic Arthritis, Pyoderma Gangrenosum and Acne	Pyogenic Arthritis, Pyoderma Gangrenosum And Acne	CTD_human_DG	27106250		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Raynaud Disease	Raynaud Disease	BEFREE	16981288		★☆☆☆☆ Found in Text Mining only
Reactive hypoglycemia	Reactive hypoglycemia	CTD_human_DG	1884014		★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	15257727, 19026124, 26819362, 29578360, 30476289		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	24446182		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	17054771, 26039006, 26385127, 27935125, 28543912, 28942153, 29550839, 29641282		★☆☆☆☆ Found in Text Mining only
Recurrent depression	Mental Depression	BEFREE	21465264		★☆☆☆☆ Found in Text Mining only
Recurrent otitis media	Otitis media	BEFREE	17142509		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	30911117, 31836304		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	1739130, 23342250, 25453823, 27799249, 28915570, 31816951, 31820316, 9736430		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	21305251		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	12136897, 25243815, 28359253, 9767525		★☆☆☆☆ Found in Text Mining only
Renpenning syndrome 1	Renpenning Syndrome	BEFREE	28948356		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	11182149, 31057533		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	LHGDN	12837173		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	18065658, 1883957, 23449693, 25089931, 25849954, 29606872, 30095747		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	11880307, 14605255, 28616049, 31659629		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	11182149		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	30961940, 38179046	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	24718616	Inhibit	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	32492562	Associate	★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	23460603, 31063999		★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Willis-ekbom disease	Pubtator	23460603	Associate	★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	3052447		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	30588605		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	25595815, 28767589, 30089839, 31773666		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	25978536	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	37924741	Stimulate	★☆☆☆☆ Found in Text Mining only
Retinal Dystrophies	Retinal Dystrophy	BEFREE	28438165		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	31379825		★☆☆☆☆ Found in Text Mining only
RETINITIS PIGMENTOSA 27	Retinitis Pigmentosa	BEFREE	31639404		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	8621439		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	30089839, 31379825		★☆☆☆☆ Found in Text Mining only
RETINOSCHISIS 1, X-LINKED, JUVENILE	Retinoschisis, X-Linked	BEFREE	31388973		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	20716963, 26471937, 29720131		★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	29568872		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	16043936, 27118427, 27521249, 29548280		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	29548280	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10210770, 10229398, 10366101, 10384145, 10402163, 10431483, 10441334, 10470256, 10491366, 10544841, 10600505, 10733472, 10817565, 10852253, 10976082, 11168012, 11238664, 11406520, 11477478, 11578018, 11791644, 11920402, 11930657, 11966774, 12028539, 12077707, 12115161, 12220548, 12571841, 12598651, 12632414, 12687542, 12746898, 12763679, 12847684, 12932294, 1320571, 1371728, 1386092, 1395121, 14558084, 1458286, 14872281, 15314683, 15353352, 15464974, 1550404, 15541037, 15723199, 15895884, 15896202, 15939878, 16406555, 16532349, 16802346, 16855167, 16886894, 16947381, 1698773, 17122966, 1714478, 17207379, 17216674, 17223662, 17328048, 17335371, 17609389, 17867984, 17963503, 18052703, 18438844, 18438857, 18468936, 18576312, 18667700, 18759964, 19004046, 1917593, 19328245, 19804846, 19809821, 19824913, 19877072, 20001767, 20039418, 20074281, 20141484, 2026869, 20432452, 20473500, 20604932, 20840651, 20887233, 2109776, 21129157, 2113447, 21383200, 2174073, 21798287, 22039170, 22040886, 22258493, 22288582, 22324944, 2258613, 22990668, 23058179, 23088220, 23148991, 23272690, 23277489, 23280345, 23317890, 23328930, 23335987, 23452206, 23635711, 23681674, 23689131, 23769905, 23934131, 24014495, 24131486, 24286242, 24351865, 24484294, 24534470, 24671001, 24767864, 24800661, 25436214, 25522907, 25708025, 25728492, 25941031, 26003199, 26044288, 26166764, 26520876, 26710124, 26718437, 27001429, 27105431, 27457515, 27603301, 27655512, 27736946, 27824863, 2786697, 27894399, 28245522, 28249243, 28295853, 28358286, 28408798, 28490617, 28506571, 28550307, 28584977, 28601049, 28660311, 28738524, 28756336, 28770826, 28782180, 28782994, 28783661, 28849205, 28986307, 29054755, 29120821, 29226077, 29257274, 29276516, 29394098, 29410669, 29442025, 29456830, 29536646, 29553845, 29554943, 29633070, 29752727, 29777367, 29794013, 29852739, 30001644, 30079994, 30254017, 30272996, 30273785, 30280295, 30358982, 30402834, 30423415, 30459597, 30574739, 30648758, 30762811, 30785275, 30851708, 30875506, 30890451, 30910693, 30911117, 30943136, 30975731, 31005814, 31119302, 31139184, 31153827, 31231388, 31295961, 31455659, 31498070, 31513665, 31585899, 31638264, 31735734, 31762409, 31820689, 31836304, 31841174, 7554443, 7622181, 8004060, 8132748, 8163935, 8185691, 8216423, 8507220, 9058643, 9117172, 9120311, 9214430, 9317160, 9525978, 9646842, 9797555, 9918236		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	11838837, 12115161, 15464974, 15723199, 17207379, 17593860, 18040764, 18052703, 18799084		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	12566094, 17379860, 22450443		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	24654309, 31185305, 37713866	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic Seasonal	Seasonal allergic rhinitis	Pubtator	29581620	Associate	★☆☆☆☆ Found in Text Mining only
Roberts Syndrome	Roberts syndrome	Pubtator	33319833	Associate	★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	28061032, 29169956, 30146165, 30311796		★☆☆☆☆ Found in Text Mining only
Sacroiliitis	Sacroiliitis	BEFREE	25835314, 31813060		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	10527395, 11127488, 11790645, 12039524, 30946009, 3297354, 8179912, 9186988		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	11127488, 18654018, 27402699, 30946009	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	LHGDN	12039524		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	21575908, 21792887, 23388709, 8669484	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	38564482	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	24085323	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	28782180	Associate	★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	29074356		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10208450, 11423178, 11481169, 12706488, 12804791, 14563376, 14681906, 14997019, 15236409, 15318032, 16856121, 16905295, 17510951, 17901998, 19125864, 20067853, 20347268, 21843369, 22763186, 22804923, 22869038, 24012176, 24155145, 25858413, 28083609, 28126482, 28314932, 28338954, 29074356, 29306989, 29680514, 29803226, 30218782, 30220520, 31211828, 31473906, 9184320, 9323321		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	14985387, 17901998		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	18583979		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	22832610, 32109548, 37946206	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	26194183, 27957319, 29803226, 35719348, 37075652	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	29032575	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schnitzler Syndrome	Schnitzler Syndrome	BEFREE	19608676, 23527164, 27501129, 27658762, 28718061, 29214791, 29284595, 30108026, 30339714, 30668200		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	11469463, 16447227, 29203183		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	11710721, 15642145, 8082299	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	14729510	Stimulate	★☆☆☆☆ Found in Text Mining only
SCLEROSING CHOLANGITIS, NEONATAL	Sclerosing Cholangitis	BEFREE	30465881		★☆☆☆☆ Found in Text Mining only
Sclerosis	Sclerosis	Pubtator	9263995	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	BEFREE	16371897		★☆☆☆☆ Found in Text Mining only
Seborrheic dermatitis	Seborrheic dermatitis	BEFREE	28588486		★☆☆☆☆ Found in Text Mining only
Secondary Trigeminal Neuralgia	Trigeminal neuralgia	CTD_human_DG	27093858		★☆☆☆☆ Found in Text Mining only
Seizure, Febrile, Complex	Seizure	BEFREE	22911481, 31709864		★☆☆☆☆ Found in Text Mining only
Seizure, Febrile, Simple	Seizure	BEFREE	15916853		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	27122151, 32219137, 32782321, 36089763	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures Febrile	Seizures	Pubtator	12790892, 24668705, 26813462, 28296777, 36089763	Associate	★☆☆☆☆ Found in Text Mining only
Seizures Febrile	Seizures	Pubtator	34449141, 38218765	Stimulate	★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	10959036, 12399113, 29793509		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	28501927		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	14500502, 32496420	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	16436009, 23825193, 25619315, 31416821, 33253913, 34566996, 36923408	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	10766854, 11328954, 12117955, 14871456, 16528020, 19953002, 20217044, 20334922, 21078560, 21933552, 22112657, 22288582, 24428862, 25000179, 25216263, 25619315, 26184633, 26312770, 26519599, 26561011, 26625855, 27142195, 27592234, 28090688, 28258192, 28428949, 28525674, 28601305, 28974614, 28991823, 29129362, 29192367, 29375379, 29599924, 29601597, 29621735, 29733298, 29782861, 29847538, 29896237, 29945883, 30305325, 30311579, 30455347, 30587411, 30601406, 30773464, 30855474, 30905847, 30971430, 31049763, 31125901, 31127032, 31174699, 31257645, 31281454, 31323346, 31539844, 31595873, 31658116, 7680670, 8307982		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	1377699, 29870142		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	12824917		★☆☆☆☆ Found in Text Mining only
Severe combined immunodeficiency due to adenosine deaminase deficiency	Severe combined immunodeficiency	Pubtator	7511077	Stimulate	★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	25596176		★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	BEFREE	27927236		★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	BEFREE	10052770, 10397510, 10711605, 10863964, 10872952, 11737511, 11846849, 12546099, 12795791, 17209795, 18166103, 21672595, 22348697, 23241110, 24690098, 24843315, 28286291, 31324923, 9049801		★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	29618653, 29780394, 29864926, 31394382		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	36902104	Associate	★☆☆☆☆ Found in Text Mining only
Short Sleeper Syndrome	Short Sleeper Syndromes	CTD_human_DG	17520785		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	30423938		★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	16824509		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	Pubtator	36094193	Associate	★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	8955214		★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	30096906		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	31562704, 35705251, 38016737	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	33603736	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	19479852, 25330301, 39465738	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Diseases	Skin disease	Pubtator	36672844	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Erosion	Skin Erosion	BEFREE	20141484, 20472585, 21859345		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	19477321, 25299544, 27623398, 28339016, 28396236, 28422993, 30503675, 30967262, 7744320		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	21969559		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	24293770, 26276663, 28742193, 33378050	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	27858556, 28742193, 28830779, 29245360, 29968150		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	36982291	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	CTD_human_DG	17520785		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	26937653		★☆☆☆☆ Found in Text Mining only
Sleep Wake Disorders	Sleep Wake Disorders	CTD_human_DG	17520785		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	16721367	Associate	★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	11748220		★☆☆☆☆ Found in Text Mining only
Smoldering Systemic Mastocytosis	Smoldering Systemic Mastocytosis	BEFREE	21708453		★☆☆☆☆ Found in Text Mining only
Snowflake vitreoretinal degeneration	Snowflake vitreoretinal degeneration	BEFREE	19142372		★☆☆☆☆ Found in Text Mining only
Spherocytosis Type 1	Spherocytosis	Pubtator	14510824	Associate	★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	30903721		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	28214532		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia 17	Spinocerebellar ataxia	Pubtator	21637346	Associate	★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 6 (disorder)	Spinocerebellar Ataxia	BEFREE	11427317		★☆☆☆☆ Found in Text Mining only
Splenic Hypoplasia	Splenic Hypoplasia	BEFREE	25441669		★☆☆☆☆ Found in Text Mining only
Split hand foot deformity 1	Split hand foot deformity	BEFREE	28617889, 29910817		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	16947381, 19900269, 22312160, 25941031, 7622181		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	16508980, 16918024, 28423679	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17356794		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22796477, 23383347, 24063998, 29207019, 8098727, 9039974		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21912958, 23726808		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26176534, 26462152, 28861772, 29207019, 31356195, 33232279, 35211756, 36450755, 37686462, 39516476	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37505766	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	31849516		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17465207, 19789323, 27738319, 28915597, 29184980, 8820364		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	27864235, 29853279		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	23270518, 27296494, 27915186, 28716963, 29186698, 29326654, 29549796, 30278465, 30843525, 30986405, 31171434		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status epilepticus	Pubtator	36802956	Stimulate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	24695489, 25216251, 25847140, 27477770, 27730688, 28167322, 28245087, 29482933, 29735977, 30211444, 30505331		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	28658584		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10746728, 11606496, 11686480, 12050395, 12105837, 12115538, 12530098, 12594817, 12854083, 12883469, 15014040, 15175940, 15233701, 15481335, 15551344, 15570075, 15658613, 15688413, 15704154, 15800325, 15851404, 15927855, 16103427, 16114018, 16143884, 16211343, 16985030, 17006981, 17096351, 17196954, 17201881, 17235630, 17287896, 17596959, 18688641, 18807132, 18949424, 19031173, 19861615, 20332462, 20405297, 21246243, 21523770, 21649724, 22414649, 22714811, 24023501, 24557417, 24626561, 25172489, 25258120, 25740226, 25773799, 26632693, 26870992, 26898458, 27076787, 27215350, 27340011, 27460807, 28035062, 28558708, 30094865		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	11686480, 22714811		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	12528938, 22714811	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10746728, 11936957, 12688521, 14633943, 15851404, 16425433, 16769709, 16804964, 17297261, 17359523, 19132772, 19861615, 21523770, 22414649, 22415887, 22714811, 22969242, 23323013, 23995914, 24323564, 25292060, 25684535, 26069103, 26158864, 26898458, 27340011, 28110439, 32467608, 32530809, 32703913, 33942631, 36501012, 37858201	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12133467, 12297725, 12730860, 14566840, 15488638, 15540224, 15927855, 16454826, 17006981, 17035400, 17196954, 17295877, 17359523, 18565646, 19102413		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	15492468, 19584167, 22414649		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	15492468, 34773930	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	17453104, 26158864, 33942631	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	BEFREE	25172489, 27460807		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomatitis	Stomatitis	LHGDN	17960403		★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	28258409		★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	Pubtator	35170684	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	21478439	Associate	★☆☆☆☆ Found in Text Mining only
STRIATONIGRAL DEGENERATION, INFANTILE (disorder)	Striatonigral Degeneration	BEFREE	29510394		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	17981284, 24167359	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	24190014, 31480765, 35008765, 35673992	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	34201498, 39394477	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	11578841, 20495422, 27796945, 28682429, 29078973, 29163015, 30459553, 30791908, 30910642		★☆☆☆☆ Found in Text Mining only
Subcutaneous panniculitis-like T-cell lymphoma	Subcutaneous Panniculitis-Like T-Cell Lymphoma	BEFREE	30374066		★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	22512814		★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	21741294	Associate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet syndrome	Pubtator	24903614	Stimulate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet syndrome	Pubtator	27030597, 36355435	Associate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	30423938		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	16566946, 30423938		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	LHGDN	16955392		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	10090156, 11561109, 12472254, 1707461, 24434628, 26005048, 30276528, 30653843, 31285423		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	19333931	Inhibit	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	39390512, 9358757	Associate	★☆☆☆☆ Found in Text Mining only
SYNOVITIS, GRANULOMATOUS, WITH UVEITIS AND CRANIAL NEUROPATHIES (disorder)	Arthrocutaneouveal granulomatosis	BEFREE	19180500, 28032234		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	15851489, 17724127, 17963170, 18418395, 24671001, 28296284, 28935693, 29848367, 29922038, 29928998, 30647180, 31599092, 31829244		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11083268, 11469463, 1375465, 14705223, 16447227, 16636934, 17444587, 17584583, 18396211, 18576303, 21149496, 21535076, 25739168, 26416393, 27098064, 28575534, 29203183, 29507108, 30042768, 30978354, 30997045, 31320452, 31572353, 8082299, 9373715		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	LHGDN	17444587, 17584583, 18396211		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	3494073		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	23472661		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	15679809		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	20920788		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	29561914		★☆☆☆☆ Found in Text Mining only
Tendinitis	Tendinitis	BEFREE	29951874		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	28091588		★☆☆☆☆ Found in Text Mining only
Testicular Diseases	Testicular disease	Pubtator	37033952	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	17215863		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	26490522	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocytosis	Thrombocytosis	BEFREE	31234906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombophilia	Thrombophilia	Pubtator	15304040	Associate	★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	21839492, 29396046, 29602462		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	19092239, 36226612	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	10566653, 12608932, 12970294, 16002736, 16210363, 19274529, 19702713, 20671275, 22039452, 23633206, 24446657, 24627146, 24956560, 25135760, 26578206, 27484716, 28364200, 28656526, 29127443, 31399042, 31488432, 8954062, 9112998		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	16203990	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	1322431, 31499272		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	CTD_human_DG	26037280		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	22878044		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	CTD_human_DG	26037280		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	CTD_human_DG	26037280		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31499272		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	10464273, 29877208	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	17964974, 19793334, 22878044, 25127106, 36387897	Associate	★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	16824509		★☆☆☆☆ Found in Text Mining only
Tonsillitis	Tonsillitis	Pubtator	28542534	Associate	★☆☆☆☆ Found in Text Mining only
Tooth Diseases	Tooth disease	Pubtator	32952230	Associate	★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de Pointes	BEFREE	28490617		★☆☆☆☆ Found in Text Mining only
Toxic Shock Syndrome	Toxic Shock Syndrome	BEFREE	30817226		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	28893572		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	16698387		★☆☆☆☆ Found in Text Mining only
Transposition of Great Vessels	Transposition of the great arteries	Pubtator	35590253	Associate	★☆☆☆☆ Found in Text Mining only
Treatment related secondary malignancy	Treatment Related Secondary Malignancy	BEFREE	28483765		★☆☆☆☆ Found in Text Mining only
Trichiasis	Trichiasis	BEFREE	27249027		★☆☆☆☆ Found in Text Mining only
Trichiasis	Trichiasis	Pubtator	27249027	Associate	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	29766377		★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Insufficiency	Tricuspid Valve Insufficiency	BEFREE	30997045		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	CTD_human_DG	27093858		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	34067581	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Trigeminal Neuralgia, Idiopathic	Trigeminal neuralgia	CTD_human_DG	27093858		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24786829, 29592953, 30728901		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31105691, 32235890, 32778144, 34072893, 35377948, 36922898, 38254674	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	33846813, 35268073	Stimulate	★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	BEFREE	28991528		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	27122151, 29384235, 29803222		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	27122151	Associate	★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	CTD_human_DG	21335463		★☆☆☆☆ Found in Text Mining only
TUMORAL CALCINOSIS, HYPERPHOSPHATEMIC, FAMILIAL	Tumoral calcinosis	BEFREE	27164190		★☆☆☆☆ Found in Text Mining only
Type II Mucolipidosis	Mucolipidosis	BEFREE	30339978		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10192196, 10380697, 11173905, 12572877, 1587185, 18942751, 19392835, 20509889, 20975573, 21248762, 22960943, 23195532, 23211301, 23566938, 24581881, 24776844, 25466956, 26530134, 27558380, 27622899, 27966619, 29366788, 29379540, 29712770, 30029674, 30347808, 30583612, 30797423, 30876876, 30906449, 31206576, 31383741, 31480888, 31671425, 31689519, 31714673, 7586694, 8440434, 8563893, 8899101, 9246063, 9414973, 9933456		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	LHGDN	12133438, 18240282		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	12133438, 15955209, 20452301, 22119283		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	10483047, 12700687, 19629761, 20044070, 21465264, 28599834, 31100612, 7506108		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	17700577, 19629761, 20044070, 22683764, 25422961		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urethral Obstruction	Urethral Obstruction	BEFREE	30993884		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32098891	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Incontinence Stress	Stress urinary incontinence	Pubtator	35666377	Associate	★☆☆☆☆ Found in Text Mining only
Urolithiasis	Urolithiasis	BEFREE	18186699, 23363559		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	CTD_human_DG	12121561		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urticaria	Urticaria	BEFREE	17300660, 23527164, 31837215		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Dysplasia	Uterine disease	Pubtator	25893807	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17297261, 19904560, 25893807, 25925136, 26579841, 28402258, 31222982, 31554368, 31943744, 35791307, 36969161, 39289490	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19904560	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	18710704	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	17222831, 19614627		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	21519029		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	22429778, 36707938	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	19657978, 25017970, 26487500, 27981463, 28032234, 29424312, 30148652		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	Pubtator	37924741	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	23928854		★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	27764704, 27825895, 28534957, 28688036, 29248584, 30011214, 30368040, 30679700		★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	32126555	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	10872808, 15102770, 24063019, 24612355, 34343639, 9104815	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	15539626, 24063019, 26269588, 30089839, 31081038		★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	26502906	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	11094434, 23322405, 27455075, 27981463, 28148962, 30996002, 31471109, 31758701, 8918573, 9186886		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	LHGDN	14760799		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	3491091, 3526909	Associate	★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	25269057	Stimulate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	20031567, 37753073	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	38215128	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	28111350, 28826800, 31175933		★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	22059992	Associate	★☆☆☆☆ Found in Text Mining only
Vertical Talus	Vertical Talus	BEFREE	29981290		★☆☆☆☆ Found in Text Mining only
VEXAS syndrome	Vexas syndrome	Pubtator	38291039	Stimulate	★☆☆☆☆ Found in Text Mining only
Visceral myopathy familial external ophthalmoplegia	Visceral neuropathy	Pubtator	23451225	Associate	★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	34424286	Associate	★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	16824509		★☆☆☆☆ Found in Text Mining only
Vitamin A Deficiency	Vitamin A Deficiency	BEFREE	16813970		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	29297432		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	23382179, 25221996, 28082234, 29312598, 29613836, 31756352		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	23382179, 25221996, 32705792	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	23382179, 25221996, 28082234, 29312598, 29613836, 31756352		★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	37107562	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	8167341		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	8137887		★☆☆☆☆ Found in Text Mining only
Wolfram Syndrome	Wolfram syndrome	Pubtator	33693650	Associate	★☆☆☆☆ Found in Text Mining only
X-linked agammaglobulinemia	Agammaglobulinemia, X-Linked	BEFREE	28216434		★☆☆☆☆ Found in Text Mining only
X-Linked Lymphoproliferative Disorder	Lymphoproliferative Syndrome, X-Linked	BEFREE	20682698		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	11710926	Associate	★☆☆☆☆ Found in Text Mining only