IL6 (interleukin 6)

Gene

• Entrez ID: 3569
• Gene name: Interleukin 6
• Gene symbol: IL6
• Synonyms (NCBI Gene): BSF-2, BSF2, CDF, HGF, HSF, IFN-beta-2, IFNB2, IL-6
• Chromosome: 7
• Chromosome location: 7p15.3
• Summary: This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005420	hsa-let-7a-5p	Luciferase reporter assay, qRT-PCR, Western blot	19878981
MIRT006061	hsa-miR-203a-3p	ELISA, qRT-PCR	21279994
MIRT006061	hsa-miR-203a-3p	ELISA, qRT-PCR	21279994
MIRT006061	hsa-miR-203a-3p	ELISA, qRT-PCR	21279994
MIRT006790	hsa-miR-142-3p	ELISA, Immunoblot, Microarray, qRT-PCR	21474672
MIRT007374	hsa-miR-26a-5p	Luciferase reporter assay	23389848
MIRT016026	hsa-miR-939-5p	Other	21611196
MIRT016949	hsa-miR-335-5p	Microarray	18185580
MIRT020073	hsa-miR-365a-3p	Reporter assay	21518763
MIRT021049	hsa-miR-155-5p	Proteomics	20584899
MIRT021049	hsa-miR-155-5p	Proteomics	18668040
MIRT022183	hsa-miR-124-3p	Microarray	18668037
MIRT023501	hsa-miR-1-3p	Microarray	18668037
MIRT027449	hsa-miR-98-5p	Microarray	19088304
MIRT054777	hsa-miR-107	Luciferase reporter assay, qRT-PCR, Western blot, Coimmunoprecipitation, Chromatin immunoprecipitation, Immunofluorescence microscopy	24429361
MIRT438344	hsa-miR-149-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	25916550
MIRT438284	hsa-miR-223-3p	Luciferase reporter assay	24084739
MIRT438050	hsa-let-7c-5p	Luciferase reporter assay, qRT-PCR, ELISA	23977098
MIRT438050	hsa-let-7c-5p	Luciferase reporter assay, qRT-PCR, ELISA	23977098
MIRT438344	hsa-miR-149-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	25916550
MIRT438284	hsa-miR-223-3p	Luciferase reporter assay	24084739
MIRT438050	hsa-let-7c-5p	Luciferase reporter assay, qRT-PCR, ELISA	23977098
MIRT438050	hsa-let-7c-5p	Luciferase reporter assay, qRT-PCR, ELISA	23977098
MIRT733359	hsa-miR-146a-5p	Microarray, Luciferase reporter assay	25265569
MIRT731223	hsa-let-7f-5p	ELISA, Luciferase reporter assay	26810534
MIRT731223	hsa-let-7f-5p	ELISA, Luciferase reporter assay	26810534
MIRT731223	hsa-let-7f-5p	ELISA, Luciferase reporter assay	26810534
MIRT731223	hsa-let-7f-5p	ELISA, Luciferase reporter assay	26810534
MIRT731232	hsa-miR-146b-5p	Luciferase reporter assay, qRT-PCR, Western blot	26338965
MIRT731232	hsa-miR-146b-5p	Luciferase reporter assay, qRT-PCR, Western blot	26338965
MIRT027449	hsa-miR-98-5p	Luciferase reporter assay, qRT-PCR, Western blot	26367177
MIRT731346	hsa-miR-9-5p	Luciferase reporter assay	25809226
MIRT731346	hsa-miR-9-5p	Luciferase reporter assay	25809226
MIRT027449	hsa-miR-98-5p	Luciferase reporter assay, qRT-PCR, Western blot	26587789
MIRT027449	hsa-miR-98-5p	Luciferase reporter assay, qRT-PCR, Western blot	26587789
MIRT733041	hsa-miR-375	ELISA, qRT-PCR, Western blotting	33938607
MIRT733359	hsa-miR-146a-5p	ELISA, Immunoprecipitaion (IP), qRT-PCR	34203452
MIRT007374	hsa-miR-26a-5p	ELISA, Immunoprecipitaion (IP), qRT-PCR	34203452
MIRT733361	hsa-miR-26b-5p	ELISA, Immunoprecipitaion (IP), qRT-PCR	34203452
MIRT020073	hsa-miR-365a-3p	ELISA, Immunoprecipitaion (IP), qRT-PCR	34203452
MIRT733563	hsa-miR-603	Immunocytochemistry (ICC), Western blotting	34056002
MIRT734350	hsa-miR-29b-3p	qRT-PCR	31495191
MIRT734353	hsa-miR-199a-3p	qRT-PCR	31495191
MIRT027449	hsa-miR-98-5p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	31886314
MIRT022105	hsa-miR-125b-5p	Microarray	33429366
MIRT735301	hsa-miR-298	Luciferase reporter assay, qRT-PCR, ELISA	32353008
MIRT735664	hsa-miR-340-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	32712318
MIRT735795	hsa-miR-137	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	32498294
MIRT438050	hsa-let-7c-5p	qRT-PCR	34198264
MIRT438344	hsa-miR-149-5p	qRT-PCR	34198264
MIRT438050	hsa-let-7c-5p	Western blotting, Microarray, ELISA	31915680
MIRT731346	hsa-miR-9-5p	qRT-PCR	31578247
MIRT737372	hsa-miR-19a-3p	Microarray, qRT-PCR	32308549
MIRT438284	hsa-miR-223-3p	RNA-seq, qRT-PCR, Flow cytometry	32493731
MIRT737573	hsa-miR-146a-3p	RNA-seq, qRT-PCR, ELISA	31700158
MIRT755511	miR-374c-5p	Western blotting, qRT-PCR, ELISA	35689099
MIRT755511	miR-374c-5p	Western blotting, qRT-PCR, ELISA	35689099
MIRT005420	hsa-let-7a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	36215225
MIRT438050	hsa-let-7c-5p	Luciferase reporter assay	34967707
MIRT1550127	hsa-miR-149	CLIP-seq
MIRT1550128	hsa-miR-3064-5p	CLIP-seq
MIRT1550129	hsa-miR-3126-3p	CLIP-seq
MIRT1550130	hsa-miR-4766-5p	CLIP-seq
MIRT1550131	hsa-miR-4794	CLIP-seq
MIRT1550132	hsa-miR-760	CLIP-seq
MIRT2015481	hsa-miR-136	CLIP-seq
MIRT2015482	hsa-miR-3123	CLIP-seq
MIRT2015483	hsa-miR-3925-5p	CLIP-seq
MIRT2015484	hsa-miR-3976	CLIP-seq
MIRT2015485	hsa-miR-4803	CLIP-seq
MIRT2015486	hsa-miR-515-5p	CLIP-seq
MIRT2015481	hsa-miR-136	CLIP-seq
MIRT2015482	hsa-miR-3123	CLIP-seq
MIRT2015483	hsa-miR-3925-5p	CLIP-seq
MIRT2015484	hsa-miR-3976	CLIP-seq
MIRT2015485	hsa-miR-4803	CLIP-seq
MIRT2015486	hsa-miR-515-5p	CLIP-seq
MIRT2551397	hsa-miR-103b	CLIP-seq
MIRT2551398	hsa-miR-1297	CLIP-seq
MIRT2551399	hsa-miR-1323	CLIP-seq
MIRT2551400	hsa-miR-153	CLIP-seq
MIRT2551401	hsa-miR-217	CLIP-seq
MIRT2551402	hsa-miR-23a	CLIP-seq
MIRT2551403	hsa-miR-23b	CLIP-seq
MIRT2551404	hsa-miR-23c	CLIP-seq
MIRT2551405	hsa-miR-26a	CLIP-seq
MIRT2551406	hsa-miR-26b	CLIP-seq
MIRT2551407	hsa-miR-3129-3p	CLIP-seq
MIRT2551408	hsa-miR-3163	CLIP-seq
MIRT2551409	hsa-miR-3662	CLIP-seq
MIRT2551410	hsa-miR-374c	CLIP-seq
MIRT2551411	hsa-miR-4272	CLIP-seq
MIRT2551412	hsa-miR-4465	CLIP-seq
MIRT2551413	hsa-miR-4795-3p	CLIP-seq
MIRT2551414	hsa-miR-494	CLIP-seq
MIRT2551415	hsa-miR-498	CLIP-seq
MIRT2551416	hsa-miR-548o	CLIP-seq
MIRT2551417	hsa-miR-587	CLIP-seq
MIRT2551418	hsa-miR-607	CLIP-seq
MIRT2551419	hsa-miR-655	CLIP-seq
MIRT2551420	hsa-miR-885-5p	CLIP-seq
MIRT2551397	hsa-miR-103b	CLIP-seq
MIRT2551400	hsa-miR-153	CLIP-seq
MIRT2551401	hsa-miR-217	CLIP-seq
MIRT2551411	hsa-miR-4272	CLIP-seq
MIRT2551414	hsa-miR-494	CLIP-seq
MIRT2551417	hsa-miR-587	CLIP-seq
MIRT2551420	hsa-miR-885-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AHR	Activation	20511231
AHR	Unknown	18483242;23349129
ATF4	Unknown	16931790
CEBPA	Unknown	11975924
CEBPB	Activation	10903137;8725624
CEBPB	Unknown	11120852
CREB1	Activation	8725624
DDIT3	Activation	12706815
EGR1	Repression	15517885
EGR2	Unknown	24007274
EP300	Unknown	19966855
FOXO1	Activation	21185807
GBX2	Activation	10690529
JUN	Activation	20225236
JUN	Unknown	10542237;11120852
JUND	Activation	11337499
KLF4	Activation	23846700
MYC	Unknown	19259613
NFKB1	Activation	10329846;10903137;11327783;11504280;12058956;12887736;14532843;15756023;16984731;17040605;17196927;18057724;18061164;18243142;18942706;18996370;19124729;19164127;20066113;22547075;7876168;8679226;8725624
NFKB1	Repression	15517885
NFKB1	Unknown	10823821;10963848;11120852;11975924;15158360;16112536;17490702;17532054;19469019;19707556;2405250;8752656;9516466
OTX2	Activation	21047732
PPARA	Unknown	15001458
RBPJ	Activation	10329846
RBPJ	Unknown	9516466
REL	Repression	1372388
RELA	Activation	10329846;10903137;11327783;11504280;12058956;12887736;14532843;15756023;16984731;17040605;17196927;18057724;18061164;18243142;18942706;18996370;19124729;19164127;20066113;22547075;7499267;7876168;8679226
RELA	Repression	15517885
RELA	Unknown	10542237;10823821;10963848;11120852;11975924;15158360;16112536;17490702;17532054;19469019;19707556;19966855;20457835;8752656;9516466
SP1	Activation	18502099
STAT1	Repression	18616672
STAT3	Activation	10391682;18765795;20930550;22547075;22927445
STAT3	Repression	18616672
STAT3	Unknown	22105366;22363173
TBP	Repression	9209275
VDR	Repression	11050002
XBP1	Unknown	16931790
ZFP36	Repression	21656745
ZMYND11	Activation	19379743
ZNF300	Activation	21777376

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001781	Process	Neutrophil apoptotic process	IDA	7595060
GO:0002314	Process	Germinal center B cell differentiation	ISS
GO:0002384	Process	Hepatic immune response	IDA	2444978
GO:0002384	Process	Hepatic immune response	TAS	12832423
GO:0002446	Process	Neutrophil mediated immunity	TAS	16034137
GO:0002548	Process	Monocyte chemotaxis	IC	10510402
GO:0002639	Process	Positive regulation of immunoglobulin production	IDA	3491322
GO:0002639	Process	Positive regulation of immunoglobulin production	ISS
GO:0002675	Process	Positive regulation of acute inflammatory response	IDA	2444978
GO:0002690	Process	Positive regulation of leukocyte chemotaxis	TAS	16034137
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	3023045, 3491322, 12829785, 27830702
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	ISS
GO:0005125	Function	Cytokine activity	NAS	10443688
GO:0005125	Function	Cytokine activity	TAS	28720735
GO:0005138	Function	Interleukin-6 receptor binding	IEA
GO:0005138	Function	Interleukin-6 receptor binding	IPI	12829785
GO:0005138	Function	Interleukin-6 receptor binding	IPI	12829785
GO:0005138	Function	Interleukin-6 receptor binding	NAS	1883960
GO:0005138	Function	Interleukin-6 receptor binding	TAS	10925276
GO:0005515	Function	Protein binding	IPI	8702737, 11238858, 12829785, 18775332, 25401472, 28265003
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	11080265, 27830702
GO:0005615	Component	Extracellular space	IDA	3023045, 10443688, 16034137
GO:0005615	Component	Extracellular space	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005896	Component	Interleukin-6 receptor complex	IDA	2261637, 12829785
GO:0006953	Process	Acute-phase response	IEA
GO:0006953	Process	Acute-phase response	TAS	12832423
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IDA	10443688
GO:0006954	Process	Inflammatory response	TAS	28720735
GO:0006955	Process	Immune response	IEA
GO:0006959	Process	Humoral immune response	IC	3491322
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	8272873
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IMP	28433754
GO:0008083	Function	Growth factor activity	IDA	2261637, 12643274
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	2829354
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	2261637, 31886314
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	25809226
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	18719127
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	3023045
GO:0010573	Process	Vascular endothelial growth factor production	IDA	12794819
GO:0010574	Process	Regulation of vascular endothelial growth factor production	IDA	8557680
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IMP	28433754
GO:0010628	Process	Positive regulation of gene expression	IDA	27252421
GO:0010628	Process	Positive regulation of gene expression	IGI	31886314
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IDA	25916550
GO:0010888	Process	Negative regulation of lipid storage	NAS	16464856
GO:0014823	Process	Response to activity	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	2261637, 12643274
GO:0030154	Process	Cell differentiation	IEA
GO:0030168	Process	Platelet activation	TAS	7831669
GO:0031018	Process	Endocrine pancreas development	ISS
GO:0031175	Process	Neuron projection development	IMP	3264880
GO:0032494	Process	Response to peptidoglycan	NAS	16034137
GO:0032682	Process	Negative regulation of chemokine production	ISS
GO:0032722	Process	Positive regulation of chemokine production	IDA	10510402
GO:0032722	Process	Positive regulation of chemokine production	NAS	16034137
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IGI	31886314
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	31886314
GO:0032740	Process	Positive regulation of interleukin-17 production	ISS	25362566
GO:0032745	Process	Positive regulation of interleukin-21 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	10510402
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	31886314
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	31886314
GO:0032966	Process	Negative regulation of collagen biosynthetic process	IDA	12419823
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	7508917
GO:0035633	Process	Maintenance of blood-brain barrier	TAS	29702085
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	3130269
GO:0042593	Process	Glucose homeostasis	IDA	22037645
GO:0042802	Function	Identical protein binding	IPI	8702737
GO:0043065	Process	Positive regulation of apoptotic process	IDA	9949178
GO:0043066	Process	Negative regulation of apoptotic process	IDA	7595060
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	7508917
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	12419823
GO:0045599	Process	Negative regulation of fat cell differentiation	NAS	16464856
GO:0045669	Process	Positive regulation of osteoblast differentiation	TAS	12372336
GO:0045727	Process	Positive regulation of translation	IDA	16732314
GO:0045765	Process	Regulation of angiogenesis	IC	8557680
GO:0045779	Process	Negative regulation of bone resorption	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	16606666
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	17875732
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7508917
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7749983, 16946298, 17324931
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IC	17324931
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IDA	12419823, 17324931
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	10510402
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	7508917
GO:0050768	Process	Negative regulation of neurogenesis	TAS	20018408
GO:0050796	Process	Regulation of insulin secretion	IDA	22037645
GO:0050829	Process	Defense response to Gram-negative bacterium	TAS	16034137
GO:0050830	Process	Defense response to Gram-positive bacterium	TAS	16034137
GO:0050871	Process	Positive regulation of B cell activation	IDA	3491322
GO:0051223	Process	Regulation of protein transport	IEA
GO:0051251	Process	Positive regulation of lymphocyte activation	IEA
GO:0051384	Process	Response to glucocorticoid	IDA	10443688
GO:0051607	Process	Defense response to virus	IDA	3023045
GO:0060252	Process	Positive regulation of glial cell proliferation	IDA	2104886
GO:0061470	Process	T follicular helper cell differentiation	ISS
GO:0061888	Process	Regulation of astrocyte activation	TAS	29702085
GO:0070050	Process	Neuron cellular homeostasis	TAS	29702085
GO:0070091	Process	Glucagon secretion	ISS
GO:0070092	Process	Regulation of glucagon secretion	IDA	22037645
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IBA
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	8272873, 12829785
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	7749983, 11884403, 12552091, 12829785, 16946298, 30670152, 31145836
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IEA
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IMP	28433754
GO:0070102	Process	Interleukin-6-mediated signaling pathway	ISS	27893700
GO:0070102	Process	Interleukin-6-mediated signaling pathway	ISS	27893700
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	19168699
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	23776175
GO:0072540	Process	T-helper 17 cell lineage commitment	ISS	27893700
GO:0072540	Process	T-helper 17 cell lineage commitment	ISS	27893700
GO:0072540	Process	T-helper 17 cell lineage commitment	TAS	27893700
GO:0072574	Process	Hepatocyte proliferation	ISS
GO:0090091	Process	Positive regulation of extracellular matrix disassembly	IMP	26587789
GO:0090594	Process	Inflammatory response to wounding	IDA	27830702
GO:0097421	Process	Liver regeneration	ISS
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	12552091, 12643274, 19390056
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IMP	31886314
GO:0098586	Process	Cellular response to virus	ISS
GO:0150077	Process	Regulation of neuroinflammatory response	TAS	29702085
GO:0150078	Process	Positive regulation of neuroinflammatory response	TAS	26753638
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IGI	31886314
GO:1901731	Process	Positive regulation of platelet aggregation	IDA	31145836
GO:1902512	Process	Positive regulation of apoptotic DNA fragmentation	IMP	28433754
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	19390056
GO:1903978	Process	Regulation of microglial cell activation	TAS	29702085
GO:1904894	Process	Positive regulation of receptor signaling pathway via STAT	IEA
GO:1904894	Process	Positive regulation of receptor signaling pathway via STAT	IGI	30670152
GO:1904996	Process	Positive regulation of leukocyte adhesion to vascular endothelial cell	IDA	30670152
GO:2000553	Process	Positive regulation of T-helper 2 cell cytokine production	ISS
GO:2000635	Process	Negative regulation of primary miRNA processing	IGI	31507089
GO:2000660	Process	Negative regulation of interleukin-1-mediated signaling pathway	ISS
GO:2000676	Process	Positive regulation of type B pancreatic cell apoptotic process	TAS	18719127

Other IDs

• MIM: 147620
• HGNC: 6018
• e!Ensembl: ENSG00000136244

Protein

• UniProt ID: P05231
• Protein name: Interleukin-6 (IL-6) (B-cell stimulatory factor 2) (BSF-2) (CTL differentiation factor) (CDF) (Hybridoma growth factor) (Interferon beta-2) (IFN-beta-2)
• Protein function: Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism. Binds to IL6R, then the complex associates to the signaling subunit IL6ST/gp130 to trigger the intracellular IL6-signaling pathway (Probable).
• PDB: 1ALU, 1IL6, 1P9M, 2IL6, 4CNI, 4J4L, 4NI7, 4NI9, 4O9H, 4ZS7, 5FUC, 7NXZ, 8D82, 8QY5, 8QY6, 8YWQ, 8YWR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00489	IL6	27 → 212	Interleukin-6/G-CSF/MGF family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Produced by skeletal muscle. {ECO:0000269|PubMed:11080265}.
• Sequence:

  MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
  LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

• Sequence length: 212

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMNESIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMNESTIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEURYSM	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGIOFOLLICULAR GANGLIONIC HYPERPLASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGIOLYMPHOID HYPERPLASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC STENOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE CALCIFICATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTERIAL OCCLUSIVE DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE CHRONIC HEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE HEPATITIS WITH CENTRILOBULAR NECROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BERYLLIOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CACHEXIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, BASAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CASTLEMAN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	other; risk factor	ClinVar CTD	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn disease-associated growth failure, susceptibility to	other; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEFICIENCY OF GLUCOSE-6-PHOSPHATE DEHYDROGENASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes mellitus type 2, susceptibility to	other; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 1	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes mellitus, type 1, susceptibility to	other; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DRY EYE SYNDROMES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EYE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HASHIMOTO DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEADACHE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOLYTIC-UREMIC SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS B	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS C	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, AUTOIMMUNE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOLENTICULAR DEGENERATION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERCALCEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERINSULINISM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEROXALURIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPARATHYROIDISM, SECONDARY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC POLYMYOSITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IL6 POLYMORPHISM	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IL6-related disorder	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRACRANIAL ANEURYSM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRACRANIAL ARTERIOVENOUS MALFORMATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRACRANIAL ARTERIOVENOUS MALFORMATIONS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kaposi sarcoma	other; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS, VISCERAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, ALCOHOLIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME X	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL MYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOSAL FIBROSIS, INCLUDING OF TONGUE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOUS FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, SPINE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS, POSTMENOPAUSAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTAL DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NERVOUS SYSTEM DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLEURAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYMYOSITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYMYOSITIS OSSIFICANS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREDIABETES SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT MAJOR DEPRESSIVE EPISODES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS, SYSTEMIC JUVENILE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOMA, KAPOSI	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SICCA SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGRENS SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC-ONSET JUVENILE IDIOPATHIC ARTHRITIS	—	ClinVar, Orphanet ClinVar, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION, LEFT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AA amyloidosis	AA amyloidosis	BEFREE	28558744, 30132351		★☆☆☆☆ Found in Text Mining only
ABLEPHARON-MACROSTOMIA SYNDROME	Ablepharon macrostomia syndrome	BEFREE	29608374		★☆☆☆☆ Found in Text Mining only
Acanthosis Nigricans	Acanthosis Nigricans	BEFREE	30724385		★☆☆☆☆ Found in Text Mining only
Acne	Acne	BEFREE	25432444, 28193081, 30652337		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	25432444, 28193081, 30652337		★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	25738867		★☆☆☆☆ Found in Text Mining only
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	2229813, 8485909		★☆☆☆☆ Found in Text Mining only
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	10926317, 7550294		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	BEFREE	12843357		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	18319729		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	16098388, 16782174, 18281810, 20939703, 23918902, 27755007, 28277782, 28432157, 28527371, 29066436, 29428559, 30158377, 31017470, 31550669, 31739518		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	16098388, 16324758, 17487763		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	CTD_human_DG	23305094		★☆☆☆☆ Found in Text Mining only
Acute encephalopathy	Encephalopathy	BEFREE	21647847		★☆☆☆☆ Found in Text Mining only
Acute encephalopathy with biphasic seizures and late reduced diffusion	Encephalopathy With Biphasic Seizures And Diffusion	BEFREE	29725488		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	11551897, 24119518, 24961464		★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	21570986		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	2478222, 7919380, 8907269		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	1714404, 21875833, 2388482, 2784698, 29575872, 29963154, 30443842, 7919380, 8907269		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	1290964, 8750618		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	10025979, 29296780, 30843336, 8641372		★☆☆☆☆ Found in Text Mining only
Acute necrotizing encephalopathy	Necrotizing Encephalopathy	BEFREE	31201070		★☆☆☆☆ Found in Text Mining only
Acute otitis media	Otitis media	BEFREE	19522649, 30551453		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	10881937, 12060857, 18815552, 24072654, 24572992, 25730036, 25730090, 27918953, 27959400, 28300832, 28610827, 28618057, 28963856, 29086716, 29235373, 29393354, 29517628, 29779831, 29859191, 29925813, 30031606, 30047498, 30136704, 30144357, 30221360, 30279074, 30465176, 30515825, 30552706, 30570131, 31034353, 31054479, 31091214, 31122822, 31242405, 31363368, 31542607, 31606729, 31832004		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	31078158		★☆☆☆☆ Found in Text Mining only
Adamantinous Craniopharyngioma	Adamantinous Craniopharyngioma	BEFREE	28487953, 28859336, 31249603		★☆☆☆☆ Found in Text Mining only
Addison Disease	Addison`s Disease	BEFREE	28765037		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10845391, 11006206, 16130898, 16344268, 18573283, 24420154, 28927099, 28946699, 29970138, 8789430		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18060032, 18661238		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	17875759, 30670657		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	26663388		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	10732762, 16002475, 18060028, 18060032, 19616563, 20032397, 21122157, 21996739, 24420154, 26744530, 27893707, 28879441, 29173771, 29796998, 29970138, 30038506, 30127882, 31186684, 7657294, 9702415		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	18661238, 9122029		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	7879350		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	28394749		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	24114188, 25856562		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11920517, 20333461, 21160427, 29802748, 8288702		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	12114287		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	20333461, 28348498		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	28484271, 31650683		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	19048456, 29624096, 31137729, 31738032		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	11791174, 12547716, 19086955, 21284667, 28722826, 28849499		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21875833, 2388482, 2784698, 29963154, 30443842, 7919380		★☆☆☆☆ Found in Text Mining only
Adult Craniopharyngioma	Craniopharyngioma	BEFREE	15375575, 28487953, 31497533		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	25564959, 28544905		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	28109867		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	15070705, 15686457, 15772702, 17496310, 19573080, 24059848, 30830568		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	10480339, 21613407, 29207075		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	12121679, 7949164, 8596143, 9071222		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	19877033, 24106699, 30367666		★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	LHGDN	17090647		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	17525280, 17675241, 18538409, 23946637, 25604058, 26330749, 27404493, 28765149, 30048978, 30644965, 31086404		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	24456477, 31614176		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	16304445, 17992659, 18269659, 18752567, 19084430, 19946956, 21593780, 22918663, 24352581, 25564572, 25994389		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	LHGDN	18523355		★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	21633597, 31033014		★☆☆☆☆ Found in Text Mining only
AL-RAQAD SYNDROME	AL-Raqad Syndrome	BEFREE	29228130		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	17040605, 24974143, 26909898, 28558302, 29115624, 29849816, 31812574		★☆☆☆☆ Found in Text Mining only
Alloimmunisation	Alloimmunisation	BEFREE	28769101		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	28994714		★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	19117745	Associate	★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	17266442, 25216247		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	15212825, 19698145, 21070631, 21116047, 22272811, 24947882, 26626881, 28943632, 30193587, 30336198, 30611996, 31123752, 31733942, 32474469, 34180415, 34747789, 36835494, 37012089, 38527854, 39266981, 39800457, 39880323, 40369481, 7904796, 9003059, 9523575	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18637012, 20110602, 29361890, 33803478, 35689551, 35697992, 37679689, 38178159, 39684454	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22272811	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	10894265, 23463934, 31772933		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	15211070, 16540406, 19744138, 22272811, 28053004, 28106546		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	26545630		★☆☆☆☆ Found in Text Mining only
Amaurosis congenita of Leber, type 1	Leber congenital amaurosis	BEFREE	31702035		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	21196890, 27868311, 28699252		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	21196890, 36748192	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	31901915	Stimulate	★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	21771791		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amnesia	Amnesia	CTD_human_DG	9189931		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloid Neuropathies Familial	Amyloid neuropathy	Pubtator	28484271	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	1616367	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	16299685, 18243142, 19729864, 21298325, 24512768, 26289409, 28501482, 29234273, 29668503, 30396067, 31472250		★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	27236299, 29404871		★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	28484271		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	26198021, 26212797, 32924606	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	27741429, 28831083, 28856541, 29385088, 29523587, 30210445, 30219498, 30682521, 31231184		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	29246232, 31611269	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	31231184		★☆☆☆☆ Found in Text Mining only
Anaphylaxis	Anaphylaxis	Pubtator	30189430	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28740254		★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	25860946	Stimulate	★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	18007247, 20436380, 21228692, 29402769, 30819183, 31164999		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	10774463, 10870116, 12232842, 20564534, 20644113, 22264719, 22426798, 24119518, 24260500, 24286116, 28168662, 28377717, 28515118, 28960399, 29451472, 30047815, 30294279, 30298070, 30600440, 30705878, 31207479		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	18547996		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	18547996	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	20644113, 30047815, 32720970, 39962550	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	18477039	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	10641497, 24290434, 25378535, 25548984, 27026283	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	15795541, 25595815, 29401601, 31391342		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	16648144, 17996468, 28434701, 35909487	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Angina Stable	Angina pectoris	Pubtator	26075620, 35942210	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	28260995, 28407320	Associate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	12775581, 16098388, 18996291, 30165610		★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	LHGDN	18388036, 18996291		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	20595635		★☆☆☆☆ Found in Text Mining only
Angiolymphoid hyperplasia	Angiolymphoid Hyperplasia	BEFREE	10830746, 11863223, 12633573, 1493429, 19139722, 1954381, 19730402, 1987276, 23378927, 28168662, 28183278, 28241173, 28778870, 29157617, 29467920, 30487129, 30504327, 30946344, 31264312, 31527211		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Angiolymphoid hyperplasia	Angiolymphoid Hyperplasia	CTD_human_DG	15182131		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Angiolymphoid hyperplasia	Angiolymphoid Hyperplasia	LHGDN	18784373		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anhedonia	Anhedonia	BEFREE	28676350, 29895893, 30830260		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	Pubtator	34135474, 34502316	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	10852271, 19059800, 28421995, 28432524, 28816988, 29201209, 29477913, 30557124, 31287414		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anodontia	Anodontia	Pubtator	1710152, 32792856	Associate	★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	28578351, 39778225	Stimulate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21481788, 25238546, 27167341, 27750041, 27797936, 28053127, 28151872, 28377069, 28611107, 29092903, 29269518, 29853638, 30046904, 30396947, 30497874, 31001483, 31609478		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	29853638	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	29719601, 30889580, 31794851		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	LHGDN	11774563		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	31077775		★☆☆☆☆ Found in Text Mining only
Anovulation	Anovulation	Pubtator	12790840	Associate	★☆☆☆☆ Found in Text Mining only
Anterior Cruciate Ligament Injuries	Anterior cruciate ligament injury	Pubtator	26762166, 37919719	Associate	★☆☆☆☆ Found in Text Mining only
Anterior uveitis	Uveitis	BEFREE	29763582		★☆☆☆☆ Found in Text Mining only
Anterior uveitis	Uveitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	11692078, 12915102, 18702109, 7599837		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	25785264	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	23571152, 25350786, 28189098, 28374419, 28474231, 28950996, 29172739, 29636630, 29867078, 29898582, 29905941, 30406721, 30447911, 31057357, 31103845, 31199593, 31437534, 31634896, 31753327, 31799746, 31823093		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	32769481, 34135474	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	23571152, 25350786, 28189098, 28374419, 28474231, 28950996, 29172739, 29636630, 29867078, 29898582, 29905941, 30406721, 30447911, 31057357, 31103845, 31199593, 31207853, 31437534, 31634896, 31753327, 31799746, 31823093		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	36051484	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	11342474, 28434701, 31583844		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	28434701	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	34202072	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	15288631, 16899122, 17321344, 17996468, 26045772, 28735510, 34930827, 35602104, 37737183	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	20488324, 31885770	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	29158612, 36555139, 37445606	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	11342474, 15288631, 17182923, 17932568, 17996468, 23593036, 24963147, 28212412, 28434701, 28545777, 28982132, 29107003, 29262630, 29545260, 29549671, 29945457, 29956759, 30657332, 30991034, 31144100, 31506475, 31658493		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	LHGDN	17671746, 17996468		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Thoracic	Aortic Aneurysm	BEFREE	30088482		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	31427887	Associate	★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	30529828		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic valve disorder	Aortic Valve Disease	BEFREE	24631773		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	23026707, 23906537		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic valve disease	Pubtator	31858570	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	30552305		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	35181609	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	39217396	Inhibit	★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	Pubtator	35259429	Associate	★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	24456477, 31614176		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	22800824, 24362456, 28060106, 29068868, 8552439		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	15273551, 26714766		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	15273551, 26714766, 30918467	Associate	★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	29609021		★☆☆☆☆ Found in Text Mining only
AROMATASE EXCESS SYNDROME	Aromatase Excess Syndrome	BEFREE	10731102		★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	26864064	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10407498, 10542237, 11116068, 12217290, 12482836, 12574550, 12736161, 14612208, 15050298, 15604420, 15931619, 15953127, 15969253, 16467451, 16487030, 16513158, 16518702, 16718633, 16900203, 17098305, 17255532, 17460178, 17472849, 17916761, 18091699, 18279814, 18281810, 18449426, 18611449, 18774574, 19592000, 19661459, 20149313, 20375905, 21626471, 22075248, 23022409, 23545584, 23564081, 23673478, 23954871, 23957944, 24630186, 24733347, 26840742, 27430252, 27755007, 28069582, 28194905, 28233119, 28434701, 28472244, 28664622, 28878828, 29154780, 29197872, 29453087, 29579601, 29707570, 29744301, 29793330, 30041636, 30052808, 30061319, 30165610, 30317657, 30383519, 30413028, 30687328, 30702995, 31002155, 31039661, 31237148, 31252000, 31289638, 31294625, 31426909, 31432315, 31642412, 31817202, 9125317, 9769329		★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations, Cerebral	Cerebral arteriovenous malformation	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations, Cerebral	Cerebral arteriovenous malformation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	10623431, 12070776, 12960349, 14613283, 15312124, 1550404, 15843582, 16710471, 17227914, 18606685, 18759290, 18796608, 19180491, 19758168, 19866480, 20042455, 21937456, 24097134, 25556244, 26637957, 27214848, 27328763, 27984037, 28006753, 28158305, 28191643, 28273637, 28421996, 28680422, 28830882, 28847766, 28859307, 29549113, 29683364, 30285515, 30336338, 30606189, 30660077, 30668316, 30691120, 30831463, 31060892, 31173610, 31200688, 31438735, 31644891, 31764352, 31850514, 8596143		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	10747905, 14613283, 17393419, 18759290, 22687048, 33576004, 34539640, 35088674, 35095831	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	16802343, 18597410		★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Gouty arthritis	Pubtator	35470716	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	20740673, 23971020, 8544415	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	39712015	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	7858264	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	11520812, 14613283, 17530721, 19565513, 23543063, 26561546, 26934060, 28012239, 28286780, 33892792, 34257378, 35325069, 37052526, 37454049, 9769329	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	21637346, 34963488	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	1550404, 20631726, 27088930, 28790368, 30181004	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16728461, 34011674	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Reactive	Reactive arthritis	Pubtator	10524675, 35088674	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10632674, 10688908, 11037876, 11879547, 12296865, 12632414, 12714388, 14730602, 15000862, 15059275, 15188374, 15248214, 15270863, 1531188, 1550404, 15535835, 15642131, 16547285, 16815861, 17482423, 17665434, 17848581, 17968879, 18025155, 18205922, 18243142, 18438841, 18759290, 19404965, 19950274, 20419126, 21253618, 21740541, 21953341, 22190977, 22355377, 22488116, 22532634, 22594821, 22674488, 23024462, 23306426, 23335987, 23339928, 23619188, 23710436, 24223608, 24286242, 24401767, 24707478, 24788826, 24833787, 25345743, 25436214, 25649145, 25681343, 25891413, 26149185, 26273599, 26336855, 26578807, 26710124, 26792343, 26961818, 27282753, 27287375, 27413250, 27534557, 27629486, 27738630, 28002590, 28134597, 28228280, 28659662, 28708839, 28775366, 28800780, 28807007, 28850672, 29129636, 29784872, 30106091, 30106887, 30157931, 30229869, 30358109, 30597965, 30657547, 30861322, 30897288, 30944206, 31037071, 31061532, 31159863, 31178673, 31333666, 31852669, 32131874, 32508836, 32510258, 32561292, 32908449, 33087182, 33126846, 33148884, 33228785, 33374446, 33512089, 33855071, 33977746, 34369364, 34385542, 34414237, 34539640, 34795667, 34909885, 34911836, 34931349, 35084317, 35088674, 35628558, 35706043, 35776431, 36439145, 36918189, 37445932, 37796367, 37996918, 38003490, 38043198, 38275742, 38459704, 39229261, 39724808, 39766906, 8017985, 8870692, 9502421, 9516466, 9523575, 9653169, 9691097, 9832618	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	14680510, 15140777, 15972956, 16728461, 18311795, 1914237, 19248103, 22275154, 22736176, 24288552, 25164131, 25879761, 28114971, 28183329, 28245522, 28376277, 32547316, 32868411, 35164656, 35470716, 35955467, 37202736, 37958839	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18584044, 29096690, 34290266	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	16406656		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	27188858, 27194220, 28790368, 28926467, 29148410, 29655166, 30557124		★☆☆☆☆ Found in Text Mining only
Arthrogryposis and ectodermal dysplasia	Arthrogryposis with ectodermal dysplasia	Pubtator	38245732	Associate	★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	19804846, 27188858, 31249576, 31361271, 9744821		★☆☆☆☆ Found in Text Mining only
Asphyxia Neonatorum	Postnatal asphyxia	BEFREE	30089504		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	1374772, 15295049, 16344268, 16670028, 18763028, 18773331, 18799889, 18810365, 19503017, 20371397, 20423350, 21145125, 21637953, 23136556, 23160983, 23438328, 23441314, 23593036, 23600543, 23628948, 23944957, 25360780, 25697361, 25722071, 25950204, 25994869, 26001777, 26232935, 26546898, 26764119, 26938664, 27188427, 27469060, 27476619, 27484035, 27780376, 28185773, 28328807, 28334838, 28429138, 28635548, 28669936, 28791839, 28826527, 28831046, 28836545, 28861755, 29055943, 29242170, 29319332, 29394961, 29410184, 29665127, 29902480, 30053974, 30193887, 30534125, 30606211, 30623574, 30890137, 31101830, 31115390, 31148290, 31486903, 31496906, 31627909, 31714272		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	15295049, 16936245, 17395587, 18215266, 18774390, 18780949, 19503017, 20371397, 20423350, 23944957, 25360780, 25390970, 25697361, 26001777, 26232643, 26266960, 26368653, 26774658, 26851968, 28474507, 29319364, 29410184, 29902480, 30371106, 30998987, 31029772, 31101830, 31391224, 32479111, 32842623, 34103634, 34402724, 34552174, 34916261, 35069542, 35190755, 36066606, 38062491, 39229261, 39326916, 39868576	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	18810365		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	26546898, 26764119, 32451375, 34112152, 35572500	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	29902480		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	10349852, 11067916, 11517969, 15064729, 15688401, 15769552, 17012252, 1937574, 21042834, 2157429, 28234621, 29222114, 31730654, 8550818, 8627294, 8627304, 8817534, 8903854, 9003059, 9523575, 9795134, 9839649, 9845273, 9850935		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	10349852, 1937574, 3500852, 9003059, 9523575	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	17012252		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	17121800	Stimulate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	23564641, 26189429, 26851119, 30586396	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia with vitamin E deficiency	Friedreich Ataxia	BEFREE	29233142		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10407498, 10542237, 11116068, 12217290, 12482836, 12574550, 12736161, 14612208, 15050298, 15604420, 15953127, 15969253, 16467451, 16487030, 16513158, 16518702, 16718633, 16900203, 17098305, 17255532, 17460178, 17472849, 17916761, 18091699, 18279814, 18281810, 18449426, 18611449, 18774574, 19569017, 19592000, 19661459, 20149313, 20375905, 21626471, 22075248, 23022409, 23545584, 23564081, 23673478, 23954871, 23957944, 24630186, 24733347, 26840742, 27430252, 27755007, 28069582, 28194905, 28233119, 28434701, 28472244, 28664622, 28878828, 29154780, 29197872, 29453087, 29579601, 29707570, 29744301, 29793330, 30041636, 30052808, 30061319, 30165610, 30312930, 30317657, 30383519, 30413028, 30545708, 30687328, 30702995, 31002155, 31039661, 31237148, 31252000, 31289638, 31294625, 31426909, 31432315, 31642412, 31817202, 9125317, 9769329		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	10747905, 11805151, 12217290, 12736161, 15056843, 18069022, 19347053, 19553556, 23484124, 23874021, 24307759, 26071079, 27034587, 27177313, 27430252, 28434701, 31237452, 31901246, 31932740, 32028277, 32245324, 33035661, 34343257, 35052452, 35137664, 35598196, 35860283, 35948913, 36157437, 37339167, 38104193, 38152968, 38290570, 39216780	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	12482836, 15969253, 16620830, 17531241, 17684929		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	19330073		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	27941341	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	12970232, 15350843, 18215601, 20458440, 21214658, 22001292, 22914813, 22924939, 23593036, 24144036, 24243751, 24940886, 27609943, 28244597, 28388657, 28639986, 28875838, 29022500, 29269354, 29324263, 29595637, 29800783, 29871978, 31087601, 31704291		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	17094271, 18215601, 19117239, 19569080, 22681487, 22914813, 22924939, 24144036, 24940886, 29800783, 30180182, 32028277, 32223966, 32345003, 34931349	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	LHGDN	18523031		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	19167648, 19169931, 22001292, 29595637	Stimulate	★☆☆☆☆ Found in Text Mining only
ATRIAL SEPTAL DEFECT 1	Atrial Septal Defect	BEFREE	29884819		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	29884819		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	29415791		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	38066446	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	29415791, 30430896		★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	23313575, 30617865		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	22226452, 29178897, 38288647, 39243986	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	26418275, 31578139, 32245323	Stimulate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	27217154, 29085596, 29129319, 29178897, 29804052, 29884819, 30529000, 30681777, 30971960, 31125917, 31279535, 31578139, 31629288, 31655158, 31835709		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	20102735, 21595886, 27460706, 28070266, 29129319, 29628394, 29791472, 31655158, 31835709		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	20102735	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	32245323, 39243986	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	8964908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	CTD_human_DG	21227906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	29793131, 30083334, 30600293		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10720455, 11254686, 11992589, 12220549, 12421676, 1380241, 1380488, 1627787, 16372246, 16717113, 1728989, 17465721, 17675459, 17978466, 18528928, 19758168, 19811442, 2127356, 21881215, 22547654, 22734797, 22742541, 22871993, 23139385, 23190644, 23202933, 23434511, 24106699, 24528300, 24550394, 24594001, 24647663, 24670876, 25031389, 25585854, 25794663, 25896970, 26640809, 26683155, 26732858, 27007229, 27079270, 27332731, 27547870, 27629486, 27722916, 28168301, 28442260, 28453771, 28587079, 28620096, 28642760, 28872459, 28899868, 29055566, 29104574, 29163240, 29244194, 29361380, 29437229, 29725131, 29776017, 30178083, 30248523, 30336338, 30995501, 31023489, 31086255, 31130368, 31443998, 31555281, 31633019, 31809899, 31810605, 8691054		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	LHGDN	12220549		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	16331268, 18490707, 25345743, 26640809, 27629486, 33590853, 35911690, 36453709, 39229261, 7751005, 8343326	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	CTD_human_DG	19077085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	31809899	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	36453709	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	BEFREE	22734797		★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	1572693, 18692934		★☆☆☆☆ Found in Text Mining only
Autoinflammatory disorder	Autoinflammatory Disease	BEFREE	21480187, 23413035		★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	27481890		★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	27236299, 29404871		★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	30334451		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	11755467, 16061391, 16899594, 2137272, 21902578, 2286359, 24832086, 26491701, 27771871, 28550734, 28728856, 28837114, 29257247, 29285056, 29399101, 29707971, 30272262, 30530917, 30688264, 30772517, 31025923, 31113339, 31210286, 31222746, 31778769, 31805184, 7949151, 9081710, 9172802		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	18479302		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	10618692, 10870116, 8124214, 8726409		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	15041721, 17875759, 18192685, 23380467, 24117650, 29086334, 31399711		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	LHGDN	15041721		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	21148399, 33290281	Associate	★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	LHGDN	12445202		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	19026118, 19026125, 22197901, 23918728, 24703990, 25410656, 26222305, 27222359, 2786784, 28326169, 28392644, 28694762, 29806793, 30299243, 30385329, 31122907, 8785169		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	21059493, 26222305, 27222359, 30076035, 31885007, 35455984, 35488313	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	24749687, 24984193, 25303043, 33957967	Stimulate	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	10739905, 26061266		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	20603212, 21943235, 21965736, 28735516, 28938626, 29633291, 29848725, 30345492, 30710233, 31118628, 31288722, 9788616		★☆☆☆☆ Found in Text Mining only
Berylliosis	Berylliosis	Pubtator	12449171	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
beta Thalassemia	Beta thalassemia	Pubtator	23905873, 27104679	Associate	★☆☆☆☆ Found in Text Mining only
beta^0^ Thalassemia	beta Thalassemia	BEFREE	10634824		★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	29860474		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	25450715, 30159734		★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	23298711, 30419338		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	30419338	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	22832610, 26257203, 28074937	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	24120697, 25855618, 27245499, 27477922, 27718369, 27841086, 28199074, 28416092, 28495135, 28558364, 28914726, 29433074, 29628394, 30014955, 30261412, 30359810, 30762747, 31207853		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	24120697, 25855618		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	33667413, 37058046, 38484669	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	30560764		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11841803, 12131369, 16110031, 18558283, 18825409, 21104146, 23637926, 23727622, 23762858, 25292079, 26264279, 27092883, 28418913, 28607587, 30302904, 30744595, 9231915		★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	1932751	Associate	★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	1932751		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	24462502, 24945093	Stimulate	★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	27868136	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	17596140, 20417488, 35180460, 37555786, 8652818	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	21232591, 27449508, 29438197, 31681719		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	35180460	Stimulate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	36888618	Associate	★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	28379390, 28850077, 29167193		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	10632674, 15355555, 17129176, 21196890, 21740541, 28677723, 32524367, 33478001, 34795667, 8690800	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	11369623, 11713964, 16293576, 27463014, 28056748, 28962646, 30029729, 30671025, 31433756, 8154312		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	15287939	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	12619938	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	15640323, 16009674, 30819183	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases, Developmental	Bone Disease	BEFREE	16369891, 8690800		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	12121679, 30327453		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	19497133	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	24890946, 32383346	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	36809258	Associate	★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	21251905, 28233481, 30813947		★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	11212160, 21467819, 24557363, 25278075, 33478001, 9807705	Associate	★☆☆☆☆ Found in Text Mining only
Brachydactyly Type D	Brachydactyly	Pubtator	28504607	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	27981440, 29363904		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	24314052, 24382617, 29168181, 36459652	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	9143252	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	LHGDN	15746456		★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain infarction	Pubtator	18436879	Associate	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	23763486, 27816667, 29196212, 30863888		★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	24903966, 29402769	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Injuries	Brain injuries	Pubtator	36539847	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Injuries Diffuse	Brain injuries	Pubtator	22117975	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	21676422, 23894384, 31417126, 31553988, 40710309	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	31173307	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	12846758	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	15829914, 17394460		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	BEFREE	17272771		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	11494026, 15688401, 29460097, 30867760, 8008165		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	19497133, 30451357, 31123752	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10070858, 10813718, 11751408, 11899364, 14633738, 14735187, 14759713, 15081542, 15609131, 15945506, 16115908, 16273337, 16287071, 16464738, 16721634, 16842617, 17266178, 17416766, 17531096, 17594514, 18060028, 18060036, 18239642, 19435922, 19640729, 19687301, 19965896, 20043205, 20101226, 20633553, 21092249, 21220315, 21518778, 21523452, 21937440, 21967801, 22235336, 22595751, 22644871, 22818022, 22819326, 22903472, 23056300, 23178494, 23289672, 23368093, 23553622, 23632023, 23750285, 23762340, 23832664, 24012192, 24299316, 24467886, 24473196, 24568505, 24670917, 24705025, 24832086, 24961464, 25213863, 25305747, 25453096, 25476497, 25697898, 25824986, 25868978, 25881039, 26152358, 26173622, 26232424, 26406414, 26512918, 26515594, 26559373, 27050979, 27207649, 27248826, 27351141, 27356714, 27496793, 27879265, 27914795, 28025102, 28099924, 28166202, 28178994, 28202520, 28208810, 28460534, 28481867, 28555011, 28559409, 28591216, 28617135, 28711499, 28732081, 28856117, 28983080, 29027990, 29235043, 29245248, 29256156, 29296206, 29326716, 29387062, 29388151, 29413760, 29482885, 29540614, 29557068, 29648818, 29695771, 29695834, 29707128, 29715108, 29844821, 29867925, 29891854, 29934528, 30075885, 30079756, 30083161, 30134951, 30168090, 30262865, 30332900, 30372844, 30439625, 30442350, 30467123, 30546293, 30563531, 30578886, 30671946, 30962499, 30989585, 31004874, 31007849, 31167402, 31186728, 31515600, 31598337, 31635541, 31781916, 31795965, 31824163, 31826486, 8774705, 9770334		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16298037, 17516992, 19435922, 19446661		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10408869, 3054878	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	10574257, 10755407, 12201223, 12771987, 14735187, 16464738, 17261184, 17531096, 17594514, 18060036, 18167335, 18239642, 1852008, 18632641, 19435922, 19687301, 19965896, 20110692, 20418110, 20618976, 21092249, 21234673, 21523452, 22235336, 23056300, 23178494, 23289672, 23368093, 23530106, 23632023, 23677069, 23679576, 23696929, 23750285, 23762340, 24377611, 24467886, 24473196, 24670917, 25213863, 25231991, 25269750, 25304131, 25305747, 25453096, 25573951, 25697898, 25824986, 25868978, 25881039, 25989735, 26173622, 26268945, 26512918, 26888479, 26905583, 27050979, 27248826, 27356714, 27694691, 27701469, 28270510, 28472950, 28555011, 28591216, 28732081, 28791816, 29256156, 29728589, 29781562, 29891854, 29934528, 30451357, 30670152, 30989585, 31337349, 31450894, 31515600, 31789400, 31795965, 31838945, 32230799, 32305991, 32414408, 32636303, 32788048, 32928877, 33355355, 33371806, 34572592, 34931617, 35053185, 35508987, 35626741, 35639264, 36224342, 36289222, 36431925, 36565897, 36647876, 36873124, 36881538, 36922677, 37454220, 37480115, 37556419, 37628945, 37747031, 37773865, 38263420, 39201674, 39451175, 40550227, 8774705, 9618523	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	19446661, 22178238, 22203932, 23372803, 24568505, 25476497, 31552680, 33517609, 35524373, 37199043	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bright Disease	Bright Disease	CTD_human_DG	9403216		★☆☆☆☆ Found in Text Mining only
Brittle diabetes	Brittle diabetes mellitus	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Bronchial Diseases	Bronchial disease	Pubtator	24094526	Associate	★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial hyperreactivity	Pubtator	23737648	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	10515411, 31503552	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	30416771, 31503552		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	30936869		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	36561744	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	12451269, 8830832		★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	LHGDN	12451269		★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis obliterans	Pubtator	22815323	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	28887719		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	17400600, 18521627, 25409741, 25797206, 27321203, 28382003, 29941233, 30517142, 30862773, 30936981		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	25797206, 37090732	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	35460699	Stimulate	★☆☆☆☆ Found in Text Mining only
Brucellosis	Brucellosis	Pubtator	20404074	Associate	★☆☆☆☆ Found in Text Mining only
Bruton type agammaglobulinemia	Bruton type agammaglobulinemia	Pubtator	17090647	Associate	★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	31302740		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	1320956, 9081710		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	25071000, 29078819, 7689148	Associate	★☆☆☆☆ Found in Text Mining only
Bursitis	Bursitis	BEFREE	21484857		★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	23200412	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cachexia	Cachexia	Pubtator	24886605, 33047901, 34502316, 35967380	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Calcinosis	Calcinosis	Pubtator	23564641, 40597062	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	28134597	Stimulate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	15935550		★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	35016421	Associate	★☆☆☆☆ Found in Text Mining only
Candidemia	Candidemia	Pubtator	27376574	Associate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	15672864, 17094460	Associate	★☆☆☆☆ Found in Text Mining only
Capillary Leak Syndrome	Capillary leak syndrome	Pubtator	36453709	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17177164, 18167335, 20065508, 20354000, 21690253, 21710491, 23052692, 23185547, 24531714, 24554664, 25213322, 25697898, 28349833, 30249899, 32593213, 33682749, 34628367, 35341013, 35813468, 38245869, 40022690, 9062407	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10786674, 10923947, 10928984, 19555998, 23893709, 24573038, 24806843, 26296968, 27108527, 29050290, 30249899, 7512667, 8100482, 9414656, 9891500		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	16412062	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	24907005	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	12445202, 15610530, 28987144, 31342143, 32859764, 9681393	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	35552660	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	28791816	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	18060036, 1852008, 23696929, 2553849, 37975220, 7512730, 8183909	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	10480339, 8455626	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	15904949	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10076051, 10438468, 11257503, 11331273, 16339299, 16425355, 1879551, 19126646, 21258167, 22471481, 23011405, 23087145, 23305119, 23684136, 24371367, 2472425, 24912675, 25892518, 25908103, 26229401, 26331965, 26452542, 26547929, 26757951, 27268603, 28460481, 28970500, 29556041, 29614505, 29651140, 29722127, 30340922, 30709346, 31044528, 32363617, 32792856, 33906302, 34053234, 34056002, 34281231, 34597305, 35848884, 35955552, 36068200, 36215278, 37501379, 37995395, 39256453, 7680115, 8226773, 9003407, 9030516	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11773079, 19374779, 33173438, 34435646	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	10925276	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	26268945	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	31366794	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11841803, 16110031, 18558283, 18825409, 20499068, 21104146, 23637926, 23727622, 23762858, 25292079, 26264279, 26605964, 27092883, 28418913, 28607587, 30302904, 30744595, 7550294, 9212236, 9231915		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	28878571		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10374431, 11504947, 12151314, 12833138, 14604894, 15854959, 16344268, 1716216, 17416433, 18060028, 18990769, 19505916, 20713723, 21122157, 21216930, 21252117, 21996739, 22580886, 23052692, 23292870, 24139238, 24260500, 24408019, 24420154, 24492940, 24922005, 24984610, 24988892, 25074527, 25242236, 25461668, 25729947, 25889486, 26166037, 26372664, 26517240, 26528698, 26703799, 26739332, 26744530, 26815582, 27197187, 27556690, 27835873, 27893707, 27998891, 28149280, 28402963, 28599466, 28819126, 28830450, 28855077, 28951614, 29049175, 29101033, 29134640, 29383114, 29408308, 29869537, 29970138, 30078713, 30127882, 30266897, 30604632, 30634502, 30833304, 30851071, 30953795, 31100307, 31128010, 31273548, 31367260, 31412593, 31468132, 31491838, 31507089, 31513749, 31559061, 31771091, 8364912		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	11950960, 16368063, 17617741, 19619321, 20860602, 23889749, 26282935, 27118139, 27825119, 36814597	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21847358, 22190968, 25827621	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24884871, 27167341, 29092903, 32865617, 33893076, 35859428, 36495330, 36881486, 39256468, 39260693, 39273323, 39684873	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37047307	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10843457, 10889822, 11849447, 1596939, 16221209, 16428383, 17100773, 17346426, 19679182, 1991509, 22303451, 23578198, 24034344, 26554658, 28328292, 29286165, 29515108, 29700419, 31366794, 31636361, 32621022, 33177244, 33759378, 33993869, 34058568, 34452748, 3500852, 35341013, 35983409, 36932108, 37653791, 37927783, 38148073, 7656270, 8099898, 8231032, 8886918, 9462266, 9820173	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18294286, 25679997	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	9845545	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	16412062	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	16133109, 18310089, 24356192, 26372664, 27169370, 37369480, 9630206	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	11313947, 12445202, 15610530, 16826314, 17107380, 17307204, 28987144, 29987839, 31342143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Basal Cell	Carcinoma	CTD_human_DG	22108589		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	15904949		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	29399120		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12810629, 15581980, 15870936, 17023036, 17373716, 18587580, 19401270, 20699329, 22158046, 22595649, 23889749, 25670170, 26122176, 26282935, 27068525, 27174914, 27206315, 27825119, 28012060, 28848618, 28872976, 28960399, 29100353, 29565447, 29572027, 30009406, 30021477, 30305729, 30584363, 30642295, 31049770, 31097475, 31212816, 31533774, 31755326, 8482564		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	10716473		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	10716473, 32515246, 36298704	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	BEFREE	17336407, 20331841, 28844956, 29120957, 31665900		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	10716473		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	25827698, 36049813	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	25888309, 34669781	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	22447464	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	31002169		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	23696929, 25274950, 27430170, 30327453, 31002169, 8624580		★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular Abnormalities	BEFREE	12846758		★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	12846758	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	12201209, 15531184, 15780075, 17335789, 17596140, 17684217, 18307986, 18420533		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	12482836, 12544661, 12637697, 12846758, 14644408, 15036420, 15205588, 15364891, 15604420, 15854959, 16313298, 16458279, 16467451, 16472051, 16807407, 16900203, 16988060, 17194638, 17335789, 17508011, 17845840, 17851695, 17886064, 17994165, 18091699, 18848327, 18974842, 19729864, 19744034, 19750100, 20059469, 20164544, 21352255, 21814463, 21842238, 21889771, 23024462, 23414490, 23624317, 24611887, 24630186, 24763700, 25274950, 25492254, 26347573, 26702930, 27062409, 27798514, 27899528, 28267753, 28477314, 28542510, 28567066, 28699615, 28819827, 28825974, 28864204, 28880739, 28939513, 29042430, 29112590, 29169069, 29170076, 29186034, 29199785, 29226690, 29258216, 29452178, 29453087, 29466985, 29520828, 29579601, 29873573, 30061319, 30081225, 30213651, 30418124, 30534995, 30584444, 30875589, 30946765, 31026349, 31086050, 31108552, 31279001, 31296155, 31338006, 31419967, 31430066, 31662403, 31707836, 31772093		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	12846758, 17194638, 17596140, 17994165, 18420533, 18974842, 20164544, 21084246, 21814463, 21818333, 23024462, 23968978, 24043651, 24086545, 25492254, 25827698, 26463449, 27079270, 31707836, 32806763, 33035661, 34667241, 34927447, 34931349, 35948913, 36012132, 36102277, 36159840, 38067150, 39271913	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27992360, 32658258, 40102901	Stimulate	★☆☆☆☆ Found in Text Mining only
Carditis	Carditis	CTD_human_DG	25396421		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	BEFREE	17115186, 21700929, 27742738		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	LHGDN	17115186, 18638042		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	20536609	Inhibit	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	33350884, 33376728	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	36083252	Stimulate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	12574550, 12919773, 30946765		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	17098305		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	LHGDN	18421029		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	25441669, 27001002, 33350884	Associate	★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal tunnel syndrome	Pubtator	1616367	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	18205922, 26762166, 31434236, 31981738, 33228785, 33855071, 36799502, 39768138	Associate	★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	1632458, 19139722, 1954381, 23372742, 28241173, 32873770, 34246246, 9403701	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Castleman Disease	Castleman disease	Pubtator	28183278, 9613678	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cataract	Cataract	Pubtator	25303043, 37694725	Stimulate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	28546929, 29542353, 9856775		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	33639877, 39959181	Associate	★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	12554901, 17052299, 19900796, 22113815, 23411129, 24725540, 26121490, 27705004, 27911103, 29158121, 29847542, 30132358, 31553527, 9596098		★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	BEFREE	23969038, 29315994		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	11426023, 15644122, 16287542, 16567828, 18692934, 19280716, 25198673, 26662429, 28028951, 28928101, 30240467, 30400824		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	LHGDN	18692934		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	21392369, 28928101, 31717494, 34895167, 35216089, 35354862, 36296938, 38040898	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Central Core Myopathy (disorder)	Myopathy	BEFREE	21088110		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	38178046	Stimulate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	39364412	Associate	★☆☆☆☆ Found in Text Mining only
Central visual impairment	Central Visual Impairment	BEFREE	2229813, 8485909		★☆☆☆☆ Found in Text Mining only
Cerebral Aneurysm	Cerebral Aneurysm	BEFREE	16648144, 31264696		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	27981440, 29363904		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	27730688, 31646585, 35833818, 39433142	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	29194369, 38167007	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	12637697, 17916761, 19018268, 26662441, 29194369, 30804318, 31192907, 31316450, 31446341		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	20059469, 20622166, 24782217, 25333814, 26722564, 28716248, 28724745, 31192907, 31215220, 32223966, 35856366, 36254030, 37268894	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	31481525, 38245621	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	LHGDN	18391842		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	19566553, 19938160, 21291465, 22266275, 23415255, 24314052, 24903966, 29670909, 31094787, 31779506		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	24314052, 24903966	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	29950823, 30571420, 30844663		★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral microangiopathy	Pubtator	32223966	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Thrombosis	Cerebral Thrombosis	BEFREE	26662441		★☆☆☆☆ Found in Text Mining only
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	28869993, 29683965		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	11983287, 12637697, 12843357, 14512079, 15608432, 15733973, 15767859, 16051899, 16210572, 16323614, 16879054, 17878722, 17916761, 18158110, 18163209, 19018268, 20464061, 21407237, 22410655, 22773460, 26081809, 27049557, 28079628, 28348074, 28587928, 28716248, 28751018, 28893516, 28917588, 28990089, 29091301, 29097060, 29476447, 29953477, 30290827, 30312930, 30844663, 30934019, 31004072, 31133816, 31260841, 31269910, 31356182, 31486527, 31678139, 8824468		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	LHGDN	12637697, 12843357, 14512079, 16051899, 16642549, 16879054, 17916761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	CTD_human_DG	18319729		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	17519976, 18467705, 23019398, 24165468, 30568999, 30664615	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	30664615		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	10446984, 12629515, 16803517, 19404917, 19585495, 23180271, 23953057, 24118365, 25227842, 27220278, 27535759, 27722983, 27777338, 27866212, 28741286, 30135142, 30510453		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	7954473		★☆☆☆☆ Found in Text Mining only
Cervical myelopathy	Cervical myelopathy	BEFREE	30327453		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	10366571, 10446984, 12629515, 16803517, 19404917, 19585495, 22193459, 23180271, 23953057, 24118365, 24806843, 25227842, 27220278, 27535759, 27722983, 27777338, 27866212, 28741286, 30135142, 30510453, 7954473, 8789430		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	1500742		★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth disease, X-linked, 1	Charcot-Marie-Tooth disease	BEFREE	17714866		★☆☆☆☆ Found in Text Mining only
CHARGE Syndrome	CHARGE Syndrome	BEFREE	30867640		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	21875833, 2388482, 2784698, 29963154, 30443842, 7919380, 9324301		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	29296780		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	20371397, 28185773		★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	23380467, 31399711		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	28109867		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	10480339, 21613407, 29207075		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	10869285, 14973058, 15940637, 16317687, 16469407, 17079474, 17241887, 17621267, 19153483, 20146264, 22906985, 23110045, 24037855, 25239565, 25344679, 25580681, 25744243, 26427701, 29693152, 29707118, 29860474, 30180182, 30886152		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	15917303, 17241887, 24998588, 27809873, 30419338, 32505533, 34758510, 34948304, 36317517	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	17241887		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cholangiocarcinoma	Cholangiocarcinoma	CTD_human_DG	17621267		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	12077104, 34519176	Stimulate	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	17162367, 24390753, 25046437, 35563301, 37256725	Associate	★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	18260730, 24078093, 29671891, 8844475		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	18260730, 24078093, 29671891		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	22461449		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis	Cholestasis	BEFREE	25450715		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis	Cholelithiasis	Pubtator	35196362	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	24489901		★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	28789951		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholesteatoma	Cholesteatoma	Pubtator	24551293, 33627146	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma Middle Ear	Middle ear cholesteatoma	Pubtator	24551293, 31947538	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	16391840, 21278254		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	21278254	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	34127734, 39393273	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	8898173		★☆☆☆☆ Found in Text Mining only
Chorioretinitis	Chorioretinitis	BEFREE	23336844		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	29675846		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	7834629		★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	28384257		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	11520812, 17951471, 20001857, 23472199, 23593036, 27079270, 28077069, 32213162, 32369831, 35964023, 7701874	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	34220309	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	28883848, 28889349		★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	8051739		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	10843245, 12846758, 16076356, 16760905, 17203290, 17656329, 20144192, 20380647, 20551628, 23019398, 26421528, 28036114, 28164733, 28487598, 29170076		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	16760905, 21040163, 21183183, 21236342, 21677444, 21906921, 22068875, 22911697, 25376195, 26463449, 27996163, 28017325, 28147348, 28484449, 28608457, 28833735, 29170076, 29451472, 29861060, 29905409, 29942503, 30009900, 30249039, 30380555, 30721632, 30991230, 31148248, 31207307, 31365830, 31426909, 31549627, 31673705, 8278382		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	16425355, 18571528, 23136556, 9676846		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10618692, 10870116, 11133769, 15940637, 1606555, 18271063, 22475215, 2258703, 24836891, 26041742, 27813533, 2784698, 28722170, 28754746, 29353760, 30623437, 31409670, 8124214, 8457468, 8547132, 8726409		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CTD_human_DG	18006695		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	30571852		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	16921112, 18312445		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	18693004, 19179485, 19272152, 19349390, 19359268, 20169073, 21814463, 21997388, 22268122, 25535123, 26345781, 26617776, 27060571, 27197187, 27864635, 28004483, 28006950, 28115840, 28142050, 28334838, 28403845, 28476471, 28511344, 28670246, 28791839, 28795606, 28860735, 28873220, 29020675, 29067126, 29131048, 29149779, 29329563, 29329680, 29620199, 29804489, 29872287, 30296713, 30380761, 30392917, 30486816, 30629626, 30638307, 30908476, 31128153, 31141166, 31237014, 31257455, 31275415, 31316109, 31323391, 31363933, 31383234, 31425628, 31503552, 31517562, 31714272		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	CTD_human_DG	28864214		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic osteomyelitis	Osteomyelitis	BEFREE	18971305, 28770614		★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	32213162, 32717400, 39231552	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	12716337, 15025214, 15663749, 15863389, 19549135, 19555357, 19946956, 20059422, 20386787, 20681812, 20860764, 20881337, 22122521, 22769440, 23332218, 23377045, 23433353, 23592000, 27172922, 27280944, 27992569, 28552911, 28601733, 29065749, 29489938, 29670909, 29737428, 30186882, 30300034, 30427403, 30917206		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	LHGDN	15025214, 15863389, 17209781		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	20881337, 23592000, 24670840, 25098998, 25530681, 26096103, 29489938	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	21198766	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	26211001, 30427403	Inhibit	★☆☆☆☆ Found in Text Mining only
Chronic Prostatitis with Chronic Pelvic Pain Syndrome	Prostatitis With Chronic Pelvic Pain Syndrome	BEFREE	30927681		★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	BEFREE	25214388, 30782515		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	26266960, 9560103		★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	34951048	Associate	★☆☆☆☆ Found in Text Mining only
Ciliary Motility Disorders	Ciliary dyskinesia	Pubtator	38245732	Associate	★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathy	Pubtator	38245732	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	19054267, 23350952, 24751829, 24841049, 26725065, 27730688, 28401002, 28614777, 28665498, 31086599, 8076766		★☆☆☆☆ Found in Text Mining only
Clear cell adenocarcinoma of ovary	Ovarian adenocarcinoma	BEFREE	21343371		★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	BEFREE	23058034		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	31295461		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	22174866	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	30688042	Stimulate	★☆☆☆☆ Found in Text Mining only
clinical depression	Mental Depression	BEFREE	26821321		★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	12836160		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	11494413, 19018268, 28283439, 31437534, 7572281		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	9492179	Associate	★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	7949151		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	19359268, 23364322, 23559466, 24997674, 25214388, 25609760, 26517210, 27701469, 30256904, 32514870, 35503943, 36805537, 37108527, 40348638	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	26291404, 29090685, 29141125, 30586550		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	23593165, 29196629, 30115946, 37373554	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	36012652	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	12856331, 16150725, 16202978, 17675459, 18492028, 18535667, 18536750, 20458762, 21106853, 22374925, 22410118, 22738913, 22962574, 24604303, 24651526, 24718601, 25593461, 25713055, 25838550, 26047140, 26287468, 27261270, 27394986, 27639807, 28193514, 28511912, 28677983, 28694747, 28695925, 28698550, 28864472, 29036211, 29148173, 29203393, 29471245, 29579933, 29680209, 29694938, 29695802, 29724065, 29867078, 30279279, 30462121, 30548286, 30800169, 30836096, 31105713, 31197256, 31351432, 31366877, 31481750, 31546840, 31615012, 31679013, 31802588		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	LHGDN	18710929		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	CTD_human_DG	22410118, 24548422		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	Pubtator	36159840, 36466854	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis Ulcerative	Ulcerative colitis	Pubtator	18160345, 18825772, 22185629, 30369485	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	21129005, 22539302, 25076849, 31798282, 32022398, 32724277, 32871953, 33409535, 36575020, 37078344, 37445676, 37710023	Associate	★☆☆☆☆ Found in Text Mining only
Colitis, Collagenous	Colitis	BEFREE	21527852, 23566938		★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	7834629		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10903137, 12349828, 15485627, 16012947, 17694420, 19177010, 20132036, 20354000, 21129206, 21145125, 21994466, 22738913, 22750444, 24120915, 25622900, 25625841, 25713055, 25862884, 26125778, 26209639, 27372860, 27980357, 28193578, 28425852, 28725043, 28739265, 28746799, 30081854, 30243096, 30344742, 30345534, 30982362, 31088266, 31150612, 31208913, 31554639, 31694340, 31838134		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	17694420	Inhibit	★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	17694420, 24970802	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11355696, 18205904, 26673628, 30243096	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	20132036, 25838550, 30243096		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	33832346	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10766420, 11920517, 12760309, 12796383, 15284182, 15485627, 16035616, 16937502, 17694420, 18205904, 18448485, 19177010, 19578817, 19728052, 19926618, 20065508, 20333461, 21129206, 21633598, 21819567, 22714907, 23884764, 24430672, 24447345, 24642471, 24651526, 24859972, 25174402, 25547486, 25625841, 25713055, 25750173, 25838550, 26530697, 26638167, 26663388, 26674205, 27494533, 27504605, 27549777, 28089732, 28348483, 28349833, 28719352, 28868572, 28928161, 29108270, 29133757, 29275959, 29277790, 29333928, 29448205, 29546074, 29580751, 29695802, 29707119, 29736218, 29788743, 29803656, 30038723, 30087314, 30154846, 30184100, 30217479, 30278948, 30415472, 30591653, 30816524, 30862187, 31085401, 31208913, 31246342, 31472054, 31534132, 31554639, 31612049, 31750910, 31795177, 8102353, 9924696		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10903137, 11920517, 12760309, 15188028, 16937502, 17094421, 17189976, 17579859, 17694420, 18205904, 19177010, 20065508, 20354000, 20823887, 21129206, 21633598, 21994466, 22363134, 23018603, 23756862, 24097071, 24859972, 25461668, 25541970, 25547486, 25750173, 26258407, 26673628, 26759006, 26839145, 27006530, 27738330, 28348483, 28349833, 28676732, 29096354, 29275959, 29333928, 29690889, 29719581, 30243096, 30308035, 30598580, 30636774, 30973070, 31534132, 31646564, 31754344, 31864341, 31941522, 32022398, 32390702, 32855767, 33029691, 33236127, 34106269, 34131122, 34290255, 34726248, 34931923, 34997691, 35501324, 36063748, 36482184, 36849492, 37185128, 37430251, 37460938, 37477088, 37596598, 37749297, 38041015, 38459704, 39206889, 39247989, 39337548	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12727794, 12760309, 12839942, 12926107, 14643032, 16442710, 18448485		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	15284182, 22738913, 25461668, 29707119, 30931933		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16937502, 26595254, 33582655, 33832346, 37047623	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21129206, 35213038	Inhibit	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	11196660, 20177958, 2229813, 27288995, 29180260, 8485909		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	19076825, 19592080, 22454615, 31827477, 34146579, 8485909	Associate	★☆☆☆☆ Found in Text Mining only
Complement Component 6 Deficiency	Complement component deficiency	Pubtator	33227992	Stimulate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	23043388, 24120739, 25045829, 30594561, 31002731		★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	12836160		★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	BEFREE	29273305, 31244775		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	28075461, 28100408, 31309444		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	LHGDN	15331795, 16278864, 18841030		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	16278864, 27542852, 29932521		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	25450715, 30159734		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	1516003, 8830729		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	19153483, 23110045, 24037855, 25041016, 25744243, 26455324, 28719954, 29707118, 30415063, 30419338, 31121000, 31533404		★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1A	Congenital disorder of glycosylation	Pubtator	35711443	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	BEFREE	21353594, 25603974, 28860542		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	29444773		★☆☆☆☆ Found in Text Mining only
Congenital Myotonic Dystrophy	Congenital Myotonic Dystrophy	BEFREE	29091763		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11082413, 11380590, 11568062, 11985915, 12411982, 15867183, 16802372, 17637508, 18246092, 21503626, 25498756, 26228789, 26864064, 28193640, 28440487, 28515118, 28542263, 28674538, 28684396, 28695463, 28763371, 28793058, 28881679, 28883848, 28889349, 29066436, 29093735, 29437117, 29663512, 30259192, 30273582, 30312930, 30387679, 30408810, 30651573, 30747396, 30860934, 30968846, 31058877, 31087601, 31105751, 31275366, 31297975, 31379862, 31505423, 31749886, 31778438		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	15135663, 16360360		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conjunctival Diseases	Conjunctival disease	Pubtator	28975281	Associate	★☆☆☆☆ Found in Text Mining only
Conn Adenoma	Conn Adenoma	BEFREE	29059354		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	30561237		★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	BEFREE	28839376		★☆☆☆☆ Found in Text Mining only
Contracture	Contracture	Pubtator	19214689	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11830554, 15665272, 16221209, 17373716, 19360351, 22429968, 23274199, 25675297, 25679997, 27377533, 27384883, 28093267, 28846080, 28903416, 28915665, 29357946, 29700419, 29717134, 29902078, 31001636, 31410730, 31636361, 7861551, 8231032, 8886918, 9112382, 9736430		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	7834629		★☆☆☆☆ Found in Text Mining only
Cor pulmonale	Cor pulmonale	BEFREE	31599438		★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy, Juvenile Epithelial of Meesmann	Corneal Dystrophy, Epithelial Of Meesmann	BEFREE	29660650		★☆☆☆☆ Found in Text Mining only
Corneal Injuries	Corneal injury	Pubtator	12714388, 32016117	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	28584076		★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal Ulcer	BEFREE	12714388, 30140651		★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal ulcer	Pubtator	12714388	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	12217290, 18753723, 28212870	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	23742784, 30617865		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	28051250	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	11199329, 11703956, 11728144, 11950697, 12508953, 15379752, 15543342, 15831362, 16269662, 16984279, 17916761, 18215601, 18279814, 18307986, 18562207, 18774574, 19005292, 19075735, 19140875, 19169973, 19349293, 20116810, 20190679, 20206549, 20493832, 20860764, 21226932, 21512395, 21574137, 22260656, 22261689, 22421340, 22509361, 22575724, 23357300, 23461479, 23505291, 23582716, 23881440, 24072607, 25299085, 25312476, 25867411, 25966083, 26079504, 26174156, 26191329, 26345772, 27131578, 27323181, 27627640, 27942589, 27955950, 28051250, 28142118, 28192516, 28212870, 28288972, 28534120, 28569269, 28739396, 28878828, 29066452, 29187908, 29188498, 29579601, 29580104, 29807669, 29889576, 30230982, 30340850, 30505168, 30571600, 30633155, 30936987, 30988729, 31088358, 31157268, 31438723, 31739518, 7671371		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	11703956, 11728144, 11950697, 12185451, 12508953, 12943869, 15379752, 15543342, 15831362, 16269662, 17627181, 17916761, 18157711, 18215601, 18279814, 18281810, 18307986, 18449426, 18562207, 18753723, 18774574, 19005292, 19075735, 19140875, 19169973, 19349293, 19535079, 19652890, 19766904, 19829130, 20190679, 20206549, 20229495, 20383745, 20493832, 20691218, 20860764, 21512395, 21574137, 21626471, 22075248, 22260656, 22261689, 22421340, 22509361, 22575724, 22902153, 23242654, 23357300, 23461479, 23505291, 23582716, 23742784, 23881440, 24072607, 25299085, 25312476, 25867411, 25966083, 26075620, 26079504, 26174156, 26191329, 26345772, 26505399, 26864064, 27062409, 27131578, 27323181, 27627640, 27742738, 27749321, 27862306, 27955950, 28088561, 28192516, 28212870, 28233119, 28288972, 28349060, 28527371, 28534120, 28542263, 28569269, 28686695, 28739396, 28778748, 28878828, 28985621, 29066452, 29453342, 29580104, 29807669, 29889576, 30212581, 30230982, 30258440, 30340850, 30505168, 30571600, 31088358, 31157268, 31332225, 31411246, 31438723, 31469975, 31642412, 31739518		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	14566255, 19140875, 20206549, 21245598, 22780915, 23881440, 24363620, 24699044, 24736319, 25299085, 25526459, 25867411, 26191329, 26304941, 26345772, 26505399, 26864064, 26926996, 27323181, 27862306, 28033321, 28051250, 28212870, 29889576, 30212581, 30258440, 30261890, 31043452, 31411246, 32215496, 32223966, 32374489, 33029103, 33177541, 33504180, 34315328, 34931349, 34993731, 37201714, 37239434, 37820655, 38290570, 38459704, 38513732, 38602103	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	15015143, 18281810, 18562207, 18649055, 18753723, 19005292, 19140875, 19169973		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	19551157, 26867220, 30333306, 33731531, 33735200, 38075042	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Vasospasm	Coronary Artery Vasospasm	BEFREE	15172469		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	17194638, 21804106, 23375186, 23881440, 25082230, 25683698, 27627640, 29121163, 32215496, 33660877, 33849106, 34861059, 34883250, 35782064, 35866783, 37566005, 40184077	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	19814730, 27955950, 36051484	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	39344313	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	11703956, 11728144, 11950697, 12508953, 12542551, 15379752, 15543342, 15831362, 16269662, 17123852, 17194638, 17848119, 17916761, 18215601, 18279814, 18307986, 18562207, 18774574, 18974842, 19001202, 19005292, 19075735, 19140875, 19169973, 19349293, 20190679, 20206549, 20493832, 20860764, 21481392, 21512395, 21574137, 21804106, 22260656, 22261689, 22421340, 22509361, 22575724, 23357300, 23461479, 23505291, 23582716, 23593036, 23881440, 24072607, 25082230, 25299085, 25312476, 25781951, 25867411, 25966083, 26079504, 26174156, 26191329, 26345772, 27131578, 27323181, 27627640, 27814628, 27955950, 28192516, 28212870, 28288972, 28534120, 28569269, 28577936, 28739396, 28878828, 28930526, 29066452, 29108239, 29520823, 29731838, 29800783, 29807669, 29889576, 29896248, 30230982, 30340850, 30505168, 30571600, 31088358, 31157268, 31438723, 31739518		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	18399716		★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	10862597, 31729103	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	11714126, 35082332	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	16374139, 30988729		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	LHGDN	18064337		★☆☆☆☆ Found in Text Mining only
Coronary Vasospasm	Coronary vasospasm	Pubtator	35096275	Associate	★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	35866040, 39465738	Associate	★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	8610106	Associate	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	15375575, 28389503, 28487953, 31497533		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	LHGDN	15375575		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	28487953, 36389809	Associate	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	28859336	Stimulate	★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	25821554	Stimulate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	19826119, 21442077, 26266960, 27076371, 28234665, 28260873, 28506444, 28971493, 28994126, 29024522, 29298730, 29808005, 29808007, 30054566, 30249264, 30586620, 30753567, 30988175, 31162892, 31195139, 31355491		★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	BEFREE	23400395, 31375891		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	20003352, 20583924, 32709104, 33041191, 33939645	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	10389698, 18025155, 21228771, 21797848, 24635023, 28190086, 29521042, 31415355, 32724277, 33743589, 34106269, 34629811, 35529850, 38517030	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	CTD_human_DG	10700533, 21829567		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	11196713, 11204808, 15223609, 15842590, 1587185, 16009674, 16150725, 18022867, 18305068, 18473869, 18535667, 18799360, 18825772, 19550417, 19934771, 20564534, 20615550, 21406388, 21877213, 21945121, 21994045, 23643741, 23950992, 23974060, 24668548, 24776844, 26316104, 28088612, 28190086, 28452812, 28857361, 29247068, 29748708, 29752990, 29912382, 30584414, 7841354, 9753275, 9928378		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	LHGDN	11918227, 16150725		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	18160345, 18825772, 20564534, 21877213, 23950992, 33537747, 9099934	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	10700533, 21829567		★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	10700533, 21829567		★☆☆☆☆ Found in Text Mining only
Cryopyrin-Associated Periodic Syndromes	Cryopyrin-Associated Periodic Syndromes	BEFREE	21637346, 27036377, 29549113		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	12114287, 30480750		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	LHGDN	12114287		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	30480750, 36316863	Associate	★☆☆☆☆ Found in Text Mining only
Cushing's symphalangism	Proximal symphalangism	Pubtator	25526459	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	27616684, 29434773, 30703475		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	12394188, 14675394		★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic neutropenia	Pubtator	39210558	Stimulate	★☆☆☆☆ Found in Text Mining only
Cyclical vomiting syndrome (disorder)	Cyclical Vomiting Syndrome	BEFREE	27759738, 29434735		★☆☆☆☆ Found in Text Mining only
Cystathionine beta-Synthase Deficiency Disease	Cystathionine Beta-Synthase Deficiency Disease	BEFREE	31551410		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	10515411, 12762338, 15640323, 20438838, 20507572, 20936184, 22550062, 25058850, 26022954, 26331676, 29861448, 31428093, 31700158, 31803183, 33924887, 36480571	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	10837369, 12349828, 16361706, 18258920, 19502387, 21322102, 21649525, 26209880, 29282053, 31428093, 31742967		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	22014187, 24098711, 24885494, 34721395	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystic kidney	Cystic Kidney Disease	BEFREE	31778601		★☆☆☆☆ Found in Text Mining only
Cystic Kidney Diseases	Cystic Kidney Disease	BEFREE	31778601		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	28035695, 29136560, 29207018, 30869827		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	Pubtator	29207018	Associate	★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	24146927, 33848079	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	16676071, 23490413, 29207652, 29409258, 29890913, 30651780		★☆☆☆☆ Found in Text Mining only
Deficiency of glucose-6-phosphate dehydrogenase	Deficiency Of Glucose-6-Phosphate Dehydrogenase	BEFREE	15718915		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deficiency of testosterone biosynthesis	Deficiency Of Testosterone Biosynthesis	BEFREE	7769130		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	12836160		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	12836160		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10632674, 11281165, 12913922, 1376492, 14680510, 15104599, 15225370, 1531188, 15642131, 16198603, 16806998, 17640966, 18257935, 18528653, 18584044, 19264156, 20175976, 20886647, 2109776, 21312239, 22119941, 22294633, 22380539, 23595570, 24513290, 24719336, 24952309, 24985590, 25022967, 25252624, 25496568, 25603974, 25917063, 26233477, 26450708, 26578807, 26600476, 26713842, 26982743, 27082319, 27404795, 27669541, 27726040, 27789465, 27860453, 27894935, 28035387, 28063227, 28251487, 28262826, 28276100, 28333699, 28341537, 28379604, 28482921, 28537665, 28615667, 28663035, 28987943, 29148410, 29168867, 29245931, 29325836, 29441883, 29484338, 29695173, 29736207, 29755657, 29867478, 29998825, 30071128, 30110204, 30174601, 30184535, 30186872, 30302948, 30340925, 30462647, 30535473, 30548658, 30583501, 30597965, 30644275, 30691048, 30704030, 30707846, 30939166, 31055848, 31069838, 31177887, 31210280, 31262076, 31278964, 31298308, 31434236, 31438735, 31468982, 31497826, 31545916, 31653823, 31696218, 31696655, 31760158, 31775901, 31836142, 31837247, 7622181, 7948616, 8154312, 8655631, 9032818		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	17476620, 18257935, 18528653		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	22962574, 23607276, 26645352, 28400195, 30092402, 30981879		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	19269948, 21851175, 23385102, 24382617, 28587598, 29529166, 29549829, 29669581, 30079511, 31676521, 31770149		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Delirium	Delirium	PSYGENET_DG	19269948, 20471115, 21851175, 23385102, 24382617		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Delirium	Delirium	Pubtator	26215633	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Delirium	Delirium	Pubtator	29529166, 37156856	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia	Dementia	BEFREE	12909295, 15619128, 16297587, 16635548, 21116047, 26517210, 26725994, 27377066, 27861706, 29605221, 30150062, 30863888, 31145377, 31414991, 31497846, 9523575		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	26075907, 26517210	Associate	★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	19638714	Stimulate	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	21252539, 22015309, 26577108, 30229836		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	29518260, 37924373	Associate	★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	29856157		★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	29127274		★☆☆☆☆ Found in Text Mining only
Depression, Neurotic	Mental Depression	CTD_human_DG	18458677		★☆☆☆☆ Found in Text Mining only
Depression, Postpartum	Mental Depression	BEFREE	27822318		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	16946190, 17094069, 18458677, 20031642, 20836906, 21448457, 22921153, 23571152, 24548241, 25350786, 25596176, 25760924, 26074461, 26821321, 26934083, 27049572, 27840055, 27916659, 27936453, 27978584, 28041597, 28074475, 28083615, 28096677, 28120908, 28189098, 28243095, 28285256, 28318471, 28338340, 28418766, 28457809, 28474231, 28506437, 28521271, 28556833, 28558901, 28580183, 28582802, 28639714, 28681405, 28689006, 28867280, 28918107, 29016549, 29049348, 29059681, 29070016, 29184215, 29186541, 29197507, 29237576, 29324301, 29435648, 29500107, 29529552, 29562248, 29574669, 29626828, 29765402, 29787856, 29790996, 29842903, 29849779, 30022427, 30098513, 30104698, 30148175, 30178819, 30244217, 30287601, 30394311, 30439824, 30504424, 30682501, 30711869, 30762747, 30819515, 30848077, 30854996, 30886334, 30899619, 30925322, 30955108, 30957546, 30962090, 30967802, 30978658, 30979715, 31017303, 31052597, 31063941, 31073553, 31141465, 31165368, 31170723, 31296155, 31319037, 31394209, 31541903, 31556787, 31615595, 31686824, 31820774, 31823093, 7750122		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	CTD_human_DG	18458677		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	19073752, 19249913, 23512358, 24726621, 25464926, 25976322, 26945673, 27822318, 29936334, 30886334, 30957546, 32998701, 33079133, 35964023, 36168941, 37745719, 39760673, 39863282, 7858264	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	20836906, 24143878, 24182629, 25683698, 26403459, 27414954, 33903586, 37058046	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	24491956, 24548241, 25350786, 25760924, 25903726		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	21831269, 24424390, 25022969, 27138824	Stimulate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	26804030, 35964023, 37058046	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Syndrome	Mental Depression	CTD_human_DG	18458677		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	15888147, 22966985, 23524263, 25456159, 27942589, 28143523, 28212864, 28912118, 29698775, 29767264, 31158415, 31679013, 9820543		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	17960185, 22533231, 22968402, 23654074, 25270893, 27077833, 31596431, 31868801, 34070943, 36587063, 8082305	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	34678092	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	23654074, 31251775	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	34916261	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	37187734	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	27236299		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	10831012, 11994107, 12828754, 15356430, 19477321, 22533231, 23524263, 23582566, 23654074, 24337738, 28887839, 28958612, 29740850, 30183461, 31707051, 8082305, 8977528		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	CTD_human_DG	18249437		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Irritant	Dermatitis	BEFREE	22966985, 30171875, 30647816, 31781680		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	15654950, 20074471, 22391335, 22992805, 9820543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	22533443		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	BEFREE	19877033, 24106699, 30367666		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	19877033, 24082909, 27803134, 36197661	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	24288551, 37985458	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	29988398		★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	23058034	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	19211157	Inhibit	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	21530175		★☆☆☆☆ Found in Text Mining only
Developmental Dysplasia of the Hip	Developmental dysplasia of the hip	Pubtator	28860542, 34203285	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11287357, 11983287, 12846758, 12915627, 14988254, 15080783, 15472205, 15562008, 16306329, 16464741, 16644865, 16837641, 16984279, 16988089, 17130551, 17898129, 17928988, 18852330, 19140096, 19549135, 20059422, 20383745, 20526368, 20682019, 20856927, 21149504, 21270276, 21478228, 21558879, 24051035, 24286720, 24782217, 25025664, 26205020, 26517838, 26911440, 26960417, 27500547, 27629486, 27742738, 27955950, 28298934, 28403363, 28591216, 28632410, 28637038, 28699615, 28769070, 28834086, 28848164, 28944839, 28966614, 29047204, 29133126, 29286405, 29456813, 29490310, 29534207, 29579601, 29605608, 29720826, 29784660, 29874560, 29885882, 30383519, 30610442, 30684651, 30920128, 31059127, 31177887, 31363933, 31396410, 31430066, 31436116, 31471378, 31502701, 31676093, 31786804, 31800000		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	24397394, 28353315, 28846666, 32280713, 36849131	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	33019392, 35390031, 36499008	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Insipidus Neurogenic	Neurogenic diabetes insipidus	Pubtator	24055514	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11287357, 11983287, 12846758, 12915627, 14988254, 15080783, 15458685, 15472205, 15562008, 15931619, 16235772, 16306329, 16464741, 16644865, 16837641, 16984279, 16988089, 17016617, 17130551, 17898129, 17928988, 18025402, 18852330, 19140096, 19549135, 20059422, 20383745, 20526368, 20682019, 20856927, 21149504, 21270276, 21478228, 21558879, 24051035, 24286720, 24782217, 25025664, 26205020, 26517838, 26911440, 26960417, 27500547, 27629486, 27742738, 27955950, 28096439, 28283222, 28298934, 28403363, 28569269, 28591216, 28621703, 28632410, 28637038, 28699615, 28769070, 28824543, 28834086, 28848164, 28944839, 28966614, 29047204, 29091912, 29133126, 29258216, 29286405, 29456813, 29490310, 29534207, 29568898, 29579601, 29581121, 29605608, 29720826, 29784660, 29844328, 29874560, 29885882, 29925283, 30170484, 30179212, 30260038, 30383519, 30574423, 30610442, 30684651, 30920128, 31059127, 31177887, 31363933, 31396410, 31402276, 31430066, 31436116, 31446797, 31471378, 31502701, 31676093, 31773714, 31786804, 31800000		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	11961304, 15180970, 16464741, 16864906, 16988089, 17994165, 20526368, 21149504, 21784542, 21818333, 23160722, 24782217, 25526459, 26911440, 27629486, 27955950, 28454543, 28591216, 28739185, 29513874, 33767783, 33820928, 34887659, 35851422, 36102277, 38250713, 40640313	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	LHGDN	12589429, 17716775		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	17911088, 18285554, 18349110, 20377994, 20682019, 21694775, 22385239, 26517838, 31244210, 32265833, 34283808, 34417262, 34831154, 34951048	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	39456722	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	12410803, 1592439, 16464741, 16864906, 18045485, 20686866, 23593036, 24523574, 27629486, 33767783, 35693790, 36282595, 36766809	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	16566827, 31299986, 31809899	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19127455, 32221364, 34682638	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	15774022, 16443741, 16988089, 18496509, 18650368, 20164544, 20377994, 20967696, 22012292, 22761857, 23110196, 24473436, 25098998, 25222779, 25726203, 25959254, 26911440, 28225860, 28626770, 29752628, 29947343, 30139387, 30212581, 31237452, 32816392, 32988848, 33767783, 33858419, 34883250, 34931349, 35782064, 37626843, 38049854, 38250713, 39202464, 39229261, 40127075	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23283045, 23484124, 24182629, 26246197, 26918832, 27904654, 29233142, 31077210, 34079246, 34682638, 34763485, 34917685, 35605453, 35801423, 36232497, 36463286	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35954211	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11054276, 12719374, 14735147, 15793269, 16464741, 17315139, 17498265, 18382266, 18692934, 19034420, 19127455, 19542902, 20686866, 23246692, 23601344, 24434314, 25182144, 25384728, 27629486, 28283222, 28824543, 29198994, 29249872, 29445381, 30006377, 30020457, 30273227, 30497321, 30778653, 30945295, 31054482, 31185481, 31322069, 31338868, 31809899, 8143505, 8968689		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	12719374, 16464741, 16864906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Ketosis-Prone	Diabetes Mellitus	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12589429, 12647840, 12829659, 12915627, 14680981, 14988254, 15070960, 15168015, 15172007, 15319170, 15364891, 15472205, 15561970, 15562008, 15609025, 15622443, 15645209, 15931619, 15952088, 15965659, 16050950, 16140413, 16306329, 16443741, 16472051, 16518702, 16538490, 16644865, 16797905, 17003362, 17123852, 17286233, 17671730, 17704300, 17898129, 17922475, 17952840, 18496509, 18573122, 18650368, 18719127, 18752089, 19140096, 19549135, 19633828, 19955001, 20132806, 20144192, 21249428, 21289263, 21424184, 22037645, 22075267, 22285873, 22615949, 23289913, 23871133, 24018334, 24051035, 24057184, 24102240, 25222779, 25869607, 26067576, 26239742, 26448147, 26702930, 26911440, 26918832, 26934706, 27500547, 27904654, 27918955, 28429777, 28592636, 28626770, 28642811, 28651236, 28651253, 28684396, 28716139, 28789654, 28794498, 28824430, 28966614, 29016549, 29095915, 29104510, 29160122, 29175667, 29199608, 29217651, 29227493, 29233142, 29305826, 29336982, 29508109, 29525039, 29601913, 29605608, 29687969, 29731416, 29782863, 29851525, 29945132, 29957071, 30042685, 30061319, 30093572, 30186882, 30360498, 30420491, 30666661, 30674009, 30693534, 30894049, 30917933, 30942623, 31014098, 31016518, 31073533, 31077210, 31100371, 31219767, 31237452, 31263995, 31296192, 31336986, 31416412, 31479874, 31485456, 31496653, 31549627, 31553998, 31554967, 31586692, 31607549, 31672458, 31676093, 31733313, 31796986, 8143505		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	15070960, 18988929		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Sudden-Onset	Diabetes Mellitus	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	26732858, 30090100, 31772933		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	33096729, 34293021	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	35394091, 35909542, 37577369	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic ketoacidosis	Pubtator	24619879	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	18496509, 18670406, 29999450, 33858824, 34219868, 36363561	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	24786705, 32723296	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	12647840, 15047630, 17286233, 18256353, 18670406, 22322482, 23871133, 24102240, 25384728, 28147348, 28363692, 28447736, 28881473, 28944839, 29336982, 29514038, 29782863, 30015512, 30210570, 30355913, 30417374, 30632070, 31016518, 31258671, 31323309, 31409386, 31451183, 31637265		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	29690804		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	37197158	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	17716775, 18988929		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	27288252, 28556866, 28852447, 28969616, 29434227, 29802904, 30644770, 31331642, 31396410		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	33328159	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	33383381, 36766809, 38222451	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diarrhea	Diarrhea	Pubtator	18684212	Inhibit	★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	37895018	Associate	★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	30273982	Stimulate	★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic Dysplasia	BEFREE	31682908		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	29168186		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	19716854, 21902578, 25564959, 27394196, 27799566, 28544905, 29295936, 30755239, 31515941		★☆☆☆☆ Found in Text Mining only
Diffuse Scleroderma	Scleroderma	BEFREE	31375891		★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	23353117	Associate	★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	28778705		★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	32710539	Associate	★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	30171875, 31158415, 31165501, 31781680		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	19920349, 23685554, 28239811, 28965202, 29343476, 31427887		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	21777617, 25066751, 28252221		★☆☆☆☆ Found in Text Mining only
Disturbance in mood	Mood Disorder	BEFREE	22227623, 29458196		★☆☆☆☆ Found in Text Mining only
Diverticulitis	Diverticulitis	BEFREE	31712072		★☆☆☆☆ Found in Text Mining only
dowling-degos disease	Dowling-Degos Disease	BEFREE	25365709		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	11258753, 27770619, 28829905, 30186038, 30902060		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	17187019		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25222269, 28829905, 29093484, 30186038, 33206953	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	LHGDN	18419107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dry Eye Syndromes	Dry eye syndrome	Pubtator	23169882, 28379971, 29673232, 32476816	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dry Eye Syndromes	Dry eye syndrome	Pubtator	28887117	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	30175615, 30325678, 30664361		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	18060036, 28791816		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	28791816		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	15627645	Associate	★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	19077731		★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	27481890		★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	37717172	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	30249899	Stimulate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	LHGDN	11758653		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	15992611, 16518702, 20383745, 22385075, 26264374, 26781506, 28163257, 28288972, 28916714, 29482351, 29516281, 30139760, 31185481, 31191115, 31671940		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	17994165, 18420533, 26781506, 28212870, 35274685, 36157437, 40428368	Associate	★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	BEFREE	20570482, 24012192		★☆☆☆☆ Found in Text Mining only
Dystonia, Dopa-Responsive, due to Sepiapterin Reductase Deficiency	Dopa-responsive dystonia	BEFREE	30130755		★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	17952840		★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	28858391		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	29906710		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	29109760		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	35341013	Associate	★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia Anhidrotic with Immunodeficiency Osteopetrosis and Lymphedema	Anhidrotic ectodermal dysplasia with immunodeficiency, osteopetrosis, and lymphedema	Pubtator	19860911	Associate	★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	18495678		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	10831012, 11994107, 12828754, 15356430, 19477321, 22533231, 23524263, 23582566, 23654074, 24337738, 27476619, 28887839, 28958612, 29740850, 30183461, 31707051, 8082305, 8977528		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	31868801	Associate	★☆☆☆☆ Found in Text Mining only
Eczema, Infantile	Eczema	CTD_human_DG	18249437		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	31408438, 34439789, 35488725	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ehlers-Danlos Syndrome	Ehlers-Danlos Syndrome	BEFREE	28364485, 28728622		★☆☆☆☆ Found in Text Mining only
Elejalde Disease	Hereditary elliptocytosis	Pubtator	35455984	Associate	★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	29065892, 33936110	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	LHGDN	17441979		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	19465942, 21376661, 25081498, 26481639, 28250116, 28741149, 30045281, 30123051, 30261896, 31049785, 31279093, 31520510, 31764808, 8598391		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	26166120	Associate	★☆☆☆☆ Found in Text Mining only
Encephalocele	Encephalocele	Pubtator	20222111, 27807886	Associate	★☆☆☆☆ Found in Text Mining only
Encephalomyelitis Acute Disseminated	Acute disseminated encephalomyelitis	Pubtator	33597947	Stimulate	★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	10421411, 12934185, 30045281, 30089504, 30676776, 30936869		★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	19940521, 28082235		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	31453020		★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	CTD_human_DG	18458677		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	27193105		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	15904949, 24582558, 26130650, 29093604, 29684351, 30828987, 30922625, 31076514, 31189128, 31741758		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	15904949		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	15904949, 17953945, 19432902, 22944067, 27193105, 30828987, 31299894	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	16564564		★☆☆☆☆ Found in Text Mining only
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	28728622		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	20074813, 21640344		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	10685516, 11397854, 11532483, 12372470, 14734195, 15166129, 15831279, 16938116, 17953945, 18684450, 19271169, 20074813, 20160446, 20176595, 21762896, 22477338, 22641126, 24308758, 25035432, 27614631, 28074436, 28240436, 28412861, 28440564, 28779573, 28962161, 28992341, 29036448, 29040578, 29675846, 29871794, 29901577, 30096622, 30276219, 30367890, 30632819, 31504401, 8550748, 9239723		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	10685516, 10785230, 12372470, 12620489, 16759923, 17548071, 17953945, 21640344, 26872033, 27614631, 28300844, 28779573, 29771400, 30276219, 32432788, 34872261, 35303800, 36232341, 37095705, 39244839, 39458478, 9866071	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	16006475, 16564564, 16938116, 17207568, 17582674, 17953945		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	34360900, 34920657	Stimulate	★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	29388713, 31682933, 31831090		★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	Pubtator	33891982	Stimulate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	22606320, 23472217, 24194940, 24732104, 34418984	Stimulate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	26670709, 28658176, 33932136, 36371157	Associate	★☆☆☆☆ Found in Text Mining only
Enthesitis	Enthesitis	BEFREE	31200688		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	11536174, 25363529, 28919220, 30534125, 30865306, 31235509, 31627909		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	37052526	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	21211656, 36591238, 37967572	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	29895838, 30744559, 31160974		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	25968456, 28510691		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis Bullosa	BEFREE	26496255		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Epidermolysis Bullosa	BEFREE	26496255		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Dystrophic epidermolysis bullosa	Pubtator	37161592	Stimulate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex	Epidermolysis Bullosa Simplex	BEFREE	26496255		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex	Epidermolysis bullosa	Pubtator	34536484	Stimulate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	18834707, 21530175, 22578659, 24515998, 25366750, 27858966, 28649227, 29201182, 29273305, 31144434, 31722723		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	25366750, 31948324, 32219137, 35091307, 37946105	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	37946105	Associate	★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	12836160		★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	28632410, 7843589		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	15870936, 19401270, 22158046, 23889749, 26282935, 27825119, 28012060, 28848618, 30021477		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	11400141		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	28359407, 28413941, 31077775		★☆☆☆☆ Found in Text Mining only
Erectile Dysfunction	Erectile dysfunction	Pubtator	29233142	Stimulate	★☆☆☆☆ Found in Text Mining only
Erectile Dysfunction	Erectile dysfunction	Pubtator	39809170	Associate	★☆☆☆☆ Found in Text Mining only
Erythema Multiforme	Erythema	BEFREE	23506572		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10408408, 18482209, 18502691, 20056108, 21273582, 22847808, 23561329, 23564789, 27801498, 29976575, 30728854, 31845119		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	10408408, 23082063, 26761210, 27331408, 35071597, 35780460	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	18502691, 20056108, 21273582, 22847808, 23561329, 25238263, 25824337, 29976575, 30728854, 31845119		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25144454	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	10408408, 26761210, 30683902, 32524362, 32825936, 34520294, 35463992, 38619620	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Stenosis	Esophageal Stenosis	BEFREE	30587227		★☆☆☆☆ Found in Text Mining only
Esophageal Stricture	Esophageal Stricture	BEFREE	30587227		★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	17241868, 21451212, 30587227		★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	LHGDN	17241868		★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	30249899, 33941087	Stimulate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	11196657, 12214260, 18163209, 21468565, 21474330, 22924939, 28300071, 28837559, 29687969		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	22924939, 31772610	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	26617860	Stimulate	★☆☆☆☆ Found in Text Mining only
Ethylmalonic encephalopathy	Ethylmalonic Encephalopathy	BEFREE	31160974		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	26215971		★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	25275906		★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	BEFREE	29131274, 31356255		★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	CTD_human_DG	17621267		★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28925763		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	29947568, 30002400		★☆☆☆☆ Found in Text Mining only
Exudative retinopathy	Exudative retinopathy	BEFREE	27364629		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	18172744		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	LHGDN	18172744		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	34287477, 38304433	Stimulate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	26289409		★☆☆☆☆ Found in Text Mining only
Familial cold urticaria	Cold urticaria	BEFREE	17320940		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	21943235, 8899002		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	27193105, 30670657		★☆☆☆☆ Found in Text Mining only
Familial Osteochondritis Dissecans	Osteochondritis Dissecans	BEFREE	17610900		★☆☆☆☆ Found in Text Mining only
Familial primary pulmonary hypertension	Pulmonary Hypertension	BEFREE	22227206		★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	25003325, 32029443	Associate	★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	34445297	Stimulate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	1577464, 7552587, 8118026		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	8118026	Associate	★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	1577464, 7552587, 8118026		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP C	Fanconi Anemia	BEFREE	26999096		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	22973830, 25464926, 35570777, 9201656	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	25836975	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	16219169, 17823431, 26035386, 29228430, 30585337, 30705687, 31429848		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	25474087, 27730688, 36096296, 39766906	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	25474087	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	27730688, 31941930	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	18376369, 22658783, 27730688, 28063004, 28167322, 28264426, 28632778, 28852433, 29154469, 30668625, 31113580, 31291245		★☆☆☆☆ Found in Text Mining only
Fatty Liver, Alcoholic	Alcoholic Fatty Liver	BEFREE	19032584		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	LHGDN	16403955		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	20486195, 21376661, 22196489, 24515998, 24834995, 25611005, 26960986, 27815838, 27871023, 29428914, 29727742, 31574823, 31591845		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	26406414		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	18199986		★☆☆☆☆ Found in Text Mining only
Fibromuscular Dysplasia	Fibromuscular Dysplasia	BEFREE	30470640		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	15688424, 7708743		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	LHGDN	15688424		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	12830005, 21622209, 23092863, 25870985, 28167322, 28754776, 29129819, 30177688, 30346985, 30885249, 30935693, 31086599, 31269038, 31301646		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	12830005		★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	29162878	Stimulate	★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	15308875		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	23844163		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	20102735, 24942544		★☆☆☆☆ Found in Text Mining only
Fraser Syndrome	Fraser syndrome	Pubtator	8898173	Associate	★☆☆☆☆ Found in Text Mining only
FRONTOMETAPHYSEAL DYSPLASIA 1	Frontometaphyseal Dysplasia	BEFREE	30470640		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	36890594	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	21645364		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	18603066, 29787599	Associate	★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	32636303	Stimulate	★☆☆☆☆ Found in Text Mining only
Funisitis (disorder)	Funisitis	BEFREE	11431717, 17405871, 18971361, 29186106, 29892034, 30388714, 31693497		★☆☆☆☆ Found in Text Mining only
Galactosemias	Galactosemia	Pubtator	24398680	Stimulate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	18260730, 25573292, 27769047, 29410961, 29554539, 29723410, 30249899		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	30249899	Associate	★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	BEFREE	15273551		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	17560462, 23893709, 31010015		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	16036505, 9773925		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	16284733, 17724739, 30525242, 9773925		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	27196487	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	34008757, 38366919	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	32947843	Inhibit	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	34104107, 35905420, 39259113	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	30757999		★☆☆☆☆ Found in Text Mining only
Gastro-enteropancreatic neuroendocrine tumor	Digestive system neuroendocrine neoplasm	BEFREE	17950274		★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	30768387		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	19074641, 27055018, 34438042	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	27055018		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	29189428		★☆☆☆☆ Found in Text Mining only
Gastrointestinal inflammation	Gastrointestinal inflammation	BEFREE	28270854		★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	BEFREE	29501441		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	10400826, 25978039, 6693432	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	12897342, 14668030, 26312487		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	26486234	Stimulate	★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	17992659		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	12836160		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	BEFREE	28793299		★☆☆☆☆ Found in Text Mining only
Geographic Atrophy	Geographic Atrophy	BEFREE	18538409, 30644965		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	12051396, 12742994, 14679293, 15079760, 16265697, 16583473, 27927642, 28466804, 28479485, 28485026, 28841363, 28968895, 29414433, 29570475, 29611005, 29676602, 29946742, 30696642, 31025922, 31162032, 31531960, 31847038, 8181959		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	LHGDN	12742994, 16265697		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	24158630, 27927642, 29731755, 36912345, 37703805, 39817309, 8083354	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	31162032	Stimulate	★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	16024207		★☆☆☆☆ Found in Text Mining only
Gilbert Disease (disorder)	Gilbert Disease	BEFREE	26926838		★☆☆☆☆ Found in Text Mining only
Gingival Diseases	Gingival diseases	Pubtator	31743516	Associate	★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	17953695, 18446552, 28036117, 29896253, 31028890, 31701554, 7815373		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	19401404, 20467456, 26396484	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	26396484, 28171867, 28620279, 28975281, 29285128, 30210601, 31093481, 31330064		★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	25811482	Inhibit	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	26748993, 36254076	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	25811482, 29752408	Inhibit	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	26820987, 33216119	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	23161179		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10580807, 10845391, 11506489, 11517969, 11949822, 15688401, 17224923, 19809523, 20428809, 2208133, 23368093, 24244348, 24332177, 24472318, 25088200, 25382637, 25748242, 26143636, 26794430, 27181204, 27474433, 29422647, 29564746, 30250528, 30693511, 30824583, 30937892, 31059805, 31327593, 31396334, 31619962, 31791385, 9798907		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11506489, 17224923, 23368093, 24472318, 24474429, 25633526, 26143636, 31791385, 32213162, 32885530, 33652086, 34376733, 34713474, 35802478, 36142158, 38238463, 7856743, 8473012	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27163161	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10580807, 10845391, 11506489, 11517969, 11949822, 15688401, 17224923, 20428809, 2208133, 22986533, 23368093, 24244348, 24332177, 24390806, 24472318, 25088200, 25382637, 25748242, 26143636, 26794430, 27181204, 27474433, 28007636, 28243325, 29422647, 29564746, 30029001, 30049387, 30250528, 30693511, 30824583, 30937892, 31059805, 31269723, 31327593, 31396334, 31619962, 31791385, 9798907		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10845391, 11147905, 11517969, 11978730, 15064729, 15665100, 15688401, 17916900, 19658188, 20428809, 22159219, 22349830, 22434214, 23832741, 24078801, 25220188, 25311416, 25342742, 26267319, 26398661, 27903982, 28007636, 28191277, 28450947, 28502470, 28666100, 29118922, 29189936, 29234033, 29266974, 29460097, 30049387, 30662593, 31327593, 31599129, 31665421, 31733592		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	11506489, 9888463	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	11949822		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22752645, 23525947, 24175805, 24472318, 25342742, 25549333, 25966666, 27287871, 27613828, 27861797, 27903982, 29258522, 33174046, 33371165, 34713474, 35265072, 35302191, 37452092, 39364412, 7856743	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	27217154		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	1728989, 2127356, 28147348, 30808838		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	LHGDN	17656329		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	Pubtator	27225718	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	Pubtator	30808838, 33043579	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	CTD_human_DG	9403216		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis IGA	Iga nephropathy	Pubtator	18496506, 24398680, 30029622, 8301931, 8565271	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	20484297, 27044423, 39516745, 8268396, 8943482	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	20954977	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis, Membranoproliferative	Glomerulonephritis	BEFREE	30642741, 31316523		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	15047630		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	29269321, 31059804		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	27404493, 28765149		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	25227842	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	BEFREE	19032817		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	11520812, 20565368, 29142307, 34120222	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	20446793, 23792271	Stimulate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	11520812, 15449032, 26872287, 28077684, 28257800, 28642760, 28724796, 29263228, 30393022, 31051404, 31195139, 31578204, 31632401, 7652763, 7787751, 8136279, 8496391		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	LHGDN	18976446		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	10364903	Stimulate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	29850964		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	35039330	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	15497456, 16002736, 16313297, 16372246, 17208210, 21235536, 22438231, 23638863, 24086448, 24956560, 25226272, 28450957, 29752312, 31328557		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	21209948, 21235536, 24086448, 25226272, 2680182, 29752312, 31552761, 9222097	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	23092922	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	15497456, 19117935, 20017620, 21209948, 22736938, 23092922, 24086448, 25159204, 25198673, 28278511, 33542676, 34383782	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33498689	Stimulate	★☆☆☆☆ Found in Text Mining only
Greig cephalopolysyndactyly syndrome	Greig Cephalopolysyndactyly Syndrome	BEFREE	1981052		★☆☆☆☆ Found in Text Mining only
Growth Hormone-Secreting Pituitary Adenoma	Somatotroph Adenoma	LHGDN	14585094		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	28147379, 31379477		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	28147379		★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	11755467, 2258703, 7985490, 8840984		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	11196713, 30305562		★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	26858125		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	1572693, 16372246, 17115419, 18692934, 20153771, 21235536, 22366404, 23280318, 24703107, 26204395		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hashimoto Disease	Hashimoto Disease	LHGDN	16372246		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hashimoto Disease	Hashimoto disease	Pubtator	17115419, 21235536, 25127106, 31552761, 32662826, 33578562, 33943012	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hashimoto Disease	Hashimoto disease	Pubtator	25412700	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hay-Wells syndrome	Hay-Wells syndrome	BEFREE	30927408		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	17310346, 20682658, 21708999, 21845339, 23548270, 23948049, 28559019, 29082496, 29463991, 30642292, 31055110, 31478236		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	BEFREE	21104991, 21976712, 29082496		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	21104991, 21559372, 21845339, 30642292	Associate	★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	33559789, 7537110	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hearing Loss Sensorineural	Hearing loss	Pubtator	29695657	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	32519679	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	11985915, 30804931, 31379862, 31632400, 32221364, 32988848, 34365798, 35022042, 39719586	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	LHGDN	17851087, 18274638		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	20022263, 27104679	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	21771897, 28889349		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11082413, 11380590, 11568062, 11985915, 12411982, 15867183, 18246092, 21494108, 21503626, 25498756, 26228789, 26864064, 28440487, 28515118, 28542263, 28684396, 28763371, 29066436, 29093735, 29437117, 29663512, 30259192, 30273582, 30312930, 30387679, 30651573, 30747396, 31087601, 31105751, 31275366, 31297975, 31379862, 31505423, 31749886, 31778438		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	11511426, 11985915, 14607202, 18353715, 20019408, 22790687, 26705751, 26864064, 30941129, 31379862, 31632400, 32154187, 32515246, 34456907, 34931349, 35570197, 35967380, 36303443, 37018396, 37260062, 37304261, 37939897, 37968611, 38573265	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	15135663, 16360360		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	22615818, 23143795, 24074138, 26771970, 30968846, 34744513	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure Systolic	Heart failure	Pubtator	36303443	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Failure, Diastolic	Heart Failure	BEFREE	21263314, 28827564		★☆☆☆☆ Found in Text Mining only
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	15135663, 16360360		★☆☆☆☆ Found in Text Mining only
Heart Injuries	Cardiac injury	Pubtator	32633594	Associate	★☆☆☆☆ Found in Text Mining only
Heart Neoplasm	Cardiac Neoplasms	BEFREE	8877729		★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	19169931	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	30804931	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	30146616, 30342949		★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	20872175	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	11432624, 20583924, 33958640, 37970725	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	24059848, 28234665, 28823228, 29296722, 30671025, 31428097		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	39394593	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	30987689		★☆☆☆☆ Found in Text Mining only
Hematoma	Hematoma	Pubtator	28282868, 37038178	Associate	★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	26927669		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	21183736		★☆☆☆☆ Found in Text Mining only
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	21183736		★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	25174507, 31924826	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	33641611	Inhibit	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	9767525	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	CTD_human_DG	15384034		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	19967138, 29248444, 29905409		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemophilia A	Hemophilia	BEFREE	30300903		★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	30300903		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	32124729	Stimulate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	17428355, 28168662, 29129626, 31684904		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	21940902, 31038755	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	26757951	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	27655254, 30920976, 31058776, 31170723, 31583743		★☆☆☆☆ Found in Text Mining only
Hepatic Form of Wilson Disease	Hepatolenticular degeneration	CTD_human_DG	25002079		★☆☆☆☆ Found in Text Mining only
Hepatic methionine adenosyltransferase deficiency	Hepatic Methionine Adenosyltransferase Deficiency	BEFREE	31307051		★☆☆☆☆ Found in Text Mining only
Hepatic Veno Occlusive Disease	Hepatic veno occlusive disease	Pubtator	21330458	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Veno-Occlusive Disease	Hepatic veno-occlusive disease-immunodeficiency syndrome	BEFREE	8136279		★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	25731872	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	21526159, 27183637, 30600293, 31422415	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	12100148, 25899133	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B	Hepatitis b	Pubtator	12970895, 19374779, 24371367, 27268603, 32532356, 33506937, 37995395, 7545429	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B Chronic	Hepatitis b	Pubtator	19374779, 35801423	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	20483710, 32532356	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C Chronic	Hepatitis c	Pubtator	32532356, 35469194	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	1597519	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	1323058, 21488946, 23144154, 7657294, 7765354, 8096510, 8391424, 9360537		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	8987679	Associate	★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	20357450		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	20942594, 22139496		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatolenticular Degeneration	Hepatolenticular Degeneration	CTD_human_DG	25002079		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	40214068	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	15005841	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	33331925, 33462316	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	23593346		★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	12710748, 29193068, 30066918, 31165327		★☆☆☆☆ Found in Text Mining only
Hereditary hemorrhagic telangiectasia	Hereditary Hemorrhagic Telangiectasia	BEFREE	22391335		★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	29040306		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	35469194	Associate	★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	28769536, 30484907		★☆☆☆☆ Found in Text Mining only
High altitude pulmonary edema	High Altitude Pulmonary Edema	BEFREE	30074683		★☆☆☆☆ Found in Text Mining only
Histiocytoma, Angiomatoid Fibrous	Histiocytoma	BEFREE	26165403, 29932283		★☆☆☆☆ Found in Text Mining only
Histiocytosis	Histiocytosis	BEFREE	30973282		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10477738, 1296932, 1358770, 1493429, 15070705, 15686457, 15772702, 16760905, 1710152, 17496310, 19391137, 19573080, 23019398, 24059848, 27767372, 28044237, 28567066, 29151180, 29727764, 30830568, 8217820, 8630409, 9349232		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	11468177, 12100148, 15070705, 15686457, 1632458, 1710152, 17496310, 1951632, 19573080, 20406921, 20963937, 24141626, 28791394, 33720338, 7545429, 8630409	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	15070705, 17496310		★☆☆☆☆ Found in Text Mining only
HOYERAAL-HREIDARSSON SYNDROME	Hoyeraal-Hreidarsson Syndrome	BEFREE	30867640		★☆☆☆☆ Found in Text Mining only
Humoral hypercalcemia of malignancy (disorder)	Humoral Hypercalcemia Of Malignancy	BEFREE	21343371		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	16760905, 23019398, 27767372, 28044237, 28533375, 28567066, 29151180, 29727764, 30513753, 31076648		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington disease	Pubtator	17132891, 27681197	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington disease	Pubtator	27170315, 29944162, 34802797	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyalinosis, Systemic	Hyalinosis	BEFREE	30612530, 30684712		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	28716226, 29194369, 29363904, 30268545		★☆☆☆☆ Found in Text Mining only
Hyper-Immunoglobulin E Syndrome, Autosomal Dominant	STAT3 Deficiency	BEFREE	21937456		★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	33316770, 39252231	Associate	★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	11889177, 12917504, 15080783		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	LHGDN	11889177		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	12917504	Associate	★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	Pubtator	11432624	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	CTD_human_DG	10638776		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercalcemia	Hypercalcemia	Pubtator	10843457, 2212010, 9618523	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercalcemia	Hypercalcemia	BEFREE	20050882, 26597827, 9112382, 9674742		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia	Hypercholesterolemia	BEFREE	14644408, 17016617, 19140875, 23436135, 28472244, 28915536, 29081697, 29713239, 29873573, 29896426, 29997625, 30900815		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	25993353	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	10634824		★☆☆☆☆ Found in Text Mining only
Hypereosinophilia	Hypereosinophilia	BEFREE	1493476		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	7683928	Associate	★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	BEFREE	1376041, 28168662		★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	Pubtator	1985116	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	15616014, 16518702, 20080841, 20145925, 23135962, 23142265, 27842906, 28881473, 28939513, 29309791, 29335597, 29625124, 29851525, 30314265, 30502681, 31073533, 31091214, 31165005, 31185481, 31421247, 31616304		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	LHGDN	15616014, 18211631		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	Pubtator	23484124, 33328159	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	Pubtator	27001002, 27294162, 34203452	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	CTD_human_DG	29035695		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	22912384, 23107763, 31146011		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	10868978, 12646246, 15319170, 17952840, 19685554, 21295959, 24051035, 27777170, 28429777, 28449870, 28651075, 28844956, 28852804, 31014098, 31386565		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	Pubtator	14532168, 23484124	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperkeratosis	Hyperkeratosis	BEFREE	30634461		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	11983287, 28970282, 29372034, 29857297, 30666855, 30950217, 31108552, 31818196		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia Familial Combined	Hyperlipidemia	Pubtator	12032168	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	12032168, 25176936		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	18420533, 39433142	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	16083882	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	10634824		★☆☆☆☆ Found in Text Mining only
Hyperoxaluria	Hyperoxaluria	CTD_human_DG	16284884		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperoxia	Hyperoxia	Pubtator	10070569, 10666108	Associate	★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	31411059	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	BEFREE	15030526, 9441573		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	10499526, 21917472		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	CTD_human_DG	21350317		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperphosphatemia (disorder)	Hyperphosphatemia	BEFREE	31376399		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	21781173, 28851954	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	27342408	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperprolactinemia	BEFREE	30887277		★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	1458689, 20417488, 34789453	Associate	★☆☆☆☆ Found in Text Mining only
Hypersomnia	Hypersomnia	BEFREE	30384138		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	12846758, 17994165, 19330901, 22272811, 24782217, 25815341, 27399105, 28033321, 28716248, 28827564, 30957546, 31772610, 33652665, 36157437, 39433142, 8943482	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	21558084, 26391130, 26502942, 27765883, 39595551	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	19390056, 31141166, 35186226	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	37985458	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11196657, 11983287, 12214260, 12647840, 12846758, 15831362, 16323614, 17508011, 18163209, 19106168, 19339995, 19349390, 20383745, 20715974, 21833041, 22068875, 22385075, 22713485, 23815102, 24486505, 24947882, 26765421, 27535123, 27986660, 28163257, 28192516, 28424078, 28716248, 28915536, 28935667, 29079193, 29081697, 29087023, 29107003, 29120957, 29170528, 29186034, 29198994, 29351002, 29399101, 29687969, 29723248, 29767573, 29800237, 29873573, 30012869, 30065083, 30072126, 30186428, 30260038, 30344654, 30610955, 30631031, 30700522, 30739537, 30957546, 31042407, 31504461, 31646585, 31719823, 31772610, 31800000, 31823500		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	15831362, 18163209		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	27292124, 27659729, 27847271		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	BEFREE	24086448, 29131274		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	Pubtator	24086448	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	Pubtator	29131274, 9222097	Associate	★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	38290570	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	29436483	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	32100476	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	12846758, 29068603	Associate	★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	15172469, 15200452, 25276832, 28185531, 29232321, 29518608, 29936636, 30544373		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	25276832	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	CTD_human_DG	15044820		★☆☆☆☆ Found in Text Mining only
Hypoalphalipoproteinemias	Hypoalphalipoproteinemia	Pubtator	38290570	Associate	★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	11278795, 31119639		★☆☆☆☆ Found in Text Mining only
Hypocupremia	Hypocupremia	BEFREE	28118841		★☆☆☆☆ Found in Text Mining only
Hypofibrinogenemia	Hypofibrinogenemia	BEFREE	31681719		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	17994165	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	LHGDN	18332163		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	23110240		★☆☆☆☆ Found in Text Mining only
Hypoplastic enamel-onycholysis-hypohidrosis syndrome	Hypoplastic Enamel-Onycholysis-Hypohidrosis Syndrome	BEFREE	28754973		★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	16690359, 22080961	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothyroidism	Hypothyroidism	BEFREE	29436670, 29579409, 31350776		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	31350776	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	31560937	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypotrichosis	Hypotrichosis	Pubtator	37759728	Stimulate	★☆☆☆☆ Found in Text Mining only
HYPOTRICHOSIS 1	Hypotrichosis	BEFREE	30867640		★☆☆☆☆ Found in Text Mining only
Hypotrichosis simplex	Hypotrichosis simplex	BEFREE	29141687		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	11342455, 17568185, 17609976, 20197421, 21409457, 21887369, 22178238, 22303451, 24659848, 24933425, 25881039, 27163161, 27408996, 27858190, 28349784, 28677369, 28975966, 30355438, 31746371, 33389556, 34240756, 34367731, 35405674, 35409364, 36824025, 37071849, 37735391, 37759548, 8901607	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	1373333, 15847702, 18060036, 18693004, 18986700, 20653473, 23401697, 26001777, 26045772, 31935962, 32028672, 33484391, 34398242, 36814597, 37753073	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23272057	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia-Ischemia, Brain	Ischemic Encephalopathy	LHGDN	16181755		★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	29933753, 30089504		★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Junctional epidermolysis bullosa	Pubtator	30622656	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis Vulgaris	Ichthyosis vulgaris	Pubtator	37960775	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	28851899		★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	15005726		★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	27936488, 28536758		★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	20954977		★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	29190601, 7705373		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	17322283, 23400395, 25003325, 25941359, 26248159, 27884398, 28229900, 28473439, 28597756, 28704260, 28893516, 28956500, 29078260, 29528272, 29617176, 29629897, 29629898, 30586714, 30856466, 31191356, 31341036		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	11371414, 15030461, 16573560, 19117745, 22429962, 23526221, 23759512, 26867691, 27317687, 28115235, 28139758, 28178340, 28283478, 28415591, 28847533, 31611754		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	12819039		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	12819039, 23815594, 28139758, 30619270, 32210969, 33746960, 34873957, 34948231, 39229261	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	25003325, 28229900		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	10867534, 12200114, 18300111, 21828345, 28349446, 28969604, 29069743, 29844269, 31670996, 31748116, 7870340, 8301931, 8468929, 8943482		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	18300111		★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	CTD_human_DG	10700533, 21829567		★☆☆☆☆ Found in Text Mining only
Ileus	Ileus	BEFREE	27283365		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	20395418, 29685293, 30374077		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	20722464, 23950992	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	25022969, 35587532	Stimulate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	LHGDN	12468916		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	15755291, 22111667, 25561904, 27007229, 29971001		★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	BEFREE	16386644, 18486766		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	27926762, 28199691, 30118537, 8189054, 9414293		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	12767492, 15193763, 15851726, 15972602, 17430245, 17913303, 22154514, 23414490, 24997674, 25214388, 26291404, 26517210, 27701469, 27861706, 28122624, 28338340, 28416092, 28526765, 28561205, 28794151, 29090685, 29141125, 29163240, 29325450, 29358917, 29452810, 29562248, 29641605, 29867440, 29876882, 29896269, 30167784, 30586550, 31304907, 31402961, 31441374, 31555121		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	11706091		★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	11494166, 18191407, 28485322, 28877383		★☆☆☆☆ Found in Text Mining only
Indolent Systemic Mastocytosis	Indolent Systemic Mastocytosis	BEFREE	26153655		★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	20872175		★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	12374626, 21940958, 25257527		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	10685516, 15831279, 18828896, 29771400	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Female	Female infertility	Pubtator	37382258	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	19164426, 28146368, 29199855, 30046817		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10397166, 10530495, 11040178, 11196713, 11204808, 11713964, 12297725, 12792220, 15842590, 1587185, 18069684, 18535667, 19578817, 19725895, 19936899, 20458762, 21145125, 21305677, 22962574, 23211301, 23472658, 24120915, 24430732, 24651526, 24662057, 26668517, 27271497, 27417569, 27508514, 27980357, 28088612, 28452812, 28642760, 29149926, 29275959, 29441874, 29558031, 29625582, 29680209, 29684360, 29748708, 29775600, 30200658, 30770344, 31173202, 31519285, 31567972, 31679013, 7841354, 9468102		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	12171960, 18069684, 26497217, 29275959, 31814801, 32020185, 32390702, 36466854, 37306210, 38085149, 39970364, 9099934	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	27980357, 39487408	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	22027148		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	22966985, 23524263, 27942589, 28212864, 28912118, 31158415, 9820543		★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	10908158, 11342774		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	11287357, 12032168, 12736161, 15180970, 15319170, 15919832, 16926159, 16988089, 17993646, 24397394, 27111539, 27342408, 27903298, 29258102, 30635365, 32651353, 34872092	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	11342531, 17551966, 17993646, 29955086	Stimulate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	18834707, 19147624, 21530175, 25124963		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	25124963	Associate	★☆☆☆☆ Found in Text Mining only
Intermittent Claudication	Claudication	Pubtator	19775917	Associate	★☆☆☆☆ Found in Text Mining only
Internal Carotid Artery Stenosis	Internal Carotid Artery Stenosis	BEFREE	28623743, 29091301		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	LHGDN	17982709		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	24704835, 8051739		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	21178846, 22107760, 23537453, 27807886, 28551829, 28810568, 28810608, 29115481, 30511395, 30511959		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	22107760	Stimulate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	22107760, 26587789, 27807886, 28586059, 30511959, 31056946, 33166496, 33764282, 34191345, 35578687, 35964023, 36814575	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	23014739, 26774625, 31056946, 36293070	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	30248387	Inhibit	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	15733644, 18321738, 30273227, 30945295		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Displacement	Intervertebral disc displacement	Pubtator	23014739, 30511959	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disk Displacement	Intervertebral Disk Displacement	BEFREE	21178846		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	24447345		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	27980357	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	27449092, 29472497		★☆☆☆☆ Found in Text Mining only
Intestinal Obstruction	Intestinal Obstruction	BEFREE	29254317		★☆☆☆☆ Found in Text Mining only
Intestinal Obstruction	Intestinal obstruction	Pubtator	35528155	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Obstruction	Intestinal Obstruction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intestinal Perforation	Intestinal Perforation	BEFREE	25478789		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	16648144, 18487018, 19780647, 21497830, 22686131, 23993981, 26198819, 30808715		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	16648144, 35711443, 36451838, 37041519	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intracranial Arteriovenous Malformation	Intracranial Arteriovenous Malformation	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intracranial Arteriovenous Malformation, Ruptured	Intracranial Arteriovenous Malformation	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	16820800, 18841030	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intracranial Hemorrhages	Intracranial hemorrhage	Pubtator	29932521	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	CTD_human_DG	17621267		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29675965, 30001540, 31298745		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	24489901	Stimulate	★☆☆☆☆ Found in Text Mining only
Intravascular hemolysis	Intravascular Hemolysis	BEFREE	31099890		★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	BEFREE	30630976		★☆☆☆☆ Found in Text Mining only
Iron Metabolism Disorders	Iron metabolism disorder	Pubtator	37970725	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	28300826, 29656314, 31171361, 31316498, 31472185		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	40635108	Stimulate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	18684212	Inhibit	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	19725895, 19844779, 21752155, 21870243, 26841770, 27272011, 28886490, 30544474, 31172560, 31366385, 31576093, 31615448		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	21752155, 28191693	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	38067150	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	16518702		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	11737243, 12637697, 12843357, 14512079, 15758588, 16323614, 17916761, 19919828, 21536090, 22410655, 22417897, 22773460, 24486505, 24782217, 25325233, 25333814, 25659766, 26535620, 26722564, 26883819, 27049557, 27525901, 27840402, 28079628, 28357403, 28716248, 28724745, 29567761, 30484473, 30878372, 31141256, 31215220, 31438723, 31446341, 31836512		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	33458871, 34921461, 34970793, 35441431, 35503943, 35673992, 37338050	Associate	★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	12836160		★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	31589938		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	11024553, 11469477, 11520812, 12195624, 14613283, 15815691, 18473869, 21205466, 22205208, 24585880, 25936296, 26251193, 26305060, 26934060, 27646136, 28528519, 29250517, 30008613, 30119133, 30686091		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	LHGDN	18843772		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Juvenile polyposis syndrome	Polyposis Syndrome	BEFREE	22568934, 29927991		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10073709, 10196314, 10361100, 10364379, 10628804, 10662620, 10738139, 10779772, 10861641, 11001912, 11172301, 11264189, 11274637, 11380243, 12134031, 12176919, 12513914, 12776188, 14672670, 15154666, 1643291, 17483315, 19955303, 21767154, 21984125, 23479571, 24198402, 26675551, 27166260, 29381560, 30204240, 30265712, 30541844, 31801855, 8283061, 8939871		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kaposi Sarcoma	Kaposi Sarcoma	LHGDN	12176919		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kaposi Sarcoma	Kaposi Sarcoma	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	24037056, 29948913		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	22503230, 25741769, 28330899, 31131227		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratitis	Keratitis	Pubtator	25741769	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	BEFREE	29204439		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	22413749, 29021606	Stimulate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	25593510, 28393195, 28702675, 30245588		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	25593510, 27207902, 30245588, 33443628, 36051483	Associate	★☆☆☆☆ Found in Text Mining only
Keratosis Follicularis	Keratosis Follicularis	BEFREE	15888147, 31682908		★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	1337292, 15920698, 1951632		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	16014026		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	18496509, 28827564, 31408438, 35488725, 37273451, 8943482	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	18547996		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	19542902, 19955044, 23472199, 26421528, 27500547, 28484449, 28827564, 29605608, 29770444, 7870340, 7991018		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	23582441, 34359843	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases Cystic	Kidney disease	Pubtator	31778601	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	21388350, 30826567, 31797504, 8840280		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	10843245, 16760905, 18496509, 19684120, 23019398, 23472199, 23593165, 24755610, 34285273, 35205271, 37439962, 7520955, 8565312	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	24471420, 34602548	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	31875015	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	12215823, 15627170, 21495874, 21671855, 23566289, 28214022, 28266021, 28688148, 29351922, 29366580, 29805315, 29861060, 30077612, 30552306, 30672838, 30700847, 30721632, 30823904, 30973904, 31045897, 31164200, 31325317, 31369593, 31440860, 31487315, 31512003, 31623576, 31650729		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	21570986		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	10843245, 12846758, 16076356, 16760905, 17203290, 17656329, 20144192, 20380647, 20551628, 23019398, 26421528, 26463449, 28036114, 28164733, 28487598, 28765904, 29170076, 30755161, 8278382		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	LHGDN	15086488, 17203290		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	19539174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	11849447, 17346426, 26500094, 28328292, 38002360, 38148073	Associate	★☆☆☆☆ Found in Text Mining only
Large cell carcinoma of lung	Lung Carcinoma	BEFREE	29294439		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	21845339	Associate	★☆☆☆☆ Found in Text Mining only
Laryngomalacia	Laryngomalacia	BEFREE	30972761		★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Autoimmune Diabetes	BEFREE	15622443		★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Latent autoimmune diabetes in adults	Pubtator	28573146	Associate	★☆☆☆☆ Found in Text Mining only
LAURIN-SANDROW SYNDROME	Laurin-Sandrow syndrome	BEFREE	29602073		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	11113012, 12846758, 21468565		★☆☆☆☆ Found in Text Mining only
Left ventricular systolic dysfunction	Ventricular Systolic Dysfunction	BEFREE	21811191, 31739518		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	15135663, 16360360		★☆☆☆☆ Found in Text Mining only
Legg-Calve-Perthes Disease	Legg-Calve-Perthes Disease	BEFREE	30125727		★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh syndrome	Pubtator	35103930	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	34256950	Inhibit	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	36771423	Associate	★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	Leopard syndrome	Pubtator	31112872	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	19058987, 21917900, 22459738, 24189521, 24578538, 28511777		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	20640364, 23350010, 24578538, 28715406, 33819170	Associate	★☆☆☆☆ Found in Text Mining only
LEPTIN RECEPTOR DEFICIENCY	LEPTIN RECEPTOR DEFICIENCY	BEFREE	25098764		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10632674, 11380590, 12138373, 12799551, 18042242, 18424427, 20823291, 21854541, 21875833, 22762939, 23268184, 2331674, 29593668, 30263091, 31578204, 31624329, 9126708		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15152368		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	1699919, 1700730, 1712640, 32855274, 7919380, 7949164, 7949177, 9092685	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	3054878	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	2258703, 8227350	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Lymphoid leukemia	Pubtator	38415531	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	1932751, 8632998	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10586114, 10845908, 11264180, 1613267, 1698479, 1699919, 1712640, 23616009, 25261668, 26468600, 27577048, 3042049, 31322275, 31373163, 32995942, 33324412, 34459452, 36418348, 37272257, 39342176, 7541672, 7919380, 8805932	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	14578205	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	28084439	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	26076658, 2676012, 30026572, 31648319	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	10622210, 8193361	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	29040306		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10025979, 10348148, 11860452, 1434798, 15978940, 16107886, 1714404, 1918169, 1961022, 2207323, 2478222, 25261668, 26473447, 27486989, 2788173, 28084439, 28488049, 29296780, 30181021, 7596169, 7837815, 7919380, 7967742, 8095566, 8255093, 8319777, 8641372, 8892684, 8907269, 9692816, 9714910		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12031914, 16107886		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	7949164		★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy	Leukoencephalopathy	BEFREE	29150375		★☆☆☆☆ Found in Text Mining only
Leukomalacia Periventricular	Periventricular leukomalacia	Pubtator	24903966, 30517142	Associate	★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	BEFREE	19147624, 20237486, 29440661, 30400375, 30517142		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	10687147, 16820919, 28911066, 29482351		★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	25560781		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	15619128		★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	18158872		★☆☆☆☆ Found in Text Mining only
Lichenoid Eruptions	Lichenoid Eruptions	CTD_human_DG	18393961		★☆☆☆☆ Found in Text Mining only
Linear Scleroderma	Linear Scleroderma	BEFREE	31096996		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	11064354, 17177164, 21771210, 22050374, 24625449, 25560781, 28397778, 28454394, 29096753		★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	25712450, 28776758		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	18427208		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	28668397		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	21790860		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10076051, 10397166, 10445852, 10486281, 11405230, 11444852, 11931340, 12456503, 12754410, 12927756, 1321738, 1321818, 1328443, 1334115, 1384466, 15910501, 16054696, 16425355, 16595893, 16831601, 17261774, 17464423, 17956865, 17993646, 18263735, 1846631, 19054267, 19126646, 19137011, 19374779, 19940521, 20332458, 20937539, 21298325, 21329460, 2160579, 2163835, 2172789, 22171994, 22318941, 22471481, 22611157, 22998440, 23011405, 23089469, 23144154, 2320005, 23213087, 23221382, 23350952, 23674845, 23684136, 23728999, 23763486, 24318992, 24332041, 24440854, 24530755, 2457587, 24668548, 2470740, 24751829, 24833103, 24841049, 24910242, 25087183, 25088994, 25173978, 25564572, 25608525, 25645622, 25892518, 26452542, 26457732, 26525581, 26879559, 26933995, 27213590, 27268603, 27311882, 27368337, 27477312, 27557564, 27585737, 27589954, 27593937, 27770462, 27894955, 28004112, 28054958, 28063004, 28109867, 28166197, 28178643, 28254435, 28340949, 28393222, 28501131, 28508871, 28584306, 28625979, 28628795, 28646470, 28659496, 28677802, 28716525, 28981732, 29073625, 29100435, 29211023, 29227538, 29344257, 29393468, 29410961, 29432845, 29483096, 29486150, 29511600, 29556041, 29563753, 29574282, 29894725, 29904948, 29938458, 29957468, 29976395, 29991878, 30015355, 30034633, 30116311, 30154433, 30214606, 30340922, 30377567, 30482241, 30546452, 30564864, 30648776, 30800209, 30809789, 30866863, 30918019, 31044528, 31065105, 31118769, 31152021, 31249138, 3133443, 31387809, 31409352, 31575546, 31606594, 31614930, 31646099, 31683891, 31771617, 31818192, 7519723, 7545121, 7578977, 7680115, 7964514, 8034668, 8210716, 8703909, 8938575, 9269767, 9676846, 9722935, 9755236		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	17615358, 20818158, 26297436, 27022031		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18522933		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	12754410, 12927756, 19054267, 19940521, 21329460, 23350952, 24751829, 24841049, 26725065, 27730688, 28401002, 28614777, 28665498, 31086599, 31368578, 31583743, 8076766, 9676846		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	12830005		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	39766906	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	12077104, 31867004	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	14730602, 15884119, 19604266, 34367180, 38228248	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	1772964	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	1397888, 29272979, 7876633		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	CTD_human_DG	23274713		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases	Liver disease	Pubtator	1772964	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	19438606, 24905921, 39766906	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	12547716	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	38146363	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	23582441, 33356606	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	24366287, 29174983, 30206980, 30214381		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	28876364, 31534132, 33991637, 35529862, 37175814	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	12970895	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	1772964	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	18957043, 26481639, 28689811, 29191769, 29991758, 30867056, 31030090, 31061003, 31409825		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10397166, 10445852, 11405230, 11444852, 11931340, 1321738, 1321818, 1328443, 1334115, 1384466, 16054696, 1846631, 20937539, 21298325, 2160579, 2163835, 2172789, 22471481, 22611157, 22998440, 2320005, 2457587, 2470740, 25892518, 26457732, 26725321, 29266245, 3133443, 31606594, 31614930, 7519723, 7545121, 7578977, 7680115, 7964514, 8034668, 8210716, 8703909, 8938575, 9269767, 9722935, 9755236		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	12940515		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	24912675, 32924606	Associate	★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	26301107	Stimulate	★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	BEFREE	16911288		★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	28171867		★☆☆☆☆ Found in Text Mining only
Luft Disease	Luft Disease	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Lumbar disc disease	Lumbar Disc Disease	BEFREE	29179499		★☆☆☆☆ Found in Text Mining only
Lumbar scoliosis	Lumbar scoliosis	BEFREE	28378072		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	10843457, 17078813, 17490702, 20438838, 25289758, 33390771, 34246246, 34789453, 36480571, 36852851, 37052526, 37653422	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	19748599, 23136556, 28415591, 29174965, 29233668, 29703138, 31562126, 9378980		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	23582441, 24696530, 30249899	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	23743311	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	23592411, 32271462, 32602227, 32691471, 33080140, 33446609	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	33298584	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Obstructive	Lung disease	Pubtator	29319364	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	20089076, 30051925		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	11504947, 15894558, 16276011, 21048114, 21122157, 21881374, 23052692, 24420154, 24907005, 24988892, 25461668, 25514196, 26372664, 26484608, 26486080, 26517240, 26572130, 26739332, 28427199, 28617549, 28878242, 29869537, 30249899, 30604632, 31366794, 31412593, 31507089, 32233518, 32963220, 33545757, 34967707, 36140747, 36211008, 37901456, 38103126, 8144399, 9353425	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	15048152, 19124500, 27095254, 30953795, 31196220, 31552680	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	15570310, 16276011, 16278387, 17654453, 18676738		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	16344268, 20578176, 20713723, 24260500, 27090786, 27197187, 28878242		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	26372664		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus anticoagulant disorder	Lupus anticoagulant	BEFREE	29675623		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	19380809, 21153673, 23140401, 24865418, 26568585, 27416847, 27646883, 28286780, 28303221, 30268079		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11342672, 1563109, 17082661, 17608810, 19199277, 19380809, 19448905, 20334681, 20434119, 20954190, 24106699, 24829414, 25109676, 25345743, 26516833, 26930567, 27110576, 27225718, 27412348, 28286780, 28288675, 29545790, 30340504, 30466076, 30894863, 31886314, 32602296, 33037080, 33549023, 33576004, 33584722, 33871355, 34940981, 36741410, 38003490, 8879455	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	12480667, 15751081, 19448905, 24083390, 24288552, 24433387, 25548434, 26457008, 26583155, 26790609, 27852285, 27914596, 28320468, 29271478, 29563616, 31007604, 31871930, 32868411, 35972968, 36506019, 36740569, 37343193, 39818255, 9003407	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19644848, 9010506	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Cutaneous	Lupus Erythematosus	BEFREE	27646883		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	19380809, 21153673, 23140401, 24865418, 26568585, 27416847, 27646883, 28286780, 28303221, 30268079		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10219249, 10525320, 11196716, 11197305, 11312376, 11422212, 11754993, 15449022, 17082661, 17115422, 17537388, 17608810, 18764842, 19380809, 19448905, 19955044, 20110525, 20383729, 2051017, 20618924, 20843912, 20954190, 21153673, 21700657, 21968701, 2197219, 22004976, 22734797, 22961070, 23139385, 23140401, 23770252, 24013670, 24106699, 24117194, 24574329, 24865418, 25109676, 25151985, 25652333, 25794663, 26038346, 26078984, 26209923, 26457008, 26568585, 26769434, 27416847, 27531690, 27646883, 27672124, 27687026, 27696782, 27863333, 28118202, 28169339, 28234905, 28286780, 28303221, 28530463, 28649995, 28899868, 29192160, 29208022, 29397904, 29422675, 29462939, 29563616, 30058241, 30148445, 30268079, 30340504, 30466076, 30551949, 30894863, 30943147, 30979715, 31110478, 31399013, 31842967, 8879455		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	18158872		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	19029276		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	11422212, 12875719, 16192422, 18771958, 19955044, 27780843, 28216896, 29480020, 30541881, 8468929, 9607638		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	27716443, 30594048, 31685786	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	27738386	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	19380809, 21153673, 23140401, 24865418, 26568585, 27416847, 27646883, 28286780, 28303221, 30268079		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17094421, 28791816	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17189976, 28348483, 32329850, 32705271, 34165442	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	21710490, 31154151		★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	27366905	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	1954380, 34461635, 35510179	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	21325597	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	28222313, 28869447, 31400073		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	LHGDN	11960393		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10196314, 11426493, 15691277, 22016619, 26987877, 27430206, 2787680, 29523105, 30047815, 3052631, 3054878, 31601188, 33009434, 33578562, 35432366, 37975847	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10210773, 11805288, 11863223, 1320956, 1493476, 1498262, 16741895, 17363561, 17373716, 19509224, 20176801, 2331674, 26612425, 28157416, 29135797, 30149240, 7584673, 8124214, 8217820, 8750057, 9815659		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	12038454		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20963937	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	15070705, 24836297	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	16449530, 22113576, 22820139, 24913351, 25564959, 28140696		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	16690518, 18190463		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	24913351, 28140696		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	11807001, 15507390		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	LHGDN	15507390		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	28431111		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	10774463, 11895764, 16061391, 20644113, 27813533, 28241173, 28823228, 30314457, 7949151, 9172802, 9442386		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	20644113, 2258703, 28241173, 7595192	Associate	★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	17140157		★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	25455270, 26251193, 27296321, 27846755, 28499329, 28807602, 30877950		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	18538409, 24036938, 26330749, 29348424, 33510953, 34445430, 39959181	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	23946637, 39959178	Stimulate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	34202702	Inhibit	★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	11895764, 12134031, 14578560, 16984619, 18319288, 20644113, 21245574, 22490805, 24491093, 25243371, 25528859, 26597827, 28140696, 28676350, 29157617, 29684500, 30314457, 30541844, 30632181, 31475901, 31829070, 8043430		★☆☆☆☆ Found in Text Mining only
Macular Edema, Cystoid	Cystoid macular edema	BEFREE	17024220, 24319335, 28328965, 30660771		★☆☆☆☆ Found in Text Mining only
Macular retinal edema	Macular edema	BEFREE	17024220, 24319335		★☆☆☆☆ Found in Text Mining only
Magnesium Deficiency	Magnesium Deficiency	BEFREE	29454997		★☆☆☆☆ Found in Text Mining only
Majeed syndrome	Majeed syndrome	Pubtator	33314777	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	16244501, 22832853, 23813968, 26008736, 26556688, 26804030, 27502736, 27718369, 27796193, 27858966, 27913990, 27960139, 28074937, 28122130, 28243095, 28338340, 28338954, 28382017, 28418766, 28633757, 28867280, 29069253, 29070016, 29298663, 29415791, 29529546, 29587166, 29626828, 29684628, 29895759, 29895893, 29935756, 29968776, 30033161, 30248896, 30564974, 30762747, 30769022, 30819515, 30844329, 30899619, 31063941, 31195092, 31207853, 31291232, 31417262, 31615590, 31629608, 31669792, 31686824, 31693974, 31753725, 31818803, 7506108		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	21448457, 22683764, 22832853, 23813968, 25331895		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	29300279, 31002915		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	15064729, 22159219		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	17310346, 20682658, 21708999, 21845339, 23548270, 23948049, 28559019, 29082496, 29463991, 30642292, 31055110, 31478236		★☆☆☆☆ Found in Text Mining only
Malignant hyperthermia susceptibility type 1	Malignant hyperthermia	Pubtator	2103309	Associate	★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25162674		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	7750122		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10070858, 11751408, 11899364, 14633738, 14735187, 14759713, 15081542, 15609131, 15623590, 15945506, 16115908, 16273337, 16287071, 16464738, 16721634, 16842617, 17416766, 17531096, 17594514, 18060028, 18060036, 18239642, 19435922, 19640729, 19687301, 19965896, 20043205, 20101226, 20633553, 21092249, 21220315, 21518778, 21523452, 21937440, 21967801, 22211709, 22235336, 22595751, 22644871, 22818022, 22819326, 22903472, 23056300, 23166300, 23178494, 23289672, 23368093, 23553622, 23632023, 23750285, 23762340, 23832664, 24012192, 24299316, 24467886, 24473196, 24568505, 24670917, 24705025, 24832086, 24961464, 25213863, 25305747, 25453096, 25476497, 25697898, 25824986, 25868978, 25881039, 26152358, 26173622, 26227964, 26232424, 26406414, 26512918, 26515594, 26559373, 27050979, 27248826, 27351141, 27356714, 27496793, 27879265, 27914795, 28025102, 28099924, 28166202, 28178994, 28202520, 28208810, 28460534, 28481867, 28555011, 28559409, 28591216, 28617135, 28711499, 28732081, 28856117, 28983080, 29027990, 29235043, 29245248, 29256156, 29296206, 29326716, 29387062, 29388151, 29413760, 29482885, 29540614, 29557068, 29593668, 29648818, 29695771, 29695834, 29707128, 29715108, 29844821, 29867925, 29891854, 29934528, 30075885, 30079756, 30083161, 30134951, 30168090, 30262865, 30332900, 30372844, 30439625, 30442350, 30467123, 30546293, 30563531, 30578886, 30671946, 30962499, 30989585, 31004874, 31007849, 31167402, 31186728, 31515600, 31598337, 31635541, 31781916, 31795965, 31824163, 31826486, 9770334		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16298037, 17516992, 19435922, 19446661		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	15904949, 24582558, 26130650, 29093604, 29684351, 30828987, 30922625, 31189128, 31741758		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	18502691, 20056108, 21273582, 22847808, 23561329, 29921731, 29976575, 30728854, 31572184, 31845119		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	18260730, 25573292, 27769047, 29410961, 29554539, 29723410, 30249899, 30882917		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	22411584, 23321674, 30038723		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	1596939, 17261774, 20168352, 25766682, 28572026		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	21845339, 28878571		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	24910242, 26096712, 28109867, 28430601, 29486150, 29722127, 30944206, 31069838		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10374431, 11504947, 12151314, 12833138, 14604894, 15854959, 16344268, 1716216, 17416433, 18060028, 18990769, 19505916, 20713723, 21122157, 21216930, 21252117, 21996739, 22580886, 23052692, 23100065, 23292870, 24139238, 24260500, 24408019, 24420154, 24492940, 24922005, 24984610, 24988892, 25074527, 25242236, 25461668, 25729947, 25889486, 26166037, 26372664, 26517240, 26528698, 26703799, 26739332, 26744530, 26815582, 27197187, 27556690, 27835873, 27893707, 27998891, 28149280, 28402963, 28599466, 28819126, 28830450, 28855077, 28951614, 29049175, 29101033, 29134640, 29383114, 29408308, 29869537, 29970138, 30078713, 30127882, 30266897, 30604632, 30634502, 30833304, 30851071, 30953795, 31100307, 31128010, 31273548, 31367260, 31412593, 31468132, 31491838, 31507089, 31559061, 31771091, 8364912		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	26372664		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	11064354, 17177164, 20035059, 22050374, 24625449, 25560781, 28397778, 28454394, 29096753		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	15935550		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12810629, 15581980, 17023036, 17373716, 18587580, 20699329, 22595649, 25670170, 27068525, 27174914, 27206315, 27825119, 28872976, 28960399, 29100353, 29565447, 29572027, 30009406, 30305729, 30584363, 30642295, 31049770, 31097475, 31212816, 31533774, 31755326		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	19401270		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11724306, 12553038, 16109537, 16115919, 17568185, 18951869, 20388782, 20482858, 21408027, 21481788, 21515913, 21744993, 22261331, 24097820, 24572992, 24839931, 25725585, 25779676, 26762195, 26847351, 27085461, 27876525, 28126348, 29337110, 29653723, 29714141, 29853638, 30497874, 31424683		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10068344, 10639189, 11410519, 11555613, 12547723, 12727841, 12763015, 14563701, 14633682, 15041717, 15389813, 15474988, 15672864, 15688010, 15870945, 16006970, 16618780, 17072336, 17148681, 17346688, 17373716, 17513150, 18045952, 18303206, 18694328, 18954528, 19011039, 19147545, 19170126, 19189403, 19240160, 19267250, 19342366, 19406240, 19437484, 19489038, 19638459, 19805306, 19844233, 19866469, 19908944, 19965896, 19996656, 21214673, 21251905, 21321981, 21664423, 21965736, 22415092, 22516897, 22580608, 22782910, 22895549, 22952749, 23026707, 23073774, 23192657, 23250823, 23677069, 23824741, 23867565, 23906537, 23913484, 23977098, 24338924, 24446297, 24551118, 24577942, 25223386, 25243457, 25261365, 25633035, 26201947, 26252635, 26265203, 26375444, 26535651, 26691865, 26986507, 27053681, 27207661, 27324222, 27577074, 27665471, 27706719, 28077171, 28292326, 28296724, 28315704, 28396297, 28845520, 28864928, 29441069, 29465157, 29526757, 29659051, 29691294, 29741809, 29776955, 29848725, 30148452, 30254184, 30333255, 30345492, 30345534, 31020420, 31288722, 31315262, 31521528, 31600936, 7512667, 7553641, 7879350, 9788616		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	15672864, 17196171, 19011039, 19240160, 25970160		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	26928068, 30267577		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17139167, 17304514, 17724739, 20222161, 20405297, 21633597, 21843047, 22554382, 22711691, 23365642, 23948300, 24460320, 24886605, 26750536, 27049718, 27644247, 28186964, 28442395, 28828629, 29616104, 29710474, 29929193, 30071135, 30195978, 30525242, 30583668, 30927911, 30961685, 31741772, 31767616, 31801938, 8844475, 9195382		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	23593346		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	19494710, 24464184, 30627158		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11841803, 16110031, 18558283, 18825409, 2004327, 21104146, 23637926, 23727622, 23762858, 25292079, 26264279, 26605964, 27092883, 28418913, 28607587, 30302904, 30744595, 9231915		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10196314, 10690529, 11145432, 11147905, 11422466, 11675343, 12008042, 12176919, 12431817, 12613526, 12662382, 12730860, 12760309, 12807728, 1380241, 15041721, 15064729, 15361708, 15364891, 1559228, 15688401, 15784411, 16036105, 16083340, 1617640, 16199153, 1643291, 16640655, 17103073, 17139167, 17261774, 17283116, 17465721, 17496199, 17609658, 17639077, 17694420, 17924856, 18060028, 18205904, 18450338, 19070595, 19185845, 19189403, 19431143, 19658188, 19795418, 19805306, 19926618, 19965896, 20222161, 20520770, 20603212, 20717995, 20797623, 21102457, 21104146, 21122157, 21191816, 21329460, 21343371, 2160579, 21664423, 21767154, 21799891, 21801145, 21881215, 21943235, 22050374, 22389450, 22410118, 22576683, 22580886, 22595649, 22819326, 22923190, 22952749, 23018603, 23027619, 23116756, 23117246, 23200412, 23253923, 23289672, 23298711, 23333246, 23490413, 23637926, 23695722, 23748283, 23812431, 23832741, 23867565, 23884764, 24082147, 24260469, 24334138, 24386298, 24447345, 24473196, 24531714, 24552665, 24573038, 24602448, 24651526, 24830721, 24886605, 24895231, 24901008, 24912675, 24994460, 25031389, 25074527, 25234193, 25342631, 25405520, 25539728, 25566963, 25616716, 25625841, 25766682, 26096712, 26166037, 26265203, 26376676, 26535637, 26629698, 26681039, 26718030, 26738736, 26745602, 26759006, 26810186, 26839145, 26858125, 26879559, 26892992, 26928068, 26971998, 27025651, 27096320, 27109105, 27174914, 27177087, 27197187, 27248826, 27466289, 27722916, 27732936, 27734409, 27821605, 27866212, 27866306, 27879265, 27892764, 27991692, 28011625, 28012060, 28053020, 28053127, 28056186, 28140696, 28186964, 28235765, 28243242, 28254435, 28262975, 28270510, 28320465, 28328292, 28340506, 28397778, 28484449, 28548958, 28550196, 28559409, 28607587, 28672024, 28705384, 28707587, 28711499, 28724217, 28725043, 28749573, 28758175, 28778705, 28823497, 28839362, 28846080, 28855077, 28864870, 28903357, 28928376, 28991883, 29039460, 29048388, 29059160, 29066452, 29090850, 29096753, 29197678, 29199606, 29207662, 29245982, 29258216, 29307852, 29322414, 29333170, 29351275, 29399191, 29405201, 29422647, 29439531, 29463991, 29465157, 29475966, 29552316, 29610117, 29635790, 29641213, 29653746, 29656647, 29661142, 29662489, 29680500, 29695802, 29699936, 29699938, 29700911, 29707118, 29707793, 29776955, 29777383, 29781562, 29788156, 29788918, 29802929, 29808007, 29842912, 29849601, 29860474, 29896191, 29921731, 29959142, 29967259, 29970138, 29976575, 29991500, 30038723, 30049582, 30087314, 30096715, 30127882, 30128900, 30135142, 30169594, 30178819, 30249811, 30249899, 30254251, 30266897, 30278948, 30305729, 30342949, 30344742, 30395772, 30443842, 30467123, 30482241, 30498394, 30523881, 30565675, 30571286, 30617223, 30628094, 30647533, 30670657, 30671025, 30699065, 30719231, 30728820, 30728854, 30742544, 30802456, 30836096, 30945288, 30952727, 30982362, 30989585, 31003933, 31010006, 31026677, 31027698, 31189128, 31235785, 31272716, 31286307, 31368718, 31414667, 31436048, 31448052, 31470515, 31515600, 31515941, 31527211, 31592205, 31694340, 31707338, 31737947, 31771617, 31777581, 31794851, 31801855, 31810605, 31823669, 31824138, 31824195, 7499443, 7553641, 7750122, 8117291, 8217820, 8231032, 8436594, 9642683, 9770334, 9820173, 9822274, 9918201		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	10446984, 12629515, 16803517, 19404917, 19585495, 23180271, 23953057, 24118365, 25227842, 27220278, 27535759, 27722983, 27777338, 27866212, 28741286, 30135142, 30510453		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10903137, 12349828, 15485627, 17694420, 19177010, 20132036, 20354000, 21129206, 21145125, 21994466, 22738913, 22750444, 24120915, 25622900, 25625841, 25713055, 25862884, 26125778, 26209639, 27372860, 27980357, 28193578, 28425852, 28725043, 28739265, 28746799, 30081854, 30243096, 30344742, 30345534, 30982362, 31088266, 31150612, 31208913, 31554639, 31694340, 31838134		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	18496743, 25023587, 28925763, 31010015		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	31398886	Stimulate	★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	36248906	Associate	★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16298037, 17516992, 19435922, 19446661		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10049521, 10574257, 11410329, 14759713, 17531096, 21220315, 23814496, 25481644, 25881039, 29027990, 29320557, 29715108, 8735608		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11751408, 12771987, 15609131, 16115908, 16773437, 17531096, 17594514, 17965799, 18239642, 18689272, 18974155		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16298037, 17516992, 19435922, 19446661		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16298037, 17516992, 19435922, 19446661		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	27476619, 28914726, 29898582		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	26073757, 28056186, 28529032, 29040306		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	37445606	Associate	★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	17965063		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	23078005, 27611333, 30948489		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	23078005, 26774658, 30948489	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	30948489	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	27611333		★☆☆☆☆ Found in Text Mining only
McCune-Albright Syndrome	McCune-Albright Syndrome	BEFREE	8690800		★☆☆☆☆ Found in Text Mining only
Meckel syndrome type 1	Meckel Syndrome	BEFREE	20186139		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	10480339, 21613407, 29207075		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	10480339, 33279931, 35159191	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	29207075, 32539808	Stimulate	★☆☆☆☆ Found in Text Mining only
Megaconial Myopathies	Megaconial Myopathies	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Meibomian gland dysfunction	Meibomian Gland Dysfunction	BEFREE	28887117		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	18458677		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10389979, 10996632, 12394188, 15383566, 16835788, 16909117, 18781131, 18996182, 20181932, 21056991, 24548412, 25277211, 26632958, 27818281, 28222747, 29032405, 29363180, 29371911, 29486738, 29967259, 30377573, 7615019, 7648437, 7648448, 7743524, 8314311, 8436594, 8576096, 9049837, 9816316		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11442760, 12706815, 1347555, 1544709, 16278308, 16801397, 16835788, 17141217, 17374732, 18996182, 19443406, 20181932, 21048114, 21268068, 21853302, 23582441, 23959735, 24548268, 24766647, 24954857, 27191257, 27741090, 27818281, 28222747, 30582770, 31545456, 34367731, 34411141, 37296634, 39216232, 8436594	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18942706		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35538545, 37481560	Stimulate	★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	20954977, 30515781		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	17994165	Associate	★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	27755058		★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere disease	Pubtator	34920656	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	12117909, 32832554	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	19445568, 19614683, 28454415, 29460097, 9496264		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	16946190, 17094069, 18458677, 20031642, 20836906, 21448457, 22921153, 23571152, 23813968, 24548241, 25350786, 25596176, 25760924, 26074461, 26821321, 26934083, 27049572, 27840055, 27916659, 27936453, 27978584, 28041597, 28074475, 28083615, 28096677, 28189098, 28243095, 28285256, 28318471, 28338340, 28418766, 28457809, 28474231, 28506437, 28521271, 28556833, 28558901, 28580183, 28639714, 28681405, 28689006, 28867280, 28900748, 28918107, 29016549, 29049348, 29059681, 29070016, 29184215, 29186541, 29197507, 29237576, 29324301, 29435648, 29500107, 29529552, 29562248, 29574669, 29765402, 29787856, 29790996, 29842903, 29849779, 30022427, 30098513, 30104698, 30148175, 30178819, 30244217, 30287601, 30394311, 30439824, 30504424, 30682501, 30711869, 30762747, 30819515, 30848077, 30854996, 30886334, 30899619, 30925322, 30955108, 30957546, 30962090, 30967802, 30979715, 31017303, 31052597, 31063941, 31073553, 31141465, 31165368, 31170723, 31296155, 31319037, 31394209, 31541903, 31556787, 31615595, 31686824, 31820774, 31823093, 7750122		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	23813968, 24491956, 25350786, 25760924, 25903726		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	26074461, 28418766, 30269203, 30298202, 30768387, 30844329, 31525567		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	19147624		★☆☆☆☆ Found in Text Mining only
Mesangial sclerosis diffuse	Diffuse mesangial sclerosis	Pubtator	29708439, 8943482	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	20651338, 7750122		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	38029536	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	21048114, 2787682	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	LHGDN	11918227		★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	12619938		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	17998015, 20526368, 25367327, 25712450, 28484449, 28592636, 29163240, 30584444, 31101976		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	25993353	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	17596140, 20016051, 20156756, 20186139, 20869059, 25464926, 25815341, 26052894, 26864064, 28763032, 30383538, 30635365, 31798282, 32382575, 32751810, 33582655, 34931349, 35119092, 40617584	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome	Metabolic syndrome	Pubtator	22357188, 22991262, 29670915	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	14644408, 15645209, 16320084, 16456090, 16797905, 17123852, 17160670, 17635339, 17823431, 19569017, 19685554, 20080841, 20156756, 20174757, 20186139, 21177727, 21183736, 21473680, 21749608, 21842238, 21978920, 22991262, 23170936, 24200052, 25329057, 25815341, 25869607, 26673968, 26864064, 28077381, 28163257, 28268030, 28291973, 28521868, 28598231, 28638270, 29022500, 29037330, 29081698, 29099655, 29199785, 29367725, 29390261, 29435395, 29670915, 29907916, 29930690, 30383538, 30418124, 30555225, 30576798, 30635365, 30916180, 30924020, 30989422, 31017459, 31118157, 31154939, 31466863, 31534339, 31798282, 31836512		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	CTD_human_DG	16644639		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	LHGDN	18535190		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metastatic melanoma	Metastatic Melanoma	BEFREE	21853302, 8608953, 9247310		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	15474988, 16006970, 23250823, 23492367, 24680871, 26048576, 31678743, 9788616		★☆☆☆☆ Found in Text Mining only
Methylmalonic acidemia with homocystinuria	Methylmalonic acidemia	Pubtator	17023704	Stimulate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	28549057		★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular Angina	BEFREE	22404441, 26058672		★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	12374626, 21940958, 25257527		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	12770686, 28677995, 28950996, 29938621, 31823093		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	28130814, 28951620, 30256904, 30630955, 31296192, 31332506, 31555121		★☆☆☆☆ Found in Text Mining only
Mild depression	Mental Depression	BEFREE	30248896		★☆☆☆☆ Found in Text Mining only
Milk-Alkali Syndrome	Milk-Alkali Syndrome	CTD_human_DG	10638776		★☆☆☆☆ Found in Text Mining only
Milroy Disease	Milroy Disease	BEFREE	2060582		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	10632428, 12571160, 16052406, 17034864, 22131390, 23739222, 24032723, 29017513		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	30753671, 33097606, 39174953	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	39266981	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Myopathies	Mitochondrial myopathy	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	BEFREE	22350281		★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	29307283		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	23571152, 26849950, 29408464, 30979031		★☆☆☆☆ Found in Text Mining only
Mixed phenotype acute leukemia	Mixed Phenotype Leukemia	BEFREE	7919380		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	16487028, 25353275, 27400413, 28540748		★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	31679013		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	18832862, 27816667, 28138158, 28987816, 29626828, 31207853		★☆☆☆☆ Found in Text Mining only
Mood swings	Mood swings	BEFREE	29742460		★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome	Mosaic variegated aneuploidy	Pubtator	17537851	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	23226210, 24453419, 29018115	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	17177164, 18360107, 21710491, 22103462, 27742160, 33551310, 34384424	Associate	★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	29168181	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	10233729, 20718783, 25039241, 32884012, 34035116, 37506144	Stimulate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	11704800, 15900570, 20718783, 25585854, 28108813, 29360808, 29447181, 29913529, 30178831, 30541507, 30617865, 30877950, 31302740		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	21048327, 23298273, 27867156, 31043452, 33381571, 35222381, 35699824, 36449533, 37820655, 7851022	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10023775, 10214873, 10329429, 10375612, 10460618, 10528891, 10537331, 10561908, 10602002, 10626139, 10648414, 10673673, 10848780, 11050000, 11106109, 11145432, 11175262, 11236942, 11400151, 11532348, 11805288, 11818668, 11840273, 11971193, 11986233, 12017294, 12097303, 12135668, 12149650, 12209879, 12366710, 12393684, 12453469, 12456503, 12459170, 12483530, 12569357, 12613526, 12660820, 12771946, 12791645, 12846815, 12969979, 14592826, 14726660, 1493476, 15010462, 15029211, 15070698, 15086420, 15087402, 1516003, 15217829, 15292061, 15467434, 15550378, 15585329, 15626731, 15655377, 1568457, 15781640, 15809207, 15817674, 15860671, 1587349, 1588793, 15930364, 16024627, 16082380, 16118318, 16208410, 16263571, 16266902, 16293576, 1633265, 1643291, 16460686, 16487028, 16497971, 16732369, 16809610, 16951196, 1695702, 1707469, 17119059, 17261774, 17273664, 17384201, 17579094, 1826658, 18502099, 1864979, 18728182, 18927280, 19124510, 1912582, 19139110, 19147757, 19187270, 19259613, 19282458, 19330649, 19406470, 19417136, 19622582, 19751251, 1991169, 20018915, 20395418, 2060582, 20974848, 21030352, 21173094, 21220034, 21534877, 2160579, 21705340, 21801145, 21934357, 21936961, 22387051, 22421411, 22427205, 22689860, 22838736, 22906876, 22955917, 2297574, 23012246, 23063726, 23913134, 23935020, 24118365, 24151609, 24327544, 24440854, 24625985, 24713927, 24833354, 25000828, 25353275, 25359504, 25749497, 26026586, 26383911, 26389776, 26927669, 26935956, 27023728, 27036022, 27400413, 27463014, 27525545, 27611810, 27658435, 27833099, 28154173, 28338993, 28393658, 28467797, 28544233, 28658983, 28677723, 28962646, 29031125, 29109769, 29190960, 29254208, 29333170, 29510136, 29632307, 29773987, 30145467, 30671025, 30791634, 30825517, 30953364, 31142847, 31164886, 31337650, 31784427, 7510989, 7524765, 7535594, 7537117, 7553641, 7578977, 7579407, 7579410, 7619053, 7706747, 7723407, 7743552, 7813426, 7949178, 7964514, 7989587, 8137932, 8145045, 8467229, 8499642, 8507873, 8520509, 8562936, 8579899, 8640863, 8642840, 8656685, 8691054, 8726410, 8830729, 8897437, 8916964, 8978296, 9122743, 9156653, 9188529, 9674742, 9763578, 9827928, 9886334		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	10029602, 10233376, 10460618, 10482577, 10583232, 10602002, 10620064, 10720689, 10753844, 10848780, 10880513, 10929036, 11030205, 11050000, 11090073, 11113455, 11122111, 11122145, 11154226, 11154231, 11175262, 11278272, 11369623, 11429412, 11468178, 11485567, 11532348, 11872748, 11877294, 11886382, 11986233, 12070032, 12100143, 12384432, 12393542, 12393684, 12456503, 12517814, 12531799, 12694246, 12714512, 12771946, 12791645, 12969979, 1421401, 14592826, 14717786, 14726660, 15010462, 15086420, 15292061, 15319277, 15459900, 15467434, 15550378, 15626731, 15692064, 15809207, 15860671, 1587349, 15895374, 15970928, 16118318, 16487170, 16728278, 16892169, 17173546, 17273664, 17344918, 17496199, 17644731, 17686057, 17785586, 17823079, 18173754, 18443271, 18468680, 18512025, 18544087, 18602691, 1864979, 19074889, 19103760, 19124510, 1912582, 1912585, 19187270, 19191868, 19751251, 1991169, 20068065, 20228272, 20629663, 20652971, 20974848, 21173094, 21934357, 21936961, 22471522, 22567049, 2265252, 22838736, 2297574, 23063726, 23855381, 24374814, 24489445, 24833354, 24965524, 25000828, 25469832, 25781885, 26545722, 26700310, 26775013, 26935956, 27036022, 27039771, 27268602, 27400413, 27463014, 27510016, 27698077, 27833099, 2783335, 2783861, 2785119, 2786435, 2787674, 2787832, 28154173, 28210014, 28467797, 28544233, 28801664, 29632307, 29798960, 32041604, 3264406, 32844992, 33488620, 33806619, 36043519, 37126127, 38598843, 40135312, 40481899, 7524765, 7579407, 7579410, 7605999, 7949175, 7949178, 7989587, 8125932, 8137932, 8142657, 8145045, 8204890, 8260708, 8329711, 8499642, 8507873, 8547658, 8549788, 8562936, 8634441, 8822942, 8874209, 8898103, 8977259, 8978296, 8978300, 9022078, 9054668, 9207463, 9233575, 9359513, 9373238, 9450806, 9490667, 9523575, 9531328, 9609524, 9639523, 9674742, 9716605, 9734662, 9763578, 9808582, 9822274, 9886334	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	LHGDN	12070032, 12393542, 12517814, 12660820, 12969979, 15550378, 17975159, 18931595, 19124510		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	CTD_human_DG	12855565, 19330649, 8520508		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	14975242, 15070698, 15287939, 15730850, 16373656, 18830264, 18927280, 25341809, 28677723, 31784427	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	11072134, 11196678, 11574109, 11984595, 12736743, 15732262, 16183136, 20228669, 20685768, 22547654, 23202972, 24328460, 24832354, 24882215, 25362566, 25637022, 25794663, 25896970, 26188623, 26285213, 26640809, 27412504, 27629486, 28082233, 28284329, 28316374, 28856541, 29126030, 29307283, 29324301, 29330324, 29856157, 30409508, 30423585, 30615197, 30917537, 31021023, 31033006, 31267347, 31284389, 31401379, 31431121, 8598391, 9645618		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	11984595, 12445803, 17439892, 18388249		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	12562396, 31857644	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	17258784, 23202972, 24155968, 25704169, 26285213, 26640809, 27629486, 29518260, 30409508, 30917537, 33240262, 33919169, 35386698, 35627281, 35767891, 36604748, 36725329, 39201794, 9523575	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	24412596, 25794663		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	28845212, 29078808		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	15005841, 15355555, 36814107	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	21842588	Stimulate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	21509823, 28472288, 28987470		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	30470640		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Oculopharyngeal	Oculopharyngeal Muscular Dystrophy	BEFREE	30860873		★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	28618057		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	10580802, 10657672, 16272363, 25518708, 25627031, 28743581, 29405352, 8982119		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	LHGDN	16997495		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	25518708	Inhibit	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	36647855	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	39346912	Stimulate	★☆☆☆☆ Found in Text Mining only
Myasthenic Syndromes Congenital	Myasthenic syndrome	Pubtator	16272363	Associate	★☆☆☆☆ Found in Text Mining only
MYD88 Deficiency	MYD88 Deficiency	BEFREE	21060793		★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	19406470		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10676644, 19406470, 23236476, 25679997, 28601896, 28826859, 29924032, 30825517, 7522519, 7837815		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	18297540		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	25679997, 40635108	Stimulate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	27722177, 35367529, 7538815	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	30825517	Inhibit	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	10673382, 9753648		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	20952060, 24819026, 30344703		★☆☆☆☆ Found in Text Mining only
Myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	7687878		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	28393222		★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	10716473		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	15135663, 16360360		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	BEFREE	21494108		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	10475771, 11714126	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	11199329, 11485024, 12185451, 12801611, 14644408, 15135265, 15336915, 15458685, 15543342, 15777548, 15969253, 16207551, 16210572, 16313298, 16337503, 16516951, 16525568, 16782174, 17002900, 17241179, 17964560, 17981284, 17997171, 18246092, 19005292, 19056105, 19404549, 19750100, 20059469, 20585009, 20585578, 21087078, 21199393, 22575724, 22707562, 24611887, 25781951, 26498282, 26936869, 27399086, 27555111, 27706582, 27840402, 28065862, 28233119, 28250574, 28373886, 28432157, 29066436, 29066452, 29169754, 29177025, 29800789, 29908956, 30172946, 30642049, 30934019, 30988729, 31027064, 31205590, 31218464, 31280453, 31364133, 31469975, 31534054, 31749886		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	15118287, 17706955, 18056971, 19005292		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	15883752, 16310260		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	16820586, 17241179, 20585578, 27627640, 28260995, 32515246, 33174867, 38067150	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	15378163, 21536090, 26986049, 28142118, 28889349, 29066436, 29187908, 29188498, 7671371		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16286589		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial necrosis	Myocardial necrosis	BEFREE	17964560, 29908956		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	11549342, 19758168, 29334841, 30619368, 31217849, 31515529, 8624580		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	CTD_human_DG	25396421		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	BEFREE	24106699		★☆☆☆☆ Found in Text Mining only
Myopathy Central Core	Central core myopathy	Pubtator	15299003	Stimulate	★☆☆☆☆ Found in Text Mining only
Myopathy Central Core	Central core myopathy	Pubtator	21088110	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	35405674	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	22734797, 28706484		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	27936488, 36801811, 37228600	Associate	★☆☆☆☆ Found in Text Mining only
Myotonia Fluctuans (disorder)	Myotonia Fluctuans	BEFREE	29032984		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	10999804		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	21414848, 29091763, 30845774, 37468473	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	26211001	Inhibit	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	32933141	Stimulate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	18692934, 26077347, 29581121		★☆☆☆☆ Found in Text Mining only
Myxoma	Myxoma	BEFREE	10739905, 8877729		★☆☆☆☆ Found in Text Mining only
Myxoma of heart	Myxoma Of Heart	BEFREE	10739905, 1380241, 28642131		★☆☆☆☆ Found in Text Mining only
Myxoma of the Endocardium	Myxoma Of The Endocardium	BEFREE	10739905, 1380241, 28642131, 8143505		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	19936367, 22959364, 23441314, 23517389, 26266960, 30629853		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	26266960, 31870738, 33785041, 37047067	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	12792728, 15498875, 15935550, 16995954, 18307254, 19497133, 23658720, 23708661, 24504675, 24603891, 24696473, 24952889		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	20964870, 24504675, 24952889, 26453114, 28732079, 30849642, 32308549, 34165442, 34452547, 39304953	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28207826	Stimulate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	1597519, 20397261	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrosis	Necrosis	Pubtator	20309865	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	30213531, 31129099		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	14523823, 15910597, 18571528, 21258263, 23139215, 24194940, 24210203, 26270575, 26670709, 27283365, 28013313, 28815293, 29131241, 29399120, 29502797, 29784900, 29874640, 30213531, 30431380, 30517142, 30527488, 30567000, 31129099, 31190184, 31386261, 31555862, 31786582		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10049521, 10068344, 10188725, 10233685, 10446984, 10480339, 10552343, 10786674, 10845391, 10865979, 11254686, 11410329, 11494026, 11836673, 11857082, 11920517, 11949822, 12072546, 12131369, 12153001, 12394188, 12421676, 12445202, 12547723, 12589939, 12629515, 12740251, 12883476, 1315829, 1337292, 14557477, 14633738, 14675394, 14715418, 14728809, 14759713, 14973058, 14996724, 15041717, 15064729, 15375575, 15467434, 15485627, 15610530, 15688401, 15688424, 15743502, 15772702, 15827128, 15831279, 15833852, 1588254, 15904949, 15930285, 15935550, 15940637, 1596939, 16002475, 16083340, 1617640, 16221209, 16409296, 1643291, 1647881, 16546493, 1693429, 17072955, 17079474, 17189422, 17224923, 17283116, 1728989, 17374732, 17394066, 17621267, 17639077, 17869204, 17950274, 18205904, 18303206, 18482209, 18502691, 18558283, 18587580, 18825409, 18992263, 19011039, 19073710, 19139110, 19185845, 19200609, 19431143, 19437244, 19494710, 19497133, 19564351, 19582164, 19638459, 19812400, 19913908, 20064377, 20065508, 20093746, 20106948, 20132036, 20146264, 20168352, 20210523, 20354000, 20702765, 20713723, 20884685, 21104991, 21214673, 21239715, 21251905, 21273582, 21352471, 21365246, 21411755, 21481226, 21515913, 2160579, 21656745, 21664423, 21668942, 21710491, 21831037, 21887537, 21900397, 2191239, 21967801, 21976712, 21987656, 2208133, 22082565, 22273698, 22280969, 22349830, 22389450, 22457856, 22552503, 22738913, 22743617, 22750444, 22819326, 22906876, 22952749, 23011405, 23038213, 23167961, 23185547, 23200412, 23253923, 23298711, 23548270, 23561329, 23708661, 23762476, 23762858, 23814496, 23823704, 23953057, 23999825, 24029605, 24059848, 24088816, 24244348, 24260500, 24332041, 24356814, 24371367, 24440344, 24444711, 24447345, 24472318, 24530755, 24533454, 24602448, 24696473, 24727895, 24832086, 24839931, 24885636, 24885802, 24913351, 24922005, 24951586, 24969394, 24988892, 24991558, 25123545, 25234193, 25269750, 25305747, 25359504, 25365225, 25382637, 25430879, 25461668, 25512378, 25533336, 25564572, 25573292, 25580681, 25675297, 25713055, 25750173, 25809226, 25824337, 25838550, 25862884, 25888065, 25970784, 26041742, 26143636, 26165403, 26188635, 26215971, 26223813, 26255282, 26282935, 26296362, 26315114, 26338965, 26398661, 26452542, 26484608, 26486505, 26512918, 26525581, 26605964, 26623559, 26626206, 26705936, 26718581, 26725121, 26744529, 26745602, 26839145, 27032575, 27068525, 27107418, 27207649, 27297362, 27388564, 27463014, 27577074, 27658435, 27664151, 27732936, 27797827, 27866212, 27871154, 2787758, 27885273, 27902467, 27939507, 27943380, 28052874, 28058802, 28075192, 28093267, 28099924, 28123585, 28130225, 28149280, 28166197, 28178643, 28187727, 28197363, 28246881, 28254435, 28255366, 28259044, 28266140, 28282033, 28292438, 28296724, 28303957, 28315704, 28348483, 28356514, 28381401, 28389503, 28420351, 28423581, 28483607, 28501131, 28506765, 28515477, 28540834, 28548090, 28572026, 28600192, 28630636, 28658983, 28668397, 28699252, 28721163, 28745314, 28746790, 28746799, 28749573, 28828629, 28851899, 28865178, 28868572, 28915695, 28928161, 28938160, 28962646, 29020822, 29050290, 29090850, 29096753, 29100435, 29101033, 29108270, 29113265, 29118262, 29134640, 29194906, 29197088, 29207662, 29209566, 29227529, 29245982, 29296206, 29337110, 29344257, 29351275, 29360538, 29363180, 29405201, 29434884, 29443873, 29455640, 29477470, 29497991, 29515232, 29526757, 29532324, 29535825, 29540614, 29545331, 29549722, 29552316, 29610117, 29610553, 29616104, 29617099, 29624096, 29662489, 29681184, 29695771, 29699936, 29710474, 29713085, 29715108, 29723410, 29735543, 29742284, 29770821, 29773987, 29776955, 29777330, 29795364, 29796998, 29799130, 29803656, 29869537, 29893909, 29921731, 29932283, 29959142, 29967259, 29970138, 29974846, 29976575, 29991500, 29996878, 30002156, 30009406, 30040142, 30066851, 30081891, 30087314, 30091994, 30116311, 30118838, 30127882, 30128900, 30134951, 30135299, 30154906, 30165648, 30178819, 30199269, 30217479, 30241820, 30243096, 30249899, 30265712, 30294279, 30310258, 30345534, 30372844, 30419338, 30420046, 30420718, 30439993, 30447469, 30454900, 30473379, 30518684, 30528248, 30584363, 30617223, 30670491, 30675255, 30782610, 30824583, 30824840, 30836096, 30862187, 30878596, 30885958, 30926062, 30927925, 30952727, 31005045, 31010006, 31014367, 31023180, 31055110, 31069136, 31085401, 31099356, 31105699, 31117164, 31150612, 31164961, 31196220, 31211796, 31235854, 31249138, 31252615, 31286307, 31288722, 31301646, 31315262, 31316109, 31319129, 31327593, 31342143, 31385407, 31424646, 31436048, 31468624, 31554639, 31559608, 31570278, 31572184, 31609478, 31635541, 31646814, 31684144, 31702096, 31738032, 31741758, 31766212, 31777581, 31781510, 31795965, 31848193, 31850822, 7535594, 7604020, 7706747, 7708743, 7726369, 7750122, 7954473, 7964988, 8145045, 8152296, 8189054, 8288702, 8312203, 8319222, 8364912, 8452668, 8579899, 8646686, 8954167, 9062407, 9102222, 9112382, 9122029, 9156803, 9172802, 9212236, 9372008, 9372090, 9621132, 9674742, 9766812, 9816316, 9924696		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	21153673, 28849172, 31311828, 9607638		★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Interstitial nephritis	Pubtator	30088539, 8258957	Associate	★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	20420800		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	20420800		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	23665320		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	16014026		★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	29190601	Associate	★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	28084439	Stimulate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	20446793	Stimulate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	31115030		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	35837376	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	29190601, 31531336, 7705373, 7991018		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	14686749, 32038109, 37577373	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	12544661, 18834707, 23432807, 28283439, 28456715, 29104031, 29301248		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	11426493	Associate	★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	28755317		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12942094, 1407416, 15448191, 18450743, 19411762, 19671870, 22389450, 22406995, 23763486, 24204677, 27866306, 28671636, 28954414, 29692379, 8392518, 9049837		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	18450743	Stimulate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19671870, 21833997, 23633489, 24204677, 27866306, 29692379, 34993731, 35887076	Associate	★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	29452810		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	20488324, 9003059	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	11847482		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	12352619, 15265638, 28288823, 29036854, 7572281		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	12836160		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	30128872		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	BEFREE	9049837		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	17950274, 31466863		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	LHGDN	17950274		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	23535508, 27682231, 28100408, 28281110, 28283439, 28284329, 28360886, 28445879, 28495144, 28946890, 29406915, 29856157, 30342072, 30423585, 30544111, 30769212, 30887238, 30928236, 31033014, 31401379		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	11360269, 25371017, 29656686, 31165368		★☆☆☆☆ Found in Text Mining only
Neuropsychiatric Systemic Lupus Erythematosus	Neuropsychiatric Systemic Lupus Erythematosus	BEFREE	29036223		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	27738972, 30358412, 31525567		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	10687147, 16820919, 28911066, 29482351		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	7605999	Stimulate	★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	25363529, 26244337, 26389776, 28115915, 28718891, 28801624, 29684360, 30892082, 31400073, 31627909		★☆☆☆☆ Found in Text Mining only
Nevus comedonicus	Nevus comedonicus	BEFREE	28669805, 30041237		★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Crohn disease	Crohn disease	Orphanet			★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	17823431, 18376369, 19403348, 22658783, 23935128, 25644696, 26097546, 27083404, 27377869, 27730688, 28086768, 28303724, 28430371, 28437890, 28637594, 28922096, 29037210, 29557414, 29579601, 30001365, 30032465, 30034633, 30096951, 30221732, 30235828, 30246507, 30328321, 30460863, 30553055, 30585337, 30896961, 31480575, 31547124		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	BEFREE	31333561		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20032397, 21216930, 22923190, 22982189, 24260500, 24420154, 25335739, 25504436, 25566963, 25942346, 26313152, 26675547, 26985948, 27107418, 27461772, 27499357, 27992365, 28054838, 28292012, 28599466, 28656237, 28715437, 28885675, 28927099, 29088764, 29101033, 29118262, 29550807, 29862528, 29869537, 29970138, 30132982, 30212928, 30216513, 30429024, 30473379, 30604632, 30774444, 31027698, 31054777, 31115521, 31443242, 31507089, 31523190, 31545524, 31547048, 31602642, 31741710, 31807866, 9761757		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	31215797		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	19403348, 25474087, 27730688		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	30134951		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	24495605, 25214388, 29197507, 29703661, 30407606, 30414721, 30782515, 30967316		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome 1	Noonan Syndrome	BEFREE	27809499		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11287357, 12508953, 12560873, 12690081, 12898289, 12917504, 14519071, 14680981, 15070960, 15080783, 15172007, 15292466, 15364812, 15561970, 15645209, 16029943, 16123358, 16472051, 16493118, 16988089, 17704300, 18397542, 18571785, 18719127, 18807107, 18848327, 18991689, 19125180, 19238807, 19240255, 19403722, 19428338, 19633655, 19652658, 19747414, 20132806, 20156727, 20156756, 20358354, 20660075, 21111705, 21147639, 21224869, 21232790, 21660081, 22037645, 22158445, 22228719, 22272346, 22396222, 22513335, 22607892, 23142265, 23144726, 23372021, 23698162, 23981903, 24073286, 24395296, 24633552, 24681566, 24740880, 24782217, 24868113, 24962479, 25476497, 25478993, 25921605, 26035386, 26067576, 26086344, 26516848, 26673968, 27071798, 27083404, 27643980, 27840174, 28103807, 28196859, 28421996, 28429777, 28466852, 28472244, 28534168, 28696344, 28741260, 28761653, 28844956, 28848164, 28985514, 29024103, 29095915, 29163240, 29165098, 29244802, 29258216, 29342369, 29540614, 29550676, 29653118, 29704817, 29769704, 29776955, 29782863, 29795469, 29853224, 30034633, 30113463, 30174020, 30543722, 30556596, 30584444, 30605486, 30728854, 30779845, 30865890, 30904536, 30989422, 31071114, 31085628, 31120986, 31174304, 31275296, 31301734, 31365708, 31386565, 31440209, 31472475, 31507583, 31533725, 31787367		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	11287357, 12690081, 12917504, 15292466, 16464856, 16493118, 16968396, 16988089, 17993646, 18069022, 18239554, 19218687, 19876004, 20156727, 20825686, 20846165, 20930711, 21736829, 22228719, 22272346, 22761857, 23116196, 23221346, 23484124, 23760409, 24141239, 24428800, 24782217, 24868113, 24962479, 25476497, 25921605, 25993353, 26086344, 26200663, 26263971, 26558825, 26865587, 27079270, 27342408, 27808366, 27907186, 28225860, 28454543, 28515391, 28555011, 28887432, 29389973, 29887999, 30652031, 30823632, 30871567, 31301734, 31649216, 31664059, 32176045, 32192153, 32271442, 32928877, 33183332, 34620218, 35069589, 35894174, 35927653, 35933445, 36105933, 36228259, 36246898, 36253437, 36449000, 36849131, 37047308, 37878496, 38250713, 38290570, 39216780, 39868576	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	18262644, 20739506, 21558084, 24568505, 26246197, 26516848, 26694359, 27535280, 28019133, 28103807, 28963085, 29244802, 30845774, 31533725, 32849611, 33809270, 34283808, 35301059, 35390031, 35964108, 39315755	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	20141834, 24042701		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	20157327, 24741586, 36428961	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	25815341, 28103807, 29670915, 31301734	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	14519071, 20660075, 28346858		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	30382535, 30594753		★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular hypertension	Pubtator	33216119	Associate	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	30211653	Associate	★☆☆☆☆ Found in Text Mining only
Odontogenic Tumors	Odontogenic Tumor	BEFREE	21196890		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	27181204, 29482885, 29781562, 31573734		★☆☆☆☆ Found in Text Mining only
Oligoarticular Juvenile Idiopathic Arthritis	Oligoarticular Arthritis	BEFREE	12114294		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic atrophy	Pubtator	37946484	Associate	★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic neuritis	Pubtator	40348638	Associate	★☆☆☆☆ Found in Text Mining only
Optic Neuropathy Ischemic	Optic neuropathy	Pubtator	21418620	Stimulate	★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	CTD_human_DG	28984080		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	10928984, 31187548		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	31187548	Associate	★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	13678786, 20709566, 21195346, 21501964, 21917472, 23794264, 29697533, 8141796, 8154312, 8579899, 8840280, 8873960		★☆☆☆☆ Found in Text Mining only
Osteitis Fibrosa Disseminata	Fibrous dysplasia	BEFREE	13678786		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10632674, 10703936, 16198603, 16806998, 18257935, 21172926, 22362494, 25407789, 25917063, 26450708, 26578807, 26600476, 26982743, 27082319, 27404795, 27555113, 27669541, 27866912, 28262826, 28912428, 29283192, 29316707, 29763932, 30184535, 30597965, 30704030, 31146598, 31434236, 31898441, 33036557, 33087182, 33097606, 33563308, 33953899, 34078001, 34198264, 34353059, 34547432, 34649531, 34993731, 35088674, 35328817, 35647200, 36241903, 36619785, 37316888, 37548663, 37918800, 38157375, 38401067, 39342381, 39768138, 9682783	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	22275154, 22380539, 24286485, 25888873, 30186872, 31017304, 32213162, 34158566, 34448795, 35955467	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	16198603, 28860542	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	19877065, 21863560, 29283192, 30635366, 32059658, 32131377, 32409720, 33036557, 33903094, 34073132, 39341952	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	21538317, 26600476, 31898441, 40211184	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	16198603, 20175976, 21353594, 25603974, 28860542, 29402254		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	16282562, 20175976, 21538317, 21863560, 24985590, 26233477, 27836676, 28333699, 28810618, 28810626, 28900748, 29424905, 29957388, 30134281, 30635366, 30663793, 31273319, 31470613, 31733364		★☆☆☆☆ Found in Text Mining only
Osteoarthropathy Primary Hypertrophic	Primary hypertrophic osteoarthropathy	Pubtator	28851954	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthropathy, Primary Hypertrophic	Pachydermoperiostosis syndrome	BEFREE	28851954		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	31026065		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	32417847	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	19860911	Associate	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	12749050, 18971305, 26634954		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	18971305, 32454789	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	10319577, 10467228, 10678408, 10774463, 10987653, 11040178, 11182374, 11281165, 11329621, 11355017, 11713964, 12110411, 12811627, 15030526, 15355555, 18640288, 19151030, 20386787, 21509823, 23096243, 25027107, 26441240, 26857995, 27587368, 27796445, 27875664, 28739641, 29339399, 29490310, 29679733, 29843053, 30009515, 30619321, 30671025, 30737274, 31375349, 31594977, 31709730, 7769130, 8579900, 9745442		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	10599049, 10620056, 11212160, 12009364, 15005841, 15355555, 25384921, 29521042, 29745905, 30967152, 31301734, 32080087, 36105394, 36316863, 36451445, 36578954, 36626454, 37495941, 39379846, 39596387, 9171095	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	BEFREE	10865225, 10987653, 11212160, 11355017, 11754993, 12220549, 12240899, 12519862, 12544661, 12811627, 12843190, 12898289, 14997289, 15005841, 15355555, 15364891, 16083340, 17878722, 19506792, 22380539, 22999910, 23160916, 23760743, 23891823, 25022967, 26103626, 26782575, 27401061, 27541696, 28121926, 28975973, 29860063, 29934049, 30179212, 30651805, 30666355, 30701344, 30845341, 30967152, 31301734, 31823500, 7964514, 9402932, 9441573		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	11113455, 22380539, 37038178	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	CTD_human_DG	15995586		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Age-Related	Osteoporosis	CTD_human_DG	15995586		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	10678408, 12110411, 31433756, 7813426		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Postmenopausal	Osteoporosis	CTD_human_DG	9032749		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Senile	Osteoporosis	CTD_human_DG	15995586		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	10375199, 11089884, 11820362, 16475708, 17266178, 20874851, 22743617, 23219526, 24231354, 24752352, 26623559, 26810186, 27568842, 27888521, 28053020, 28702842, 29048621, 29184419, 29228633, 29454604, 29515232, 29731768, 30135299, 30265649, 30523881, 30706385, 31718519, 31777581, 7579410, 9328832		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24455684, 26810186, 27851822, 29048621	Associate	★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	17142509, 18560870, 26957492, 30055742, 31086579		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	29595664		★☆☆☆☆ Found in Text Mining only
Otosclerosis	Otosclerosis	BEFREE	18491423		★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	28673661		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	BEFREE	20074813		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	37883761	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	28478265, 30233686		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	18171700		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	12810629, 15581980, 17023036, 17373716, 18587580, 20699329, 22595649, 25670170, 27068525, 27174914, 27206315, 27825119, 28872976, 28960399, 29100353, 29565447, 29572027, 30009406, 30305729, 30584363, 30642295, 31049770, 31097475, 31212816, 31533774, 31755326		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12810629, 17848619		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	19401270		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10682675, 14670967, 14715418, 16368063, 17023036, 17565609, 17617741, 18587580, 18624749, 19398128, 25376541, 25658637, 26238017, 26561720, 27035765, 27068525, 27206315, 27456942, 27825119, 28327095, 28473707, 30697874, 31005045, 31097475, 31396019, 31766991, 32851734, 32928797, 32977853, 33060649, 33247999, 33833265, 33855091, 33887301, 33921111, 34238029, 34369236, 34439877, 34582655, 35577351, 36276992, 37124547, 38527595, 7648722, 9681393	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32727400	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33062717, 36675246, 37322531	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oxalosis	Hyperoxaluria	CTD_human_DG	16284884		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	11870802, 18954528, 22415092, 25223386		★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	13678786, 21195346, 29697533, 8141796, 8154312, 8579899, 8840280, 8873960		★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	30134811, 30365818		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11724306, 12553038, 16109537, 16115919, 17568185, 18951869, 20388782, 20482858, 21408027, 21481788, 21515913, 21744993, 22261331, 24097820, 24572992, 24839931, 25725585, 25779676, 26762195, 26847351, 27085461, 27876525, 28126348, 29308316, 29337110, 29653723, 29714141, 29853638, 30497874, 31424683		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	24572992		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	21481788, 28151872, 28611107, 30396947, 31001483		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15609321, 16115919, 17975158, 18469355, 18951869		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	29308316, 29977235		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17568185, 19745053, 21515913, 21737619, 21880146, 23458624, 25409614, 25609203, 25807437, 29693005, 29853638, 31230062, 31424683, 31609478, 32463297, 32867538, 36105933, 36999632, 39260693	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23272057	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	40170581	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	10881937, 23774701, 23892538, 25120736, 28618057, 28704954, 28982582, 29512741, 30221360, 30531679		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	11777983, 20397261, 28935577, 32549759, 32865617, 35205334, 35946453, 40450371	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	31314190	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	18053242, 33893003	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	30047498, 30697275, 31037357		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	15917409, 18661238, 24572992, 29142471, 31506423		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	LHGDN	18091322		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	7686032		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	26283638	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	28146444, 31669792		★☆☆☆☆ Found in Text Mining only
Panniculitis	Panniculitis	BEFREE	27840174		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	7834629		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	19494710, 30627158, 31288714		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	27943380		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	37780619	Associate	★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic Syndromes	BEFREE	16083340, 26165403		★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic syndrome	Pubtator	2212010	Associate	★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	BEFREE	20393813, 23265967, 23487197		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	26609200, 30466392	Associate	★☆☆☆☆ Found in Text Mining only
PARIETAL FORAMINA	Parietal Foramina	BEFREE	30316007		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15619128, 15635591, 17982884, 18284424, 22155094, 28060896, 28182002, 28623717, 28769786, 28856541, 28987816, 29036854, 29203265, 29435648, 29478949, 29576695, 30063943, 30454693, 30658122, 30971879, 31524180, 31828965		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	17189976, 22155094, 26911448, 28943632, 31828965, 33029617, 33577043, 34536521, 34660782, 36926335, 39229261	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	21318773		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	24593806, 27735031, 35656776, 36768317	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	22565057, 26869278, 28153195, 31841386		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	28810246		★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	BEFREE	24144036, 29324263, 30180182, 9187959		★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	22800824, 31099890		★☆☆☆☆ Found in Text Mining only
Paroxysmal nonkinesigenic dyskinesia	Paroxysmal nonkinesigenic dyskinesia	Pubtator	21912648	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	26864064	Associate	★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	28384257		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	19056808, 31116709		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	19056808, 37266648	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	27868136, 35140724, 35921900	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	11161984, 11422521, 22365967		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	18373702	Stimulate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	LHGDN	18584045		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	31211854	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	16242304, 22365967		★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	19470040, 22365967, 29201111, 31057535, 31342641		★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile neoplasm	Pubtator	37763742	Associate	★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	18192685, 30815822		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	25753878		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	25753878	Associate	★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	25748492, 29066283, 29306532, 31356689		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical periodontitis	Pubtator	35300329	Stimulate	★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical periodontitis	Pubtator	40280320	Associate	★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	28202857, 29384263, 31156149		★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	17286759, 17448042, 17953698, 18181010, 19017034, 19555357, 20461739, 20682019, 22050374, 23079986, 23657600, 25994389, 27469563, 27587368, 28063227, 28809379, 29193068, 29393507, 29520828, 29538476, 29740515, 30009515, 31701554, 31825817, 7815373, 8735906, 9846737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontal Diseases	Periodontal Diseases	LHGDN	17286759, 17448042, 18502965, 18627438		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontal Diseases	Periodontal disease	Pubtator	17286759, 20682019, 24557363, 29538476, 39337647	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontitis	Periodontitis	BEFREE	11394393, 11858158, 15777561, 15863389, 16304445, 17286759, 17452560, 18380561, 18543249, 19084430, 19549135, 19555357, 19946956, 20653818, 22769440, 22918663, 23079986, 23332218, 23592000, 23657600, 24011303, 25576892, 27440198, 27925202, 28050060, 28776753, 28886588, 29393507, 29520828, 29574949, 29740515, 30165248, 30300034, 30417380, 30580840, 30719451, 31026349, 31070784, 31365708, 31560804, 31583485, 7815373		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontitis	Periodontitis	Pubtator	17286759, 23046796, 23428978, 27602578, 31978095, 32215496, 33208145, 33291232, 35844512, 37342352, 39266981, 7642293, 8608641	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontitis	Periodontitis	LHGDN	19084430		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontitis	Periodontitis	Pubtator	22926406, 28320468, 34213019, 34502071, 35139411	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	16443741, 19761682, 19778662, 20385468, 34993731, 38152968, 39863282	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	24913105, 25095746, 28406704, 29587258	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	16235772, 16443741, 17671730, 19761682, 20385468, 25095746, 28406704, 28789654, 29604234, 30773823, 31274724		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	19761682, 20385468, 28789654		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	11358282, 28251164, 31165368		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	18270703		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	27981790	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	28251164, 31165368		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	1951632		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	12349828, 16235772, 16443741		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	28490530	Associate	★☆☆☆☆ Found in Text Mining only
Personality Disorders	Personality Disorders	BEFREE	31525567		★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	28359407, 28721300		★☆☆☆☆ Found in Text Mining only
Pharyngitis	Pharyngitis	BEFREE	30687316		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	19048456, 29624096, 31137729, 31738032		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	21704966, 26934706, 28271611, 28497987, 28632410, 28651253, 29084332, 30644770		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	27050975	Associate	★☆☆☆☆ Found in Text Mining only
Pleoconial Myopathies	Pleoconial myopathy	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Pleocytosis	CSF pleocytosis	BEFREE	14595053, 25150097, 31356620		★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural Diseases	CTD_human_DG	21357438		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pleural effusion disorder	Pleural effusion	BEFREE	31741710		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	CTD_human_DG	11181422		★☆☆☆☆ Found in Text Mining only
POLYCYSTIC KIDNEY DISEASE 1	Polycystic kidney disease	BEFREE	16741147		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	23883183		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	28604386, 31134465		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	15080783, 15193488, 18680073, 18787381, 19744034, 21801267, 22553983, 22607892, 23824412, 24114630, 25634659, 25690158, 25809118, 27809669, 28276006, 28521868, 28836404, 28953677, 29306057, 29456813, 29617629, 30024552, 30463907, 30475222, 31005728, 31039949, 31293514, 31554782		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	15193488, 22344199, 24114630, 25446648, 28019133, 31999854, 32454906, 33094626, 33308258	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	18787381		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	24628003, 28868943, 32785222	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	Pubtator	33710927	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	10086722, 30571852, 30703493, 31675371		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	35025147	Stimulate	★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	29462939		★☆☆☆☆ Found in Text Mining only
Polyglandular Type I Autoimmune Syndrome	Polyglandular autoimmune syndrome	BEFREE	31023489		★☆☆☆☆ Found in Text Mining only
Polymyalgia Rheumatica	Polymyalgia rheumatica	Pubtator	34664888, 34993731, 8083354	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	29239244		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis	Polymyositis	Pubtator	29239244	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis	Polymyositis	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis Ossificans	Polymyositis Ossificans	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis, Idiopathic	Polymyositis	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	31338868		★☆☆☆☆ Found in Text Mining only
Porphyria Cutanea Tarda	Porphyria Cutanea Tarda	BEFREE	11805288, 12216069, 12846815, 20018915		★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	12830005		★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	BEFREE	31356372		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Osteoporosis	Osteoporosis	CTD_human_DG	15995586		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	18363804, 28160656, 28521179, 28933225, 29179015, 29202383, 29244900, 29393449, 29684628, 29783162, 30172946, 30390522, 30544002, 31291232, 31352811, 31698278, 31784695		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	LHGDN	19107725		★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	26738736		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	20061428, 29975666, 31692257		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	31797504		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	1714404, 29963154, 8907269		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	28478265, 29994968, 30233686		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	12909295, 15619128, 16297587, 16635548, 21116047, 26517210, 26725994, 27377066, 27861706, 29605221, 30150062, 30863888, 31145377, 31414991, 31497846, 9523575		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	15884119		★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	7524765		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	23710539	Associate	★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	30571852, 31369569		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	26738736, 29707118		★☆☆☆☆ Found in Text Mining only
Prion Diseases	Prion disease	Pubtator	9003059	Associate	★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	28493068		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	11095488		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	21704966, 22105495, 28271611, 28497987, 28651253, 29084332, 30644770		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	25015355, 28572674, 28600710, 28645275, 30807515, 31659187, 31661651, 7843589, 8983978		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10068344, 10639189, 11141475, 11410519, 11494336, 11555613, 11774033, 12431817, 12547723, 12727841, 12763015, 14563701, 14633682, 15041717, 15389813, 15474988, 15672864, 15688010, 15772702, 15870945, 16006970, 16618780, 17072336, 17148681, 17346688, 17373716, 17513150, 18045952, 18303206, 18497081, 18694328, 18954528, 19011039, 19147545, 19170126, 19189403, 19240160, 19267250, 19342366, 19406240, 19437484, 19489038, 19638459, 19805306, 19844233, 19866469, 19908944, 19965896, 19996656, 21214673, 21251905, 21321981, 21664423, 21965736, 22415092, 22516897, 22580608, 22782910, 22872134, 22895549, 22952749, 23026707, 23073774, 23192657, 23250823, 23677069, 23824741, 23867565, 23906537, 23913484, 23977098, 24338924, 24446297, 24551118, 24577942, 24664372, 25223386, 25243457, 25261365, 25633035, 26201947, 26252635, 26265203, 26375444, 26535651, 26691865, 26986507, 27053681, 27207661, 27324222, 27577074, 27665471, 27706719, 28077171, 28292326, 28296724, 28315704, 28396297, 28845520, 28864928, 29441069, 29465157, 29526757, 29659051, 29691294, 29741809, 29776955, 29848725, 30148452, 30254184, 30333255, 30345492, 30345534, 31020420, 31288722, 31315262, 31521528, 31600936, 7512667, 7553641, 7879350, 9788616, 9891500		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	21081304, 28735516, 29938471, 30345492, 34606081, 37378942, 37847180	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	17094460	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10391095, 11389966, 11733366, 11751884, 12163482, 12902351, 15672864, 17094460, 17346688, 17878531, 18303206, 18601766, 18615482, 19147545, 19240160, 19242540, 19267250, 19342366, 19437484, 19528499, 19805306, 19908944, 19965896, 19966016, 20576793, 21081304, 21258401, 21430300, 21535317, 21734453, 21943235, 22475653, 23192641, 23342084, 23754304, 23913484, 24151226, 24264315, 24307657, 24338924, 24446297, 24551118, 25305352, 25633035, 25858146, 25970160, 26048576, 26252635, 26265203, 26528857, 27012192, 27053681, 27706719, 27732936, 28317149, 28467474, 28561752, 29741809, 29896191, 29938471, 30333255, 30345492, 30602952, 31600936, 31689825, 32415054, 32999046, 33149212, 34171447, 34350063, 34399719, 34633095, 35292057, 35703345, 35813468, 35821621, 35887223, 36371231, 36524848, 36776524, 36924677, 37108754, 37378942, 38087324, 39574470, 9520419	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	11733366, 12431817, 12727841, 14981536, 16006970, 17196171, 17373716, 17876341, 18027847, 18615482, 18924133, 19147545		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	12547723, 12853969, 19242540, 24446297, 25261365, 27732936, 28077171, 28315704, 28467474, 30134795, 30345534, 30809313, 7512667, 8555651, 8986637		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	15672864, 17196171, 19011039, 19240160, 25970160		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17148681, 19189403, 19351789, 31348843	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
prostatitis	Prostatitis	BEFREE	23620238		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	26517838, 34245398, 8258957, 8268396	Associate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	38401467	Stimulate	★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	30134811, 30365818		★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	10634216, 26962819, 28083615, 30734130		★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	23359500		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11097836, 12220549, 1294020, 1711550, 1796815, 18311435, 20148256, 21574971, 2191052, 22158445, 2258628, 22909235, 23524263, 24140476, 2474833, 25357087, 26331791, 27194220, 27224855, 27421005, 27942589, 27984037, 28235443, 28681405, 29390261, 29926968, 30219085, 30760013, 31571243, 31747314, 31789253		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	LHGDN	15859365, 16864908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	16844318		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	16864908, 18669614, 30301277, 30998987, 33259876, 38115636	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	21681565	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	18311435, 27194220, 29027583		★☆☆☆☆ Found in Text Mining only
Psychomotor Disorders	Psychiatric disorders	Pubtator	34535767	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	24495605, 25214388, 29197507, 29703661, 30407606, 30414721, 30439824, 30782515, 30967316		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	25214388, 40348638	Associate	★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	12407153		★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	20966748		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	20808962	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	24083390, 29629898, 32029443, 32813135, 34445297, 34588193, 34993731, 35960497, 36157437, 36871578, 37516840	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	25941359, 28893516, 31191356, 31341036		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	11106212, 14624669, 17395587, 18693004, 19359268, 21037957, 21814463, 24975928, 25183374, 25535123, 26001777, 27036869, 27060571, 28963085, 29065892, 29149779, 29319364, 29403273, 30655663, 30742544, 31141166, 31503552, 31517562, 32342557, 32698440, 32842623, 32940422, 33762567, 34079246, 34125980, 34206428, 34290711, 34479474, 34785892, 35064606, 35186226, 35637927, 36017119, 37978492, 38412768	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17626109, 19179485, 19272152, 20395558, 20500811, 24438094, 25125975, 26403459, 28178340, 28476471, 28494757, 28979110, 33590951, 34323408	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26617776, 30390648, 34815425	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	34883250	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	25525212	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	19349390, 22268122, 25749497, 27835930, 28006950, 28749079, 28910816, 29065892, 29329251, 29437944, 30763575, 31191356		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	10720455, 17579094, 20846163, 23526221, 25172494, 25318478, 25535123, 28194150, 28420366, 29038604, 29216763, 29793317, 29932250, 31049028, 31126962, 31539483, 31611754, 7568174, 9378980, 9560103		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	17266442, 25216247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	20507572, 25535123, 32210969, 33832291	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	16844318		★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	BEFREE	17992659		★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Pyelonephritis	BEFREE	29475562		★☆☆☆☆ Found in Text Mining only
Pyogenic granuloma	Pyogenic granuloma	BEFREE	10027407		★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	28450106		★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	28558744, 30132351		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	17694420, 28394749		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	12140751, 17052682, 23982631, 26039006, 26385127, 28543912, 29384969, 29550839, 29641282, 29800802		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Recurrent depressive disorder	Mental Depression	BEFREE	28558901		★☆☆☆☆ Found in Text Mining only
Recurrent otitis media	Otitis media	BEFREE	17142509		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	18786965, 19847432, 25436214, 26364660, 28013198, 29632909, 31494241		★☆☆☆☆ Found in Text Mining only
Regional enteritis	Crohn Disease	CTD_human_DG	10700533, 21829567		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	17261774, 25766682		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11830554, 15665272, 1596939, 16221209, 17373716, 1749019, 19360351, 20168352, 22429968, 23274199, 25675297, 25679997, 27377533, 27384883, 2787758, 28093267, 28572026, 28903416, 28915665, 29717134, 31410730, 7861551, 8231032, 8886918, 9112382, 9736430, 9820173		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	15665272, 16428383		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	7834629		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	22068875, 31281526		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	18496509, 31072913, 9767525		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	28859607		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	17400600		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	17400600, 22113815, 27701117, 28340238, 28424078, 28590889, 28713998, 29138874, 30308440, 30584968, 30651808, 30990758, 31261506, 31281400		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	LHGDN	18593632		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	11006206, 17400600, 18521627, 22489672, 31258705		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	29808005		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	28230530, 28660319, 32472750, 7813103	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	30193587	Stimulate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	33828172	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Artery Occlusion	Retinal Artery Occlusion	BEFREE	15604420		★☆☆☆☆ Found in Text Mining only
Retinal Artery Occlusion	Retinal Artery Occlusion	LHGDN	15604420		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	26015767, 32542038	Stimulate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	28645275		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	29263305, 32957329, 33371882, 34544594	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	19542902, 25595815, 28632410, 30944099		★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	LHGDN	18039346		★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	31814701		★☆☆☆☆ Found in Text Mining only
Retinitis	Retinitis	BEFREE	29976680		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	31810025		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	10229675	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	14730602, 21664423, 28099924, 28481867		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	29260199, 29274846, 30517142, 31525777		★☆☆☆☆ Found in Text Mining only
RETINOSCHISIS 1, X-LINKED, JUVENILE	Retinoschisis, X-Linked	BEFREE	28505494		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	28672024		★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	28632410, 29568872, 30807515, 31661651		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	17607501, 23168096, 27400406, 29067978		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10323452, 10329846, 10470256, 10623431, 10632674, 10688908, 10708808, 10880057, 11037876, 11056676, 11120852, 11145851, 11196696, 11281165, 11315916, 11406520, 11580755, 11685652, 11748261, 11824970, 11879547, 12148597, 12220549, 12517948, 12632414, 12714388, 12794819, 12847684, 12913922, 1376492, 1380241, 1462123, 14680510, 14730602, 15104599, 15170913, 1531188, 15353352, 1550404, 15517632, 15570426, 15642131, 15972956, 16095005, 1643291, 16511915, 16802343, 17056579, 1707461, 17314215, 1732419, 17426140, 17477816, 17482423, 17665434, 17851546, 17942634, 18006645, 18243142, 18728048, 18759290, 18786965, 18796608, 18799095, 18848327, 19180491, 19328245, 19379726, 19404965, 19542367, 19560569, 19635908, 19713205, 19804846, 19847432, 19950274, 20072851, 20100935, 20149313, 20609399, 20661738, 20665032, 20974296, 2109776, 21195737, 21279994, 21312239, 21383200, 21551509, 21633911, 21724701, 21740541, 21742641, 21833517, 21889771, 21937456, 21952924, 21953341, 2197219, 21981268, 22027148, 22046434, 22055894, 22122521, 22132693, 22246057, 22294633, 22324945, 22342385, 22427231, 22491018, 22532634, 22594821, 22762939, 23024462, 23058179, 23070535, 23148991, 23233117, 23264340, 23272690, 23335987, 23375120, 23593036, 23601344, 23635711, 23746537, 23773307, 24120697, 24183354, 24253594, 24286242, 24440854, 24449571, 24484294, 24513290, 2462501, 24668548, 24707478, 24721042, 24728031, 24792438, 25027107, 25030201, 25248373, 25273676, 25436214, 25630523, 25652333, 25707877, 25794663, 25847223, 25941031, 26135838, 26166764, 26336855, 26343270, 26364660, 26526676, 26558442, 26578807, 26710124, 26713842, 26939566, 27058440, 27072520, 27108590, 27163292, 27281095, 27413250, 27440258, 27550416, 27629486, 27696782, 27738630, 27777170, 27829535, 27845065, 27846751, 2786697, 27902343, 27984037, 28002590, 28010120, 28013198, 28017911, 28053286, 28056105, 28107624, 28114971, 28120218, 28165872, 28211306, 28214674, 28215362, 28228280, 28314223, 28316139, 28316374, 28369786, 28374627, 28376065, 28376277, 28400572, 28446208, 28463788, 28490617, 28494214, 28506571, 28547815, 28550307, 28579757, 28583713, 28584977, 28642760, 28657833, 28659662, 28676350, 28680422, 28708839, 28738524, 28770826, 28778705, 28794503, 28800780, 28809379, 28812210, 28828944, 28847766, 28850026, 28855173, 28880691, 28886017, 28901512, 28916714, 28928840, 28946707, 28947313, 29038247, 29038523, 29041951, 29042029, 29080328, 29094311, 29096690, 29101672, 29137228, 29157669, 29186541, 29202486, 29209219, 29323140, 29325462, 29377743, 29461286, 29465346, 29465348, 29467856, 29482351, 29483080, 29490676, 29500054, 29512371, 29514712, 29549113, 29578578, 29611409, 29631459, 29632909, 29683364, 29706965, 29708588, 29725131, 29755657, 29768427, 29777367, 29786138, 29852739, 29853972, 29901815, 29915585, 29924032, 29925278, 29931592, 29949166, 29961161, 29961573, 30001644, 30054992, 30076153, 30106091, 30106887, 30123797, 30148175, 30148441, 30148452, 30157931, 30173151, 30178083, 30233580, 30336338, 30345838, 30357484, 30383519, 30402834, 30405318, 30418124, 30423415, 30427250, 30431436, 30459279, 30488231, 30553912, 30557124, 30587230, 30587928, 30591403, 30597965, 30653667, 30657547, 30659893, 30695794, 30729713, 30848077, 30887238, 30944206, 30988705, 30995492, 31025923, 31037071, 31066041, 31181818, 31239367, 31244849, 31333447, 31389580, 31433756, 31455730, 31494241, 31536783, 31585899, 31601476, 31631790, 31733368, 31758423, 31762409, 31780864, 31782615, 31818460, 31842396, 7554443, 7622181, 7948616, 8143505, 8163935, 8318038, 8403545, 8596143, 8778953, 9032818, 9416849, 9441573, 9502421, 9506880, 9832618		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17665434, 18243142, 18260177, 18419107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	19192274, 22450443		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis, Systemic Juvenile	Rheumatoid arthritis	BEFREE	9045866		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis, Systemic Juvenile	Rheumatoid arthritis	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	22533231, 26909898, 33966399, 35190755, 37713866	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	31185305, 33224143, 36032502	Stimulate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	37634407	Inhibit	★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	30099957		★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	18327798		★☆☆☆☆ Found in Text Mining only
Salivary Gland Adenoma Pleomorphic	Salivary gland disease	Pubtator	27286739, 8198972	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	28039719	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	12737276, 16933469, 17671745, 31021023, 8179912		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	12946220, 24768588, 27402699, 39284999	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	LHGDN	18799077		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	27929051	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	1652755, 34982796, 39778225	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	28851899		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sarcoma Clear Cell	Sarcoma	Pubtator	23058034	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	25092916, 26215971, 33682749	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	34440851	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	10196314, 10482577, 11001912, 11050002, 11264189, 11781250, 12134031, 15154666, 20583924, 21984125, 23818101, 24198402, 26646010, 28878084, 32669340, 37740179, 7657807, 7688764, 8030759, 8669484, 9199351	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	24373201	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Spindle Cell	Sarcoma	BEFREE	12015752		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	7834629		★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	39519004	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	14563376, 17140746, 19914334, 19939410, 21700295, 22571276, 23265967, 24787542, 25214388, 26133963, 26198920, 26491028, 27245499, 27810494, 27840055, 28338954, 28923068, 29090685, 29163240, 29217401, 29417623, 29864757, 30005373, 30016466, 30025760, 30116031, 30138899, 30218782, 30248668, 30442531, 30461427, 30682559, 30906479, 31024366, 31118157, 31526800, 31534339, 31587436, 31738648		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	24984193, 29803226, 38066312	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	25214388, 25433960, 26462458, 30630651, 32038109	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	8067274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schnitzler Syndrome	Schnitzler Syndrome	BEFREE	23374612, 29284595		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	10720455, 11237429, 27992693, 28956500, 30009261		★☆☆☆☆ Found in Text Mining only
Scleroderma Localized	Scleroderma	Pubtator	37372943	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	11710721, 17125598, 19536281, 31178673, 31545397, 33922041	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	24083390, 30157947	Stimulate	★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	26199858, 36670417	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	BEFREE	18007247		★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	LHGDN	18007247		★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	27296563		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	26839145, 27549777, 27738330		★☆☆☆☆ Found in Text Mining only
Seizure, Febrile, Complex	Seizure	BEFREE	26960986, 31709864		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	29194369, 32219137, 40348638	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures Febrile	Seizures	Pubtator	26960986	Associate	★☆☆☆☆ Found in Text Mining only
Seizures Febrile	Seizures	Pubtator	34449141, 38218765	Stimulate	★☆☆☆☆ Found in Text Mining only
Selective immunoglobulin A deficiency	Selective Immunoglobulin A Deficiency	BEFREE	16386644, 18486766		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	28544640		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	28544640	Associate	★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	10927795, 12399113, 17430245, 28453488		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	10477399, 14500502, 17210974, 18949559, 22187279, 26125767, 26463449, 31415369, 32484987, 34461635, 35491874	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	23679576, 32496420, 32996896, 35095877	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	30666251	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	11236899, 11328954, 11902285, 11956023, 11975924, 12411588, 12807489, 12970043, 1375198, 14523169, 15520404, 15642878, 15721840, 15784721, 15845478, 16208404, 16444434, 17363400, 1749040, 17869650, 18001296, 18375611, 18434913, 18571528, 19781786, 19914088, 20207161, 20217044, 20375552, 20561086, 20835611, 21671855, 21777617, 21898524, 22079540, 22113815, 22608565, 22609212, 23145105, 24292568, 24771854, 24944154, 24945834, 25030319, 25337817, 25529480, 25734339, 25881528, 26025100, 26312770, 26399395, 26463449, 26496101, 26561011, 26704762, 27169526, 27172264, 27388228, 27449508, 27622284, 27701117, 27782294, 27939333, 27960200, 28086962, 28170292, 28177877, 28222313, 28257334, 28278436, 28407580, 28422377, 28499395, 28549777, 28662100, 28694565, 28793880, 28829877, 28834779, 28859554, 29016484, 29127203, 29129626, 29138874, 29193197, 29204105, 29239828, 29413717, 29489737, 29505782, 29541387, 29544449, 29562764, 29584685, 29599924, 29620667, 29664086, 29683274, 29687346, 29760745, 29782861, 30004393, 30037797, 30123776, 30127927, 30146415, 30174784, 30207217, 30214506, 30221694, 30233734, 30365067, 30423400, 30477377, 30529771, 30542439, 30547887, 30601406, 30602262, 30666251, 30726111, 30734480, 30760225, 30782124, 30817635, 30858952, 30915758, 30947238, 30966828, 31038735, 31247004, 31263829, 31323346, 31325317, 31389587, 31415369, 31440860, 31450153, 31501504, 31512003, 31547696, 31568052, 31651475, 31658116, 31665078, 31701437, 31718563, 31757216, 31794773, 8307982, 8550842		★☆☆☆☆ Found in Text Mining only
Serous retinal detachment	Serous Retinal Detachment	BEFREE	27364629, 30130755		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	15860669, 16482545, 17052299		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	29870142, 30842658, 8645749		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	15817674		★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	29197507, 30943938		★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	BEFREE	21530175		★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	BEFREE	17286759, 17953698, 19017034, 24824149		★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	29914105		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	27039262	Associate	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick Sinus Syndrome	BEFREE	19468049		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	39210558	Stimulate	★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	12836160		★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	BEFREE	29273305		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	17040605, 29853978		★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	15579284		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	18209090, 27207443, 28379971, 29846789, 37418983	Stimulate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	19700754, 22018243, 24827536, 29504848, 30150979, 32576236, 32914376, 34909885, 34993731, 35705251, 36999025, 38013284, 39819714, 40650157, 9867125	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	15654950, 22992805, 25270893, 29771405, 36672844	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Diseases	Skin disease	Pubtator	37740179	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Erosion	Skin Erosion	BEFREE	18799095, 28340008, 29853972		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	16309502, 19477321, 24013670, 25341795, 26038346, 28235443, 28321152, 29390261, 29479352, 29771405, 30481683, 30651813, 30967262, 9767281		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	19218687, 19581829, 20847078, 22761257, 24380782, 26276663, 30001365, 31210414, 32029067, 36824025, 39252231	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	35491659, 37217113	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	29617910, 31446797		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	7949151		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	LHGDN	18577878, 18685607, 18780208		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	19288024, 19581829, 20668869, 21481226, 22761257, 24380782, 25953302, 26564171, 28131740, 28364485, 28675894, 28728622, 28830779, 29042934, 29135515, 29245360, 29305826, 29394961, 29444292, 29482817, 29744301, 29744684, 29991422, 30001365, 30032465, 30093572, 30678164, 31210414, 31313021, 31473474		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	23440187	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	25451613	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	20570482, 24012192, 30299243, 30334418, 30414442, 31368718, 31417262		★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	19288024		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	22662257, 28285690, 29581757		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	29020964, 31366794	Associate	★☆☆☆☆ Found in Text Mining only
Small Fiber Neuropathy	Small Fiber Neuropathy	BEFREE	20513817		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	28851899		★☆☆☆☆ Found in Text Mining only
Spastic Quadriplegia	Spastic Quadriplegia	BEFREE	23415255		★☆☆☆☆ Found in Text Mining only
Spherocytosis Type 1	Spherocytosis	Pubtator	34540188	Inhibit	★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	28614141		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	12121679, 30327453		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	LHGDN	12121679		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	27331400		★☆☆☆☆ Found in Text Mining only
Spinal stenosis of lumbar region	Spinal Stenosis Of Lumbar Region	BEFREE	25735609, 29436483, 30067795		★☆☆☆☆ Found in Text Mining only
Split hand foot deformity 1	Split hand foot deformity	BEFREE	28680751		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	25941031, 26149736, 7622181		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	31953524, 36575020, 36700196, 40305235	Associate	★☆☆☆☆ Found in Text Mining only
SPONDYLOCARPOTARSAL SYNOSTOSIS SYNDROME	Spondylocarpotarsal Synostosis Syndrome	BEFREE	30875143		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	14604894, 18310089, 18502691, 23185547, 24356192, 24398980, 24420154, 2473120, 27108527, 27744625, 29344239, 29702196, 31167516, 31314647, 31766212, 8789430		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	14604894, 15847702, 18260266, 18273643, 18310089		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	26372664		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	10408408, 18502691, 21273582, 22677780, 22847808, 23561329, 25238263, 25405520, 27801498, 29059160, 29209110, 29710521, 29948421, 30254470, 30683902, 30804112, 31324197		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	10543258, 10736096, 15847702, 18006755, 21104991, 21187140, 21559372, 21656745, 21710491, 21845339, 22583829, 22912337, 23185547, 24048704, 24398980, 25761055, 25888065, 27108527, 27174914, 27736845, 27744625, 28107179, 28545132, 28861772, 29138797, 30191505, 30642292, 31327864, 31914141, 32814771, 33232279, 33551310, 33887877, 34377590, 34755560, 35089951, 35267186, 35484352, 35574984, 35813468, 36614179, 37505788, 37686462, 38246918	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16984731, 19484147, 37391526	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	26372664, 30127882		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	28107179		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	20884685		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	11169220, 18006755, 19484147, 20682658, 21104991, 21656745, 21708999, 21845339, 22110204, 22313388, 23349315, 23625689, 24048704, 25888065, 26079381, 27078157, 27108527, 27174914, 27943380, 28559019, 28915597, 28945228, 29245982, 29456743, 30642292, 30899371, 30926062		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29769425, 30367209, 31778438		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	12775581, 15342284, 18281810, 21872532, 26075620, 28407320, 28527371, 29858968		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	30986405		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	16219169, 17823431, 18571785, 22658783, 23892696, 24332041, 26035386, 26384383, 27730688, 28430371, 28710554, 29228430, 30001663, 30229840, 30585337, 30705687, 31429848		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	28851899		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15153787, 17139167, 17304514, 17724739, 18198221, 20222161, 20405297, 21633597, 21843047, 22554382, 22711691, 23117246, 23365642, 23893709, 24460320, 24886605, 26750536, 27049718, 27196487, 27644247, 28186964, 28442395, 28828629, 29616104, 29710474, 29929193, 30071135, 30195978, 30525242, 30583668, 30927911, 30961685, 31741772, 31767616, 31801938, 8844475, 9195382		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	24116074, 25888319, 34008757, 34104107	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	30525242		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12297725, 12760309, 17560462		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	12760309, 15354212, 15361708, 16769709, 18573283, 21633597, 22126569, 22351606, 22457856, 23117246, 23365642, 24116074, 24460320, 24519125, 24886605, 24946088, 25350954, 25916550, 27049718, 27824145, 28507278, 28828629, 29391307, 30583668, 32044717, 33824303, 33843442, 34008757, 35361764, 35672352, 35691615, 36158129, 36371539, 36454780, 37950040, 9414656	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	23593346		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	28851954, 31646814	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	21478439	Stimulate	★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	20872175		★☆☆☆☆ Found in Text Mining only
STRIATONIGRAL DEGENERATION, INFANTILE (disorder)	Striatonigral Degeneration	BEFREE	29510394		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	20090932, 27409177, 33903586	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	20622166, 21407237, 22167233, 35503943, 35673992, 38067150	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	24167359	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	15726267, 16741147, 18344399, 21410438, 27576738, 27759738, 27931942, 28229304, 28415958, 28869993, 28912935, 29194369, 29336471, 29429002, 29434735, 29683965, 29926382, 29981464, 30028365, 30116336, 30646897, 30814021, 30910642, 31272120, 31361786, 31801576		★☆☆☆☆ Found in Text Mining only
Supraventricular tachycardia	Supraventricular tachycardia	BEFREE	28639986		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	25868978		★☆☆☆☆ Found in Text Mining only
Sveinsson Chorioretinal Atrophy	Sveinsson chorioretinal atrophy	Pubtator	28434701	Associate	★☆☆☆☆ Found in Text Mining only
Synovial Hypertrophy	Synovial Hypertrophy	BEFREE	30630515		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	24373201		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	1707461, 17918786, 21548952, 22532634, 27789465, 2786784, 28333699, 28621703, 29457379, 30302948, 30336338, 31200688		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	21548952	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis, Acne, Pustulosis, Hyperostosis, and Osteitis Syndrome	Synovitis, Acne, Pustulosis, Hyperostosis, and Osteitis (SAPHO) Syndrome	BEFREE	30428761		★☆☆☆☆ Found in Text Mining only
SYNOVITIS, GRANULOMATOUS, WITH UVEITIS AND CRANIAL NEUROPATHIES (disorder)	Arthrocutaneouveal granulomatosis	BEFREE	28797204, 31006736		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	11469477, 11606449, 12220549, 12373010, 14613283, 26251193, 27798725, 28094589, 28115015, 28277841, 28841363, 29242269, 29801971, 29888930, 29940586, 29981562, 9769329		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	10090171, 10225968, 10720455, 11237429, 12115192, 1457282, 16971486, 17125598, 17444587, 18576303, 21535076, 22586157, 22734797, 22742541, 23027890, 27992693, 28038794, 28384257, 28575534, 28955239, 28956500, 28980909, 29193892, 29343447, 29562615, 29601941, 29853453, 29948346, 30009261, 30051925, 30150989, 30157947, 30404019, 30561237, 30652681, 30747392, 31073660, 31375891, 31397760, 31539483, 7948613		★☆☆☆☆ Found in Text Mining only
Systemic-onset juvenile idiopathic arthritis	Arthritis	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	7553641		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	16802373, 17002904, 25604533, 27989502, 28160070, 28438554, 28466804, 28770707, 28778711, 28968895, 29427826, 30171380, 30765261, 31297975		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	GWASCAT_DG	25604533		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	14532843		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	26792515		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	LHGDN	15121272		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	30321519, 31109746		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	28412025, 29203638		★☆☆☆☆ Found in Text Mining only
Testicular Diseases	Testicular disease	Pubtator	37033952	Associate	★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	23905873	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	26491227	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	15194532, 20600579, 24898769		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	31408438, 35488725	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	7537110	Inhibit	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	7605999	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	10841078, 11675343, 16820206, 22586157, 28504650, 31741758, 7750122, 9766812		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	11432624, 26490522	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	LHGDN	18041648		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	15795541, 28058802, 28823228, 29396046, 9550647		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	17177164, 34452748	Associate	★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	35180460	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombophilia, hereditary	Thrombophilia	BEFREE	30298070		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	20536609, 22914813, 25657311, 25988387, 35180460, 36131342	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	21498913	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombosis of cerebral veins	Thrombosis	BEFREE	26662441		★☆☆☆☆ Found in Text Mining only
Thrombotic Microangiopathies	Thrombotic Microangiopathies	BEFREE	28183278, 31264312, 31316523		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	11716039, 12608932, 15497456, 16002736, 19798110, 20017620, 22237514, 22661653, 22736938, 23092922, 24956560, 25135760, 25198673, 28278511, 28364200, 30480323, 31338585, 31813786		★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	23867310	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	34628367, 35090515	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer, follicular	Thyroid cancer	BEFREE	23844163		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	19494710, 24464184, 29969659, 30627158, 31288714		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	CTD_human_DG	26037280		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	18692934, 29055566		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	29131274	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	CTD_human_DG	26037280		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	29250672		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	19494710, 24464184, 30627158		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	CTD_human_DG	26037280		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	23844163, 33247999, 36407322, 37896899, 37960775	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Nodule	Thyroid Nodule	LHGDN	12553555		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	31350776	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	36159840	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	1320956, 21235536, 25127106, 2680182, 31552761, 32604892	Associate	★☆☆☆☆ Found in Text Mining only
Thyrotoxicosis	Thyrotoxicosis	BEFREE	21332025		★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	12836160		★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	BEFREE	29273305		★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de Pointes	BEFREE	28490617, 29332573, 30521586		★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de pointes	Pubtator	34664888	Associate	★☆☆☆☆ Found in Text Mining only
Toxic Shock Syndrome	Toxic Shock Syndrome	BEFREE	28483238		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	14512079		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	18558283		★☆☆☆☆ Found in Text Mining only
Transposition of Great Vessels	Transposition of the great arteries	Pubtator	35590253	Associate	★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	26090964	Inhibit	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	19342252, 20186139, 28678161, 28829905		★☆☆☆☆ Found in Text Mining only
Tricuspid Atresia	Tricuspid Atresia	BEFREE	29480841		★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Insufficiency	Tricuspid Valve Insufficiency	BEFREE	22350281		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	30612530		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	34067581	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23633491, 26028030, 27836733, 28254410, 28343970, 29341321, 29487338, 29898755, 30396947, 30450530, 30852762, 30885232, 31036052		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26513016, 26690867, 35268073, 35964108	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26752006, 28343970, 31182923, 32920591, 35960749, 37069669, 37199043, 37378935, 37657065, 37713894, 39905567, 40723906	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	20613633, 28954414, 29384235		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	24606538	Associate	★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	28393222		★☆☆☆☆ Found in Text Mining only
TUMORAL CALCINOSIS, HYPERPHOSPHATEMIC, FAMILIAL	Tumoral calcinosis	BEFREE	30867640		★☆☆☆☆ Found in Text Mining only
Type II Mucolipidosis	Mucolipidosis	BEFREE	24127423, 30171875, 31158415, 31165501, 31781680		★☆☆☆☆ Found in Text Mining only
Tyrosine Kinase 2 Deficiency	Immunodeficiency	BEFREE	26304966		★☆☆☆☆ Found in Text Mining only
Tyrosine Kinase 2 Deficiency	Tyrosine kinase 2 deficiency	Pubtator	29725107	Stimulate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11196713, 11204808, 12792220, 1587185, 18535667, 18825772, 18942752, 19926618, 19936899, 21877213, 21945121, 22185629, 22374925, 22962574, 23211301, 23974060, 24758565, 24776844, 25076849, 25768924, 26668517, 27622899, 28088612, 28652656, 28922365, 28962154, 29171305, 29226079, 29379540, 29475099, 29529212, 29530609, 29748708, 29845215, 30783488, 30797423, 30906432, 31206576, 31689519, 31694526, 8563893, 9753275, 9928378		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	17653646		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	16244501, 22832853, 23813968, 26556688, 26804030, 27502736, 27796193, 27858966, 27913990, 28074937, 28243095, 29415791, 29626828, 30359810, 30819515, 30844329, 31291232, 31417262, 31629608, 31686824, 7506108		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	CTD_human_DG	18458677		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	21448457, 22683764, 22832853, 23813968, 25331895		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uremia	Uremia	LHGDN	15494357, 16760905		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	16760905, 25000894, 29228352		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	16760905, 29944162	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18825409, 25292079, 29517678, 30310111, 30744595, 32406319, 3495482, 37047238, 38072891, 39456780, 9681394	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25640370	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Tract Infections	Urinary tract infection	Pubtator	20526368	Associate	★☆☆☆☆ Found in Text Mining only
Urolithiasis	Urolithiasis	BEFREE	16014026, 23363559		★☆☆☆☆ Found in Text Mining only
Urolithiasis	Urolithiasis	Pubtator	37878647	Inhibit	★☆☆☆☆ Found in Text Mining only
Urolithiasis	Urolithiasis	Pubtator	37878647	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	23727622, 25640370, 31069136		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	Pubtator	23207551, 26774658, 29410184	Associate	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	29410184, 30026764		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	Pubtator	36539847	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	39684873	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	12629515		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	10366571, 10925276, 12801265, 16803517, 19404917, 20565840, 23099807, 23587428, 25227842, 26474968, 27220278, 27690342, 27722983, 27866212, 27883176, 29949145, 31595161, 31943744, 33820781, 34582655, 34684062, 34854425, 7717461	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31396215	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	16989825, 35279667	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	15785748	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	22429778, 29899166, 32957329, 33682883, 35163491	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	29899166, 30702560, 31768922		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	19164426, 22197901, 24528300, 26487500, 28157416, 29135797, 9071222, 9856775		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	Pubtator	27028890	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	Pubtator	32479651, 33639877, 35061677	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis Intermediate	Uveitis	Pubtator	26640809	Associate	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	25303043	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	26818976		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	26818976, 33384687	Associate	★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	27764704, 27959437, 28324642, 28534957, 28592841, 29067115, 30173053, 30214381, 30251694, 30365067, 30864715, 31059087		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	30334274, 31781347		★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	25899133, 32679199	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	34767831	Stimulate	★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	36930472	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	12592264, 14634584, 15896753, 17115186, 17519976, 25286056, 27547870, 28769070, 29931542		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	LHGDN	14634584		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	16566827, 17596140, 18069022, 20385468, 23364322, 33383381, 37327001	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	32029443	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	22734797, 27455075, 28168662, 29186106, 29360808, 31320177, 31780858		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	36453709, 36794867	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis of large artery	Vasculitis	BEFREE	28466804, 28841363, 30427262		★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	25125049, 25269057	Associate	★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	29194369	Stimulate	★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	29439934	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	26238017, 35625609	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	29890913, 35625609, 38215128	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	24243751, 26864064		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	31379862, 40088950	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	31533725	Stimulate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular Fibrillation	LHGDN	17851087		★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular Fibrillation	BEFREE	18571935, 26864064		★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	26864064	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	15298045	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular tachycardia, polymorphic	Ventricular tachycardia	BEFREE	30521586		★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	30795865, 3133443		★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	12836160		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	28464004, 29571607, 30414721, 30729713, 30972761		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	LHGDN	12615367		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	22696056, 22871993, 26177100, 30651813		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	22696056, 40723924	Stimulate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	23555779, 26177100, 9077486	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	22696056, 22871993, 26177100, 30651813		★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	28572674	Stimulate	★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	29246578, 39486365	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	16804116, 17252022, 17534163, 2333285, 26238488, 27813533, 29496671, 31164961, 31531336, 8167341		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	16804116, 21921047, 29496671, 30104397, 30279229, 32763516, 33690107, 33764527	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	LHGDN	18508793		★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	2539277		★☆☆☆☆ Found in Text Mining only
Wolfram Syndrome	Wolfram syndrome	Pubtator	33693650	Associate	★☆☆☆☆ Found in Text Mining only
X-linked agammaglobulinemia	Agammaglobulinemia, X-Linked	BEFREE	16751014, 17090647, 17932028, 24612681, 2539277		★☆☆☆☆ Found in Text Mining only
Xanthoma tendinosum	Xanthoma Tendinosum	BEFREE	16083882		★☆☆☆☆ Found in Text Mining only
Xanthomatosis	Xanthomatosis	Pubtator	16083882	Stimulate	★☆☆☆☆ Found in Text Mining only
Xanthomatosis, Cerebrotendinous	Cholestanol storage disease	BEFREE	29322139, 30186419		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	10998144, 11710926	Associate	★☆☆☆☆ Found in Text Mining only
Zollinger-Ellison syndrome	Zollinger-Ellison syndrome	BEFREE	11866267		★☆☆☆☆ Found in Text Mining only