IL1A (interleukin 1 alpha)

Gene

• Entrez ID: 3552
• Gene name: Interleukin 1 alpha
• Gene symbol: IL1A
• Synonyms (NCBI Gene): IL-1 alpha, IL-1A, IL1, IL1-ALPHA, IL1F1
• Chromosome: 2
• Chromosome location: 2q14.1
• Summary: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macropha

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004689	hsa-miR-191-5p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR	20924108
MIRT004689	hsa-miR-191-5p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR	20924108
MIRT017051	hsa-miR-335-5p	Microarray	18185580
MIRT054374	hsa-miR-142-3p	Luciferase reporter assay, Western blot	22870299
MIRT054374	hsa-miR-142-3p	Luciferase reporter assay, Western blot	22870299
MIRT727459	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT727458	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT727456	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT727457	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT727455	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT727454	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT727453	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT727451	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT727452	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT1064196	hsa-miR-1254	CLIP-seq
MIRT1064197	hsa-miR-3116	CLIP-seq
MIRT1064198	hsa-miR-3179	CLIP-seq
MIRT1064199	hsa-miR-3605-5p	CLIP-seq
MIRT1064200	hsa-miR-3936	CLIP-seq
MIRT1064201	hsa-miR-4257	CLIP-seq
MIRT1064202	hsa-miR-545	CLIP-seq
MIRT1064203	hsa-miR-661	CLIP-seq
MIRT2389362	hsa-miR-141	CLIP-seq
MIRT2389363	hsa-miR-200a	CLIP-seq
MIRT2437788	hsa-miR-132	CLIP-seq
MIRT2437789	hsa-miR-212	CLIP-seq
MIRT2437790	hsa-miR-3545-3p	CLIP-seq
MIRT2437791	hsa-miR-4778-3p	CLIP-seq
MIRT2437792	hsa-miR-4802-3p	CLIP-seq
MIRT2451720	hsa-miR-3619-3p	CLIP-seq
MIRT2451721	hsa-miR-4535	CLIP-seq
MIRT2451722	hsa-miR-4776-5p	CLIP-seq
MIRT2451723	hsa-miR-890	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOS	Unknown	8688489
JUN	Unknown	8688489
NFKB1	Repression	17612514
RELA	Repression	17612514

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001660	Process	Fever generation	IEA
GO:0001819	Process	Positive regulation of cytokine production	IDA	1739124
GO:0002248	Process	Connective tissue replacement involved in inflammatory response wound healing	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	IMP	2989698
GO:0005125	Function	Cytokine activity	TAS	10861041
GO:0005149	Function	Interleukin-1 receptor binding	IEA
GO:0005507	Function	Copper ion binding	IDA	12746488
GO:0005515	Function	Protein binding	IPI	11554782, 12746488, 16971486, 18329368, 25241761, 25416956, 25910212
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	12746488
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	IMP	3493774
GO:0005615	Component	Extracellular space	TAS	1924307
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	12746488
GO:0006883	Process	Intracellular sodium ion homeostasis	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	1924307
GO:0006950	Process	Response to stress	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	3493774
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IEA
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	ISS
GO:0010628	Process	Positive regulation of gene expression	IDA	23817958
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IMP	2989698
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	IMP	2989698
GO:0032743	Process	Positive regulation of interleukin-2 production	ISS	31172560
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS	31172560
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS	31172560
GO:0033092	Process	Positive regulation of immature T cell proliferation in thymus	IBA
GO:0034605	Process	Cellular response to heat	IDA	12746488
GO:0035234	Process	Ectopic germ cell programmed cell death	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045766	Process	Positive regulation of angiogenesis	ISS
GO:0045840	Process	Positive regulation of mitotic nuclear division	IMP	2989698
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046688	Process	Response to copper ion	IDA	12746488
GO:0050714	Process	Positive regulation of protein secretion	IMP	9564845
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IBA
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	TAS	10748004

Other IDs

• MIM: 147760
• HGNC: 5991
• e!Ensembl: ENSG00000115008

Protein

• UniProt ID: P01583
• Protein name: Interleukin-1 alpha (IL-1 alpha) (Hematopoietin-1)
• Protein function: Cytokine constitutively present intracellularly in nearly all resting non-hematopoietic cells that plays an important role in inflammation and bridges the innate and adaptive immune systems (PubMed:26439902). After binding to its receptor IL1R1
• PDB: 2ILA, 2KKI, 2L5X, 5UC6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02394	IL1_propep	1 → 109	Interleukin-1 propeptide	Family
  PF00340	IL1	155 → 266	Interleukin-1 / 18	Domain

• Sequence:

  MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETS
  KTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLS
  NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKI
  TVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHP
  NLFIATKQDYWVCLAGGPPSITDFQILENQA

• Sequence length: 271

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMNESIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMNESTIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTHRACOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET'S SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHONDROSARCOMA, MESENCHYMAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC PROGRESSIVE EXTERNAL OPHTHALMOPLEGIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOMYOSITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIARRHEA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSENTERY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FABRY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT-VS-HOST DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK MALIGNANT NEOPLASIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOLYTIC-UREMIC SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC POLYMYOSITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IL1A-related disorder	Likely benign; Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATOCONUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES, INTERSTITIAL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELAS SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MERRF SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL MYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC ATROPHY, HEREDITARY, LEBER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROPHARYNX CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYMYOSITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYMYOSITIS OSSIFICANS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AA amyloidosis	AA amyloidosis	BEFREE	15257727, 26819362, 29578360		★☆☆☆☆ Found in Text Mining only
Acne	Acne	BEFREE	20630038, 23884315, 28193081, 28588486, 29498183		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	20630038, 23884315, 28193081, 28588486, 29498183		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	BEFREE	25223242		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	20709104		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	24819208, 28403570		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28152513		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	1700730		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	11331456, 18815552, 23418608, 31606729		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	29490936		★☆☆☆☆ Found in Text Mining only
Adamantinous Craniopharyngioma	Adamantinous Craniopharyngioma	BEFREE	31666193		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12730860		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	22819319, 23951028, 27473228		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	8939459, 9007702		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	15730917, 19086955		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	11423389		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11529470, 1883481, 2887587, 7628587		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	17265504		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	CTD_human_DG	19035492		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	31379825		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	10328654, 11350506, 11858158, 12974682, 14974822, 16304445, 17335371, 17575917, 18723088, 20335539, 21593780, 26263533, 30285894		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	LHGDN	17335371		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	14533660, 24654309		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	11703512, 11841553, 12190641, 23542780		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	11703512, 11841553, 12190641, 23542780, 8573920		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10037734, 11483667, 15201366, 17149369, 17257626, 18769539, 21070631, 21509504, 21968104, 22879895, 23038715, 24024155, 2529544, 31018751, 31618972, 31861093, 36498925, 7830934, 7904796	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10716257, 24454987, 35689551	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	23322030		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	21196890		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	21196890, 29419674	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	31901915	Stimulate	★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	CTD_human_DG	8003924		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis	Amyloidosis	Pubtator	1616367, 23718630	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	16785446, 25438464, 27927236, 28501482, 29477641, 29578360, 31057541, 31383341		★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	28812775		★☆☆☆☆ Found in Text Mining only
amyloidosis IX	Amyloidosis	Pubtator	6332168	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29384411		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	28064547		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	15257727, 16634833, 9844760		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	1824252	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	3264697	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	22674409, 27883292	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	22674409, 27883292		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	21620624	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	28407320	Associate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	31415103		★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	36142237	Stimulate	★☆☆☆☆ Found in Text Mining only
Angiolymphoid hyperplasia	Angiolymphoid Hyperplasia	BEFREE	1954381		★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	17460270		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	Pubtator	34502316	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	11145849, 11752505, 15309690, 16206345, 16361275, 16508980, 16650794, 16918024, 17259653, 17899305, 18063673, 18484691, 18525349, 19772829, 19930406, 20062062, 21962386, 22285486, 22312160, 28423679, 29200018, 30299251, 30322951, 30557124, 31726259		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21847358, 22264792, 22487523, 23951028		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	27897393, 28212946		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	20005085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anthracosis	Anthracosis	CTD_human_DG	20005085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	37914735	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28866071, 31163212		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28866071, 31163212		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	24612355	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	17321344, 21620624	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	16268484, 26352243, 26941015, 29197609, 29456054, 29884291		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	27196763		★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10685360, 11073843, 14575520, 16169330, 16804330, 17717316, 18268038, 19142372, 21380730, 21451572, 23995233, 24024155, 26139463, 28323859, 28420489, 29073957, 29198612, 29584915, 29880500, 29960988, 30698710, 30702995, 30761006, 30832770, 31415103, 31664319		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	Pubtator	3491091	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	10210770, 10419775, 17179173, 17503796, 21161742, 24024155, 30299251, 31443670, 9507015	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	10741403, 11007768, 11094434, 11342576, 12009331, 12220548, 1386092, 16710471, 16947381, 17609389, 17853003, 18060042, 19035520, 2026869, 21357261, 23341540, 23689131, 24024155, 28375155, 28457885, 28645307, 29774240, 29941463, 31298290, 31350760, 31426853, 31599092, 8054359, 8507220, 8886998		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	14688369, 17335371		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	15851489, 17724127, 29928998, 33892792	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	10857783, 16918024, 17828345, 7693825	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10210770, 11083259, 11229456, 1395121, 1427978, 15020327, 15188374, 15248214, 15458956, 15943888, 16947381, 1698773, 17640966, 1901643, 1993047, 2075829, 22040886, 22879895, 2330842, 24397353, 27105431, 30272996, 3091636, 3264697, 3264773, 39342401, 7492245, 7657832, 9525978, 9613344	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15140777, 16901957, 1914237, 22736176, 35164656	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	23339928	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	27001429, 28167912		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	12890860, 16918024, 18484691, 20886249, 27188858, 30557124		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	15341921, 21671260		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11027520, 12644720, 12752325, 12938145, 14566338, 18763028, 18926055, 19801525, 20671916, 20689814, 21703343, 23602199, 23855553, 24275925, 24568840, 25223230, 25278425, 26125632, 27007676, 27130862, 27982737, 28262817, 28528200, 28716529, 29034996, 29103994, 29154202, 29867931, 31066119, 31550242, 31727692, 8703481		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	18774390	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	19439663, 23527710, 28223794, 29103994, 29769273, 30864351, 32457454, 34800561, 35751199	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	10654577, 1937574, 2157429, 2646146, 2783391, 29734739, 8903854		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	17121800, 1937574	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	10489901		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10685360, 11073843, 14575520, 16169330, 16804330, 17717316, 18268038, 19142372, 21380730, 21451572, 23995233, 24024155, 26139463, 28323859, 28420489, 29073957, 29198612, 29584915, 29880500, 29960988, 30698710, 30702995, 30761006, 30832770, 31415103, 31664319		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	11353829, 1663075, 19439663, 23874021, 24024155, 24063019, 28323859	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	19569080	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	23713812, 26056004, 31429300		★☆☆☆☆ Found in Text Mining only
ATRIAL SEPTAL DEFECT 1	Atrial Septal Defect	BEFREE	31551826		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	31551826		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	23995914	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	15365221		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	26728085, 27217154, 29178897, 31125917, 31551826		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	10498633		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	11380474, 1427978, 20942939	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11727511, 12220548, 12763679, 18418395, 20414049, 20465500, 21380730, 22124790, 22878274, 23464866, 23651166, 24446657, 25917106, 26142671, 26164496, 27603301, 27926540, 28041873, 28207428, 29415894, 29571080, 29633070, 29802240, 29879187, 30014358, 30042333, 30659328, 30728750, 30827881, 30995499, 31382910, 31584126, 31746138, 31830463, 8330041		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	33125159	Inhibit	★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	1572693		★☆☆☆☆ Found in Text Mining only
Autoinflammatory disorder	Autoinflammatory Disease	BEFREE	20173777, 20861596, 21480187, 22723549, 27187378, 27998728, 29633070, 29766377, 30466770		★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	28812775		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	2787453, 31805184		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	10618692		★☆☆☆☆ Found in Text Mining only
Balkan Nephropathy	Balkan Nephropathy	BEFREE	11427627, 17907045		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	23806268		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	35328735	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	12730545, 15679582, 17960403, 21418526, 22197901, 23464866, 24252048, 24267724, 24422572, 27603301, 27775096, 27981463, 28335798, 28693405, 30148652, 30799530		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	17960403		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	28166214	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	15318032, 19125864, 19488045, 25855618, 28416092		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	19125864, 28129679	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar I disorder	Bipolar Disorder	BEFREE	28129679		★☆☆☆☆ Found in Text Mining only
Birdshot Chorioretinopathy	Birdshot chorioretinopathy	Pubtator	18941541	Associate	★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	28984997		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	12667716		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16698387, 19489682, 27196763, 29684419		★☆☆☆☆ Found in Text Mining only
Blau syndrome	Blau syndrome	Pubtator	17968944	Associate	★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	27868136, 7817673	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	11737511, 20059417		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	12619925, 17129176, 18612013, 19494218, 21196890, 2844218, 8605359	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	12869004, 28361334, 28968889		★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	12619938	Associate	★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	25278075, 27279422, 36614130	Associate	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain infarction	Pubtator	32503645	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	15829914		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	29734739		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12451035, 14633625, 16115908, 16319982, 16464738, 17010072, 17932347, 1832651, 19267917, 20127018, 21731759, 24670917, 24716804, 26909967, 27853906, 28405519, 29047186, 29402901, 29719585, 30012670, 30075885, 30217872, 30324661, 30670488, 31297985		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16464738, 16518599, 16684880, 17670913, 19267917, 24670917, 24716804, 26909967, 27853906, 30814616, 31297985, 32098891, 32788048, 33621853, 36766731, 37551997, 38263420, 40429863, 9618523	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	25822228		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	24750386	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	30862773, 30969811, 31354700, 31354715		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	30969811	Associate	★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	27868136		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	29033373	Associate	★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	33047901, 34502316	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	19035492	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis cutis	Calcinosis cutis	BEFREE	27164190		★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	35016421	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16884377, 1730767, 19267917, 20846456, 20863990, 23995914, 24272484, 35395492, 37551997, 9062407	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12759452, 9414656		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	16412062	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	22282663	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	22282663	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12651617, 29802240, 37501379	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35756844	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16698387, 1893964, 19489682, 2115174, 27196763, 29684419		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16126303, 17596594, 19505916, 29408308, 30832375, 9204981		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21847358	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23951028, 35395492	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22282663	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22282663, 23578198, 40612864, 7710946	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	16412062	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	20874839, 21146373, 25981582, 27121322, 2844218, 37369480	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21819702	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12538625, 14504049, 17141301, 24272484, 25195148, 30642295, 7603468, 8175024		★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	19125864	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	17002905, 17336407		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	36298704	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	17948066	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	19811434, 30311699		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	10685360, 28939513, 29198612, 29310992, 29904899, 31077280, 31127805, 31485173, 9889413		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	19439663, 22879895, 33172487, 37941911	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	20536609	Inhibit	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	20536609	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	21393601, 32927275	Associate	★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal tunnel syndrome	Pubtator	1616367	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	12469908, 15641080, 17179173, 18808736, 20592454, 29996115	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	28259981	Stimulate	★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	1954381	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	1622944	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	37694725	Inhibit	★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	23007871		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	16133447, 16567828, 23658628, 29543397		★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome 1	Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome	BEFREE	25817729		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	12947160		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	12824054, 21919908, 28602833, 29567761, 30354247, 31192907, 9099804		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	17114844, 18336824, 24063019, 29145255, 31183363, 31192907	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	11527622, 31779506		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	20536609	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	30844663		★☆☆☆☆ Found in Text Mining only
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	28868047		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	11137152, 25917615, 27856349, 29310992, 31061403, 31727174		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	17293495	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	17332449		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	12820354, 24712845, 25925136, 27866212, 7594609		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	12820354, 24712845, 24862933, 25925136, 27866212, 7594609, 8959334		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	29145837		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	23440434, 8583857, 8725537		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	33627146	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma Middle Ear	Middle ear cholesteatoma	Pubtator	31947538	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	10765924, 24901233	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	15316669, 16391840		★☆☆☆☆ Found in Text Mining only
Chorioretinitis	Chorioretinitis	BEFREE	18941541		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	1824252, 7701874	Associate	★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	24550444, 27702670, 27873163, 8243611		★☆☆☆☆ Found in Text Mining only
Chronic Infantile Neurological, Cutaneous, and Articular Syndrome	Neurological, Cutaneous And Articular Syndrome	BEFREE	12483741, 14872505, 16920754, 17763411, 18609262, 21538043, 22723549, 23226210, 25302486, 26245468, 27927236, 28118536, 29766377		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	12631337, 12837270, 15286433, 15954918, 16088107, 16766392, 20551628		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	15717635, 21045076, 22795294, 28178330, 29241624		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10618692, 16983347, 19074885, 2258703		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	11001075, 15994259, 18579366, 24504887, 25174605, 28262817, 28546273, 29137224, 29872287, 30380761, 30930781, 31066258, 31632288, 31727692		★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	27883292	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	10711605, 10711606, 11073323, 11669477, 11669478, 11858158, 12702109, 14974822, 15966908, 16907768, 16945028, 17214636, 17711477, 17823082, 18673406, 20490394, 20934174, 22344672, 22348697, 23241110, 23592003, 24060296, 24612355, 24690098, 25710474, 26263533, 29065749, 30142580, 30676974, 30939298, 30982982, 31759990		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	LHGDN	12362317, 16945028, 17711477		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	17823082, 22124068, 23592003, 24612355, 24690098, 24843315, 25530681, 25710474, 33854406	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	19671938, 21198766	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic progressive external ophthalmoplegia	Progressive External Ophthalmoplegia	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronobiology Disorders	Chronobiology disorder	Pubtator	21839423	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	31443525	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	21968104	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	10723681, 24550444, 26590314, 30654310		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	18942751, 25232259, 34717557, 36860851	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	9414973	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12096923, 16158955, 29062241, 8425199		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11355696, 34367132, 36127676	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16006751, 17611673, 19863607, 20846456, 23192617, 26345777, 28094194, 28691536, 30016900, 30547011, 30583087, 30650375, 30723583, 30819119		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16158955, 17640979, 22363134, 30593746, 30819119, 34083590, 34930323, 34931923, 35236282, 39892619	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	19076825	Associate	★☆☆☆☆ Found in Text Mining only
Complement deficiency disease	Complement Component Deficiency	BEFREE	19717455		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	26436722		★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	20131270	Associate	★☆☆☆☆ Found in Text Mining only
Congenital neutropenia	Congenital Neutropenia	BEFREE	3264774		★☆☆☆☆ Found in Text Mining only
Congenital Nonbullous Ichthyosiform Erythroderma	Congenital Nonbullous Ichthyosiform Erythroderma	BEFREE	20385541		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	24531812, 28232838, 29141858, 29549570, 29584915, 29683921, 29904899, 30010800, 30033595, 30968846, 31127805, 31415103		★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	LHGDN	18416755, 18416756		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25453823, 28915570		★☆☆☆☆ Found in Text Mining only
Corneal dystrophy Avellino type	Corneal dystrophy	Pubtator	30829721	Stimulate	★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal Ulcer	BEFREE	23750216		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	14644395, 16470016, 18716798, 24422572, 25617388, 28916975		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	11527622, 12551827, 14644395, 15051633, 16470016, 18716798, 19142372, 20070880, 21840356, 24422572, 24530664, 25617388, 27078871, 28181534, 28532406, 28916975, 29310992, 29395365, 31469975		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	11527622, 20070880, 24530664, 37304261, 39742022	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	20070881	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	14644395, 16470016, 18716798, 19053923, 20070881, 23029154, 24422572, 25617388, 28916975		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	18716798		★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	11514491	Associate	★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	7830934	Associate	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	36389809	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	21499907, 29808007, 30249264		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	33041191	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	15803022, 18942751, 22732089, 25299544, 29345374, 31843928, 8899101, 9414973		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	18942751	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	9414973	Stimulate	★☆☆☆☆ Found in Text Mining only
Cryopyrin-Associated Periodic Syndromes	Cryopyrin-Associated Periodic Syndromes	BEFREE	16344627, 16532456, 18668535, 20074280, 20074281, 20140476, 20353899, 20966753, 22288582, 22335455, 22891689, 23223423, 23253918, 23684246, 24144430, 25217959, 25730877, 26140469, 26245468, 26312542, 27036377, 27707729, 28079503, 28586272, 29130929, 29610014, 29633070, 29869008, 31194989		★☆☆☆☆ Found in Text Mining only
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	9534885		★☆☆☆☆ Found in Text Mining only
Cyclical vomiting syndrome (disorder)	Cyclical Vomiting Syndrome	BEFREE	28682429		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	18635816, 19431193, 26972847, 29884450, 31118097, 31524632, 31524633, 31715090, 8703481		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19144271, 19399182, 31118097, 32765492, 35922154	Associate	★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	36045687	Associate	★☆☆☆☆ Found in Text Mining only
Deficiency of mevalonate kinase	Deficiency Of Mevalonate Kinase	BEFREE	27723279		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10384145, 10600505, 10806046, 11007768, 11728217, 1386092, 1458286, 14724685, 15190266, 15316669, 15910695, 16934183, 17532232, 17640966, 17853003, 18802112, 19151976, 19733643, 20131253, 20592454, 21182922, 21523343, 21671260, 21798287, 22201856, 22362494, 22380539, 22576756, 22939867, 23216199, 23277489, 24767790, 24767864, 24952309, 25496568, 26239639, 27023516, 27654963, 28259981, 28323859, 28659793, 28716465, 28964890, 29095531, 29682561, 29996115, 30087302, 30312659, 30340925, 30548658, 31068673, 31121225, 31162482, 31431607, 31484919, 31575035, 31843642, 7564267, 7622181, 9616438		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	12909295, 15201366, 16226351, 17622713, 19158434, 21509504, 21968104, 24103372		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	15201366, 18631256, 21509504, 21968104	Associate	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	12794386, 16226351		★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	21261944	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	10483047, 19158434, 22990943, 24103372, 26934083, 28203105, 29247999, 29894487, 30366016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	20574126, 21722710, 22990943, 24103372, 26002078		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	29103192, 30366016	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	31044590	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	21831269	Stimulate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	28129679, 34171401	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	17908936, 21881584, 22364598, 23407395, 24996260, 27020408, 27139015, 28323859, 29157812, 29203183, 29515113, 29744290, 30240702		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	22427475	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	32896640	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	23178550		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Allergic Contact	Dermatitis	BEFREE	28812775		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	12828754, 15356430, 19477321, 22322004, 23253688, 25223230, 27348082, 29989151, 30269350, 30643810		★☆☆☆☆ Found in Text Mining only
Dermatitis, Irritant	Dermatitis	BEFREE	18416755, 22364598		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338, 22533443		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	17908936, 25688670, 25739051, 27604144, 28588486, 29857000, 30277862, 31515542		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	Pubtator	10693873	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	Pubtator	11953983, 17265504, 19035492, 34997119	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	BEFREE	17265504		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	LHGDN	19035492		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	CTD_human_DG	19035492		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	19035492		★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	CTD_human_DG	19035492		★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	20595916		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17097645, 18315433, 19792847, 19820020, 21205020, 23486342, 24024155, 25732517, 26542796, 29885882, 7931087, 8612552		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	29385062	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17097645, 18315433, 19792847, 19820020, 20173777, 21205020, 23486342, 24024155, 25732517, 26542796, 29310992, 29885882, 31773714, 7931087, 8612552		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21205020, 22972474, 26268591, 38408622	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34283808	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	16258158, 26692253, 27706611, 35460250	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18840782, 19542207, 21205020, 26576766, 27649540, 37047308, 39342401	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35801423, 37762140	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10671304, 12941768, 18029454, 18648765, 20173777, 20483667, 27253397, 27706611, 29504185, 29884765, 7578987, 7926295, 7931087, 8906850		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12631337, 15286433, 19541594, 20074280, 20173777, 20588114, 21205020, 21538043, 22288582, 22521751, 24477584, 24969107, 25491100, 26448147, 26576766, 27649540, 28532406, 29525039, 30459597, 30762811, 31513665		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	20173777, 8612552		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	37380899	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	29421772, 29999450, 32733443	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15286433, 25732517, 29514038, 30417374, 30632070, 31022160		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29584759, 31379825		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	38194422	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Cerebral Sclerosis of Schilder	Schilder disease	Pubtator	19125864	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	11423389		★☆☆☆☆ Found in Text Mining only
Diffuse Scleroderma	Scleroderma	BEFREE	30277862		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated intravascular coagulation	Pubtator	3878084, 6332168	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	15290893, 21712624, 23866266, 28816027		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	21712624, 2529544, 33206953	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	23665202, 29605492		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	25817729	Associate	★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	14632761	Associate	★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	16164697, 16550552, 19804405		★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren Contracture	BEFREE	8320323		★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	8320323	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	31671940		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	12828754, 15356430, 19477321, 22322004, 23253688, 25223230, 27348082, 28468973, 29989151, 30269350, 30643810		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	27903802		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	28187038		★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	LHGDN	16428739		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	1832651, 27136893, 28659656		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	12051868		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	1832651		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	11665666, 11804955, 12372465, 1371258, 15472211, 17517439, 17997749, 20844546, 21272866, 21958553, 22509941, 22537218, 22841820, 23635948, 24935223, 25336714, 26337243, 29332562, 29669463, 29855537, 31248297, 31507610, 9239723		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	LHGDN	17919610		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	24272484, 24935223, 31248297	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Enterocolitis Necrotizing	Enterocolitis	Pubtator	34269788	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	21281963, 31499011		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	37052526	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	21211656, 28104354	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	28104354		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis Bullosa	BEFREE	2175579		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	16860990, 19162013, 24252240, 24515998, 28941295, 29201182, 29426321, 31698971		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	29426321, 7931344	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	7931344	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	10805326		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	12538625, 25195148, 8175024		★☆☆☆☆ Found in Text Mining only
Erdheim-Chester Disease	Erdheim-Chester Disease	BEFREE	29910817		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23726808, 31102307		★☆☆☆☆ Found in Text Mining only
Esophageal Diseases	Esophageal Diseases	BEFREE	14750640		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	23726808, 31102307		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	31102307	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37998338	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	14750640		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	26617860	Associate	★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	17353161		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fabry Disease	Fabry disease	Pubtator	17353161	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	10850859		★☆☆☆☆ Found in Text Mining only
Familial cold urticaria	Cold urticaria	BEFREE	14872505, 16981288, 17300660, 17320940, 18258152, 18668535, 18668591, 29282807		★☆☆☆☆ Found in Text Mining only
Familial Hemiplegic Migraine	Hemiplegic Migraine	BEFREE	31331109		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	29527701		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	31114367		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	22973830, 26965484, 30929860	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	LHGDN	16564703		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	21664615, 31494259		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	19135625, 20486195, 24515998, 26500244, 26813462, 27240522, 29808330, 31591845		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	2250017		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	16860990		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	30921378, 9263995		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	1322431		★☆☆☆☆ Found in Text Mining only
Funisitis (disorder)	Funisitis	CTD_human_DG	21493953		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	15885804		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	17295877, 18385937, 23995914		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	LHGDN	18288454		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	20482626, 23995914, 30105789	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	19030199	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	12854083, 15247172, 16405550		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	25910374	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	23806268		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	15481335, 19322919		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	19322919	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	19706801	Stimulate	★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	27105586, 28043870		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	9844760		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	26097611		★☆☆☆☆ Found in Text Mining only
Gingival Recession	Gingival Recession	BEFREE	11895546		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	12622850, 15830637		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	17460270, 20565898, 26396484, 30473883, 31379825		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	17149369, 20565898, 30465622	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	12913327, 17149369, 17460270, 20565898, 27533638, 29179746, 30465622		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10571418, 18819934, 19074142, 1937574, 25054228, 29734739, 8120140, 8175759, 8512018		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	18819934, 19074142, 24503185, 36272241, 38238463, 7531687, 9613677	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10571418, 18819934, 19074142, 1937574, 25054228, 29734739, 8175759, 8512018		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10571418, 16964394, 25054228, 25311416, 29486949, 30712887, 7814977		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24503185, 7521890, 8910439	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	9186886, 9263995		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	9186886, 9263995	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	10916103	Associate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid-remediable aldosteronism	Hyperaldosteronism	BEFREE	31050580		★☆☆☆☆ Found in Text Mining only
Gluten intolerance	Gluten intolerance	BEFREE	30240467		★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	33902703, 36550178, 38164346	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	12930389, 17391495	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	16019479, 17391495, 22469882, 28483765, 7652763, 8496391		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	37947315	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease, Chronic, X-Linked	Granulomatous Disease	BEFREE	8243611		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	16025481, 17964974, 24446657, 24465880, 29879187, 31399042, 8954062		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	16025481, 17964974, 24446657, 2680182	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	36561758	Stimulate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	23633206, 24446657	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	36561758	Stimulate	★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	2258703		★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	7625851		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	1572693		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	1993363	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	23718630, 34865658	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	17948066, 29549570, 30734265		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	17948066, 31632400	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	17503796, 29683921, 31632400	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	24531812, 28232838, 29141858, 29549570, 29584915, 29683921, 29904899, 30010800, 30033595, 31127805, 31415103		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	28483765, 28495184		★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	10916103	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	1333300	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	9767525	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	CTD_human_DG	15384034		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemophilia A	Hemophilia a	Pubtator	21362111	Associate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	26842496		★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	31494259	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	30600293	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	24025329	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	35801423	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	8706330	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	30679661	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	20942594		★☆☆☆☆ Found in Text Mining only
Hereditary Autoinflammatory Diseases	Autoinflammatory Disease	BEFREE	24422572, 29869008		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	31959131	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	19117745		★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	27982551, 28972431, 29129600, 30136871, 30528824, 30854183		★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	25889448, 30134914, 9355965		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	1312061, 1358770, 15954918, 26406983		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	1605306	Stimulate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	26406983, 2801887	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	15954918		★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	27777363	Associate	★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	2503474, 8287365		★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	Pubtator	8605359, 9618523	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	20070881, 28420489		★☆☆☆☆ Found in Text Mining only
Hyperferritinemia	Hyperferritinemia	Pubtator	30968645	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	LHGDN	18211631		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28939513		★☆☆☆☆ Found in Text Mining only
Hyperimmunoglobulinemia D	Hyperimmunoglobulinemia	BEFREE	24422572, 26819362		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	18290856, 28485095, 8196555		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	20385541		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	28143622, 29409499		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	34794403	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	19701653	Associate	★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	31411059	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	27662089	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	1458689, 34789453	Associate	★☆☆☆☆ Found in Text Mining only
Hypersplenism	Hypersplenism	BEFREE	22674409		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	27706611, 30864351	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	23153648	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	21840356, 27986554, 29143938, 29968152, 30672138, 31320452, 7946395		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	1373333	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31935962, 8901607	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	31698971		★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	10886238, 11092196		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28828907		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	11790645, 17309781, 19117745, 22059992, 29675024, 9186988		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	17309781		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	17309781	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	11793861, 11849463, 19280228, 24592969, 28875388, 9186886		★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	31843928		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	20004775, 28621240, 8894434		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	17483707, 21591983		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	20353899, 30760333, 3264774		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	11402127, 19158434, 28416092, 30843525		★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	18484169		★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	27981463		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11220627, 15223609, 16109659, 19643686, 25466956, 26590314, 27693323, 28420941, 28798075, 29515025, 31139196, 31191826, 31487960, 7586694, 7729636, 8440434, 8899101, 9414973, 9568467, 9771403		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17640979, 32020185, 33037057, 33201212, 34675383, 35212366, 9771403	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	9414973	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	17908936, 21881584, 22364598, 23407395, 24996260, 27020408, 27139015, 28323859, 29157812, 29203183, 29515113, 29744290, 30240702		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	25124963		★☆☆☆☆ Found in Text Mining only
INTERLEUKIN 1 RECEPTOR ANTAGONIST DEFICIENCY	INTERLEUKIN 1 RECEPTOR ANTAGONIST DEFICIENCY	BEFREE	22127713, 23917160		★☆☆☆☆ Found in Text Mining only
Intermittent Claudication	Claudication	Pubtator	36277021	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	15077300, 15308963, 16436110, 27253397, 27488379, 29319363, 29884765, 30875127		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	15987475, 16436110, 35578687, 40657044	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	39287911	Stimulate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	28081267, 29028103	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	17471097, 27253397, 29884765		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Displacement	Intervertebral disc displacement	Pubtator	25207923	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	23995914	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal polyposis	Pubtator	37889976	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	20495422, 26198819		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	33511216	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	15247174	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	19844779, 25073651, 31172560, 31366385, 31487960		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	17114844, 19786079, 22417897, 24063019, 29145255, 29567761, 30453020		★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	31666193		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	10342632, 12195624, 12794844, 15170937, 17324969, 18613829, 22124790, 27717726, 29426067, 29922038, 7558921, 7848312		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	BEFREE	29848388, 31829244		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10859633, 11001912, 29244209		★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	25307768, 28963928		★☆☆☆☆ Found in Text Mining only
Kearns-Sayre syndrome	Kearns Sayre Syndrome	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Keratitis Herpetic	Herpetic keratitis	Pubtator	32867704	Associate	★☆☆☆☆ Found in Text Mining only
Keratitis Ichthyosis Deafness Syndrome	Keratitis ichthyosis deafness syndrome	Pubtator	30150638	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	LHGDN	12613995		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	19043479, 23289806, 23592922, 26200829		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoconus	Keratoconus	Pubtator	23592922	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratocystic Odontogenic Tumor	Keratocystic Odontogenic Tumor	BEFREE	22582837		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	17258699		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	12631337, 15286433, 27306980, 29968152		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	12631337, 32733443, 37947315, 9767525	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	12136897, 16174285		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	12631337, 15954918, 7520955	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	12631337, 12837270, 15954918, 16088107, 16766392, 20551628		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	7710946	Associate	★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh syndrome	Pubtator	35103930	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	26917217	Associate	★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	Leopard syndrome	Pubtator	17114844	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	20640364	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	26610735		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11877295, 1536944, 1648979, 1695108, 1700730, 2046206, 2522658, 2526668, 2887587, 6351073, 7730146	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	2172158, 21816944, 2331674, 2887587		★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	2258703	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10586114, 1373331, 1695108, 1835893, 21520003, 2522658, 2665849, 3261773, 3498521, 36418348, 8805932	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	2679915	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	1699903, 1835893, 1918169, 21520003, 2207323, 2478222, 2788173, 28355571, 29773641, 3261773, 3316474, 7629564, 7967742, 8319777, 8361209, 8907269		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	11529470, 1883481, 2887587, 7628587		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	18186919	Associate	★☆☆☆☆ Found in Text Mining only
Lhermitte-Duclos disease	Lhermitte-Duclos disease	BEFREE	28081267		★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	BEFREE	29288588		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	22288582, 29288588		★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	9263995		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	15161051	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	1384466, 1846631, 19917630, 2156928, 2172789, 21750200, 24748463, 27092311, 29802240		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	14986816		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	11171832, 13130464, 1395121, 30600293	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	1772964	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	26481639, 28953903, 29366909		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10496524, 1384466, 1846631, 2156928, 2172789		★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	BEFREE	21616095, 29279288		★☆☆☆☆ Found in Text Mining only
Luft Disease	Luft Disease	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Lumbar disc disease	Lumbar Disc Disease	BEFREE	28081267		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	11241561, 19009622, 19431193, 25858413, 29233668, 29703138, 29884450, 31562126, 31715090		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	23153648, 29703138	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	36255321	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	16636934, 25963521, 9186988		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases, Obstructive	Lung Diseases	BEFREE	28223794, 31499011		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19505916, 23149083, 26506473, 35381771, 36149146	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	26506473		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37580655	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	11727511, 28396236		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	30130620	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	14672899, 25109676, 2974765	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	6229371	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	11727511, 28396236		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10643707, 11727511, 12111633, 14672899, 14872281, 17335370, 18613829, 20805419, 23722873, 23747396, 24055697, 25286391, 28396236, 29422069, 29611775, 30854270, 7653184		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	11727511, 28396236		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27866212	Associate	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	27460425	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	21325597, 28413901	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	LHGDN	18024394		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18038187, 2331674, 7691638		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	38489975	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	31139332, 31534633		★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Lymphomatoid Papulosis	BEFREE	20682698		★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	29922038, 31710506		★☆☆☆☆ Found in Text Mining only
Majeed syndrome	Majeed Syndrome	BEFREE	23087183		★☆☆☆☆ Found in Text Mining only
Majeed syndrome	Majeed syndrome	Pubtator	33314777	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	10483047, 24103372, 28122130, 7506108		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	7689482		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	25054228		★☆☆☆☆ Found in Text Mining only
Malignant hyperthermia susceptibility type 1	Malignant hyperthermia	Pubtator	36311488	Associate	★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25162674		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	25757056		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12451035, 14633625, 16115908, 16319982, 17010072, 17932347, 1832651, 19267917, 20127018, 21731759, 24670917, 24716804, 26909967, 27853906, 28405519, 29047186, 29402901, 29719585, 30012670, 30075885, 30217872, 30324661, 30670488, 31297985		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	1832651, 27136893, 28659656		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23726808, 31102307		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	18940468		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	23049925		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16126303, 17596594, 19505916, 29408308, 30832375		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	25981582, 27121322, 30191960		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	14504049, 17141301, 24272484, 30642295, 7603468		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	16209712, 21847358, 22819319, 30760333, 30988157		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16106254, 19099590, 24185914, 25374200, 27527810, 29023981, 29527701, 31730277		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	8435107		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12530098, 12854083, 12883469, 15233701, 15481335, 15551344, 15570075, 15927855, 16128937, 16143884, 17006981, 17096351, 17596959, 20200422, 23900673, 24557417, 25172489, 26632693, 26889982, 27460807, 28608600, 29344744		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31499272		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	16698387, 19489682, 27196763, 29684419		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12530098, 12598651, 14633625, 14984963, 1559228, 16489061, 16698387, 17006981, 17141301, 19513556, 21519029, 23049925, 23481102, 23542780, 23951028, 24024155, 24550720, 24561215, 25324197, 25453823, 26460957, 27121322, 27473228, 27786298, 27866212, 27919820, 28355571, 28483765, 28691536, 28735823, 28993621, 29217760, 29247991, 29584915, 30012670, 30217872, 30760333, 30995499, 31231372, 31359795, 31396219, 31410060, 31426445, 31499272, 31672283, 31830463, 7769852, 8231032		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	12820354, 24712845, 25925136, 27866212, 7594609		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16158955, 29062241, 8425199		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	36248906	Associate	★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15514971		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23704896, 28919995		★☆☆☆☆ Found in Text Mining only
Mandibulofacial Dysostosis	Mandibulofacial Dysostosis	BEFREE	30280214		★☆☆☆☆ Found in Text Mining only
Megaconial Myopathies	Megaconial Myopathies	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	BEFREE	29103192		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10358197, 12598651, 1372901, 1450672, 14522922, 15383566, 16489061, 17906119, 1883481, 20099279, 21954434, 22850568, 3262428, 8314311, 8576096		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10414467, 1347555, 1370233, 1372901, 15930731, 21954434, 22850568, 27549123, 32571981, 7823937, 8006453, 8102061, 9013579	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11399512, 24463459, 30149677, 9804820	Inhibit	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15737206		★☆☆☆☆ Found in Text Mining only
MELAS Syndrome	MELAS Syndrome	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory dysfunction	Memory Disorders	BEFREE	29292385		★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	21385326		★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere disease	Pubtator	34920656	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	10483047, 19158434, 22990943, 24103372, 26934083, 28203105, 29247999, 29894487, 30366016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	20574126, 21722710, 22990943, 24103372, 26002078		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Disorders, Severe	Mental Disorders	BEFREE	28815548		★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	BEFREE	10471494		★☆☆☆☆ Found in Text Mining only
MERRF Syndrome	MERRF Syndrome	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesenchymal Chondrosarcoma	Mesenchymal Chondrosarcoma	CTD_human_DG	12817616		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	23937860		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	25162674, 25757056	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	17097645, 20178882, 31488830		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	19619703	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	18191048, 18716798, 19619703, 28324042, 30006351, 30576798		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	2040010		★☆☆☆☆ Found in Text Mining only
Mevalonate Kinase Deficiency	Mevalonate kinase deficiency	Pubtator	34809655	Inhibit	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	12047332		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	30541566, 31658056		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	15866604		★☆☆☆☆ Found in Text Mining only
Mitochondrial Myopathies	Mitochondrial myopathy	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	10865086, 10871782		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	23527164, 2665838, 29214791		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	29018115	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26919242	Associate	★☆☆☆☆ Found in Text Mining only
Muckle-Wells Syndrome	Muckle-Wells Syndrome	BEFREE	14872505, 17763411, 18668535, 21360513, 24150829		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	15900570, 20600450, 21279638, 26941015, 27455075, 27694492, 28148962, 28400731, 30447136, 30996002, 31758701		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	20600450, 33023630, 3491174, 35861833	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17926179, 2665838, 7510989		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	17926179		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	2786435, 9886334	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10685855, 10814801, 10865086, 10871782, 11311293, 11498264, 12161036, 14664464, 18322311, 19876593, 20192980, 21621860, 21676896, 22406096, 23052182, 23594042, 26531703, 27432634, 27827809, 27878760, 28583987, 28922099, 31231388, 9413274		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	17258784, 18322311, 2458871	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	28129679	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	11777547, 20942939, 9521608, 9916896		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	28159737		★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	22906243		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	1533785, 17391495, 2043482, 30514753		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorder Chronic with Eosinophilia	Myeloproliferative disorder	Pubtator	37250098	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	11527622, 19811432, 20070880, 20178882, 21199393, 29310992, 30010800, 31077280, 31393855, 31469975		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	18336824, 20070880, 20070881, 20619343, 24530664, 27832202	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	11133172, 28477538		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	28232838, 28400731, 29904899, 31099056		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	10886238, 17265504, 8557829		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	10886238, 36159840	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	12631337	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	33172487	Stimulate	★☆☆☆☆ Found in Text Mining only
Nakajo syndrome	Nakajo Syndrome	BEFREE	22288582		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	11418661, 12752325		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	33005006, 36168003	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	10197635, 1325786, 18798303, 21154765, 24952889		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22320262, 24952889	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	22606320, 29784900, 31786582		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10233685, 10496524, 10552343, 10871749, 11212256, 11606496, 12147202, 12530098, 12598651, 12759452, 12865923, 1315829, 1372901, 14522922, 14633625, 15570075, 16158955, 16464738, 16489061, 1690240, 1968360, 20099279, 21196890, 21277871, 21519029, 21750200, 21765471, 21847358, 21954434, 22363134, 22850568, 23023398, 23846687, 24183701, 24550720, 25453823, 25846650, 25911129, 25981582, 26460957, 26506473, 26718030, 26909967, 27121322, 27473228, 27786298, 27866212, 28522598, 28606052, 28608600, 28927416, 29124765, 29150554, 29502208, 29550799, 29556001, 29559744, 30324661, 30460760, 30572269, 30670488, 30742987, 30760333, 30890189, 31044438, 31297985, 31359795, 31410060, 31426445, 31662289, 7603468, 8125795, 8435107, 8479752, 9007702, 9739785		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	22975019		★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Interstitial nephritis	Pubtator	8258957	Associate	★☆☆☆☆ Found in Text Mining only
Nephrocalcinosis	Nephrocalcinosis	BEFREE	29241624		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	17258699		★☆☆☆☆ Found in Text Mining only
Nephronophthisis	Nephronophthisis	BEFREE	31676329		★☆☆☆☆ Found in Text Mining only
Nephronophthisis 1	Nephronophthisis	BEFREE	7789968		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	31115030		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20716963		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	33931964, 9459616	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	9003059	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	18279308, 18760325, 30658261		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	9007702		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	29372388		★☆☆☆☆ Found in Text Mining only
Neuropathy, Painful	Neuropathy	BEFREE	29372388		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	24172847, 2503474, 29103994, 30095600, 7628587		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	21154765		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	21664615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28627263, 29665983, 31044438		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16489061, 26791086, 29734739		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	21664615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	21664615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	30836740		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18191048, 18716798, 22216303, 24034586, 25182023, 25216251, 27726910, 28324042, 28659656, 29791847, 30002491, 31042669, 31488830, 31749969		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18239554, 19218687, 20825686, 35139823, 36311488, 37047308, 40528195	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28019133, 34283808	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	21394384	Associate	★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	30594753		★☆☆☆☆ Found in Text Mining only
Odontogenic Tumors	Odontogenic Tumor	LHGDN	18624935		★☆☆☆☆ Found in Text Mining only
Odontogenic Tumors	Odontogenic Tumor	BEFREE	21196890, 22582837		★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral Mucositis	Oral Mucositis	BEFREE	28403570		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	25981582, 27121322, 30191960		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	25981582, 27121322, 36426368	Associate	★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	16257277, 21917472		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	15077300, 15094134, 16141526, 17532232, 1993047, 20131253, 20592454, 23216199, 24767790, 28323859, 29996115	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	15077300, 17532232	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	12115182, 12801479, 20592454, 23216199, 28964890, 37198429	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	12115182, 19733643, 21671260		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	LHGDN	12115182		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	15190266, 23602982, 27980229, 29424905, 30653843		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	12749050, 28682145, 29912021		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	18971305, 19821768, 28682145, 32454789	Associate	★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	22975999	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	10052770, 11329621, 11453239, 12546099, 12562360, 12869004, 16126903, 17209795, 17258699, 17954336, 18166103, 18640288, 21449691, 22101928, 22392845, 29571257, 31389012, 9763149		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	LHGDN	15587751		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	BEFREE	16550727, 22380539, 22868802		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	20940514	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	22380539	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	10330423, 9763149		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	11485304, 3493322, 9661070, 9973598		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	12930967	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian adenocarcinoma	Ovarian adenocarcinoma	BEFREE	15870720		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	7603468		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	14504049	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	31332247		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	14504049, 17141301, 24272484, 30642295		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	14674121		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22282663, 24272484	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16209712, 21847358, 22819319, 27473228, 30760333, 30988157, 7532161		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	22264792, 23951028, 30737215		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12931024, 16504015		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	29308316		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	14679213, 16209712, 16504015, 21847358, 23951028, 27435927, 27473228, 31288851, 35523176	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	27473228	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	22819319		★☆☆☆☆ Found in Text Mining only
Panniculitis	Panniculitis	BEFREE	22288582		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	24453029, 27533309		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	12759452		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	24449512, 35334093	Associate	★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic syndrome	Pubtator	32771066	Inhibit	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	12052541, 17458495, 20427258, 20561568, 27356916, 29572994, 29947088, 30041526, 30063943, 30554092, 31205938		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26911448	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	38485911	Inhibit	★☆☆☆☆ Found in Text Mining only
Pelger-Huet Anomaly	Pelger-Huet Anomaly	BEFREE	3494073		★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	27868136, 31001258, 35140724	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid, Benign Mucous Membrane	Mucous membrane pemphigoid	LHGDN	11448121		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	31001258	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	31057535		★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile neoplasm	Pubtator	37763742	Associate	★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	15885804, 8558837		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	29306532		★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	BEFREE	28633474, 29910817, 31437316		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	10052770, 10599909, 10685360, 10711605, 11145356, 11669478, 11737511, 12546098, 12598547, 12702109, 14514232, 14974822, 15903175, 16945028, 17458052, 17960403, 18315433, 20335539, 20490394, 21035110, 21414132, 2141875, 21449691, 21712624, 22348697, 23241110, 24460370, 27569042, 27665233, 27987116, 29360244, 29577711, 30445239, 9846737		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	19671938, 24460370, 36429405	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	10397510, 10685360, 10711606, 11073323, 11332522, 11350506, 11453239, 11737511, 11858158, 12974682, 14584862, 15068111, 15966908, 15974847, 16304445, 16470016, 16881809, 16931944, 17214636, 17335370, 17378887, 17960403, 18052703, 18166103, 18315433, 18723088, 19563289, 19792847, 20027454, 20450372, 20490394, 2053589, 21035110, 21054222, 2141875, 21672595, 21712624, 22348697, 22795294, 23100272, 23592003, 24275344, 24818754, 24843315, 26445016, 26449434, 26576766, 26909953, 27541081, 27569042, 28766990, 29023524, 29571257, 30142580, 31324923, 31389012, 8809309, 9049801		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	LHGDN	15974847, 17378887, 18052703, 18315433		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	18723088, 21712624, 22124068, 23046796, 23592003, 23752171, 24690098, 24843315, 26449434, 26576766, 28766990, 29023524, 32618013, 35844512, 35855430, 36429405, 8809309, 9507015	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	9010272	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	30773823		★☆☆☆☆ Found in Text Mining only
Peroxisomal ACYL-COA oxidase deficiency	Peroxisomal Acyl-CoA Oxidase Deficiency	BEFREE	22508517		★☆☆☆☆ Found in Text Mining only
Peroxisome Biogenesis Disorder, Complementation Group D	Zellweger Syndrome	BEFREE	8243611		★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	31733276		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	8939459		★☆☆☆☆ Found in Text Mining only
PLCG2-associated antibody deficiency and immune dysregulation	Antibody Deficiency And Immune Dysregulation	BEFREE	27442322		★☆☆☆☆ Found in Text Mining only
Pleoconial Myopathies	Pleoconial myopathy	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy	Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy	Pubtator	19125864	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	16965825, 19191034, 22553983, 28485095, 28949260, 29359480, 29859385, 30546347, 30963410, 31139895, 31298309		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	16965825		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	27908212	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	28949260	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	10693873	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis	Polymyositis	Pubtator	11953983, 17265504	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis	Polymyositis	BEFREE	17265504		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis	Polymyositis	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis Ossificans	Polymyositis Ossificans	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis, Idiopathic	Polymyositis	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	7769852		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	8137887		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	12909295, 15201366, 16226351, 17622713, 19158434, 21509504, 21968104, 24103372		★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	17460270		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	8706330		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	23710539	Associate	★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	3264774		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	10925316, 22906243		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	11492971		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	28382439		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16106254, 18752500, 19099590, 24185914, 25374200, 27527810, 29023981, 29527701, 31730277		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	10880394, 15042672	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19099590, 29527701, 31730277	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	29502208		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	8258957	Associate	★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	38489975	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	23359500		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11518726, 12763679, 12890860, 16460958, 17591951, 21242515, 21574971, 21881584, 2191038, 2258628, 23435685, 24665164, 25305315, 27887936, 28060905, 28323859, 28857172, 29535706, 29744290, 30514663, 30574739, 31231388, 31427775, 9058835		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	18669614, 19166933, 28042206, 28323859, 31286990, 34992498, 38003437	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	25330301, 33117362	Stimulate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	30836740		★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	29484482		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	39930365	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19279357, 27418555, 28223794, 28546273, 30280794, 34348529	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24992168	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	27007676, 28528200		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19633559, 30042768		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pustular psoriasis	Pustular Psoriasis	BEFREE	23291100, 30157880, 30643810		★☆☆☆☆ Found in Text Mining only
Pyogenic Arthritis, Pyoderma Gangrenosum and Acne	Pyogenic Arthritis, Pyoderma Gangrenosum And Acne	BEFREE	27464597, 28588486		★☆☆☆☆ Found in Text Mining only
Raynaud Disease	Raynaud Disease	BEFREE	16981288		★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	15257727, 26819362, 29578360		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	26385127, 28543912, 29641282		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	29268236		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25453823, 28915570		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	12136897, 28359253, 9767525		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	11182149, 31057533		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	18065658, 1883957, 23449693, 25089931, 25849954		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	11880307, 14605255, 31659629		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	11182149		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29551335		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	29551335	Associate	★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	31379825		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	8621439		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	31379825		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	20716963		★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	29568872		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	16043936, 27118427		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10210770, 10366101, 10384145, 10402163, 10441334, 10600505, 10976082, 11406520, 11477478, 11791644, 11930657, 11966774, 12028539, 12077707, 12115161, 12220548, 12598651, 12763679, 12932294, 1320571, 1371728, 1386092, 1395121, 1458286, 14872281, 15314683, 15464974, 1550404, 15541037, 15896202, 15939878, 16096333, 16406555, 16886894, 16947381, 1698773, 1714478, 17207379, 17335371, 17609389, 18052703, 18468936, 18576312, 18667700, 18728048, 18759964, 19004046, 1917593, 19328245, 19804846, 20001767, 20074281, 20141484, 2026869, 2174073, 21798287, 22040886, 22258493, 22288582, 23272690, 23277489, 23317890, 23635711, 24014495, 24131486, 24397353, 24534470, 24767864, 25726324, 26003199, 26718437, 27001429, 27105431, 27603301, 27820799, 28358286, 28408798, 28490617, 29268236, 29633070, 30001644, 30272996, 30459597, 30557124, 30574739, 30762811, 30924147, 31231388, 31295961, 31513665, 31585899, 3264773, 7554443, 7622181, 7633938, 7809909, 8185691, 8507220, 8608352, 9120311, 9525978, 9613344, 9646842		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12928381, 18052703		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sacroiliitis	Sacroiliitis	BEFREE	31813060		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	10527395, 11790645, 12737276, 3297354, 9186988		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	18654018	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	30963193	Stimulate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10208450, 11423178, 12804791, 14563376, 14997019, 15318032, 16856121, 17510951, 17610660, 19125864, 20347268, 25858413, 28083609, 28126482, 31473906		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	19125864	Associate	★☆☆☆☆ Found in Text Mining only
Schnitzler Syndrome	Schnitzler Syndrome	BEFREE	19608676, 23527164, 27501129, 28718061, 29214791, 29284595, 30108026, 30668200		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	29203183		★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	12528118	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	11083268, 12528118, 19536281, 22879895, 8082299	Associate	★☆☆☆☆ Found in Text Mining only
Seborrheic dermatitis	Seborrheic dermatitis	BEFREE	28588486		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	29426321	Associate	★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	10959036, 12218254		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	32496420	Stimulate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	36551320	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	12117955, 16528020, 21933552, 22288582, 24428862, 26312770, 26561011, 29859746, 30305325, 30587411, 30926232, 31125901, 31323346, 7680670		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	1377699		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	2565739	Associate	★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	19158434		★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	BEFREE	27927236		★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	BEFREE	10052770, 10397510, 10551423, 10711605, 10863964, 11145356, 11737511, 12546099, 17209795, 18166103, 21672595, 22348697, 23241110, 24690098, 24843315, 31324923, 9049801		★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	29618653		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	8955214		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	16291395, 27388993	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Erosion	Skin Erosion	BEFREE	20141484, 20472585, 21859345		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	19477321, 25299544, 28396236, 29771405		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	8435107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea Obstructive	Sleep apnea	Pubtator	19218687, 19581829, 20847078	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	24293770	Stimulate	★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	31666193		★☆☆☆☆ Found in Text Mining only
Split hand foot deformity 1	Split hand foot deformity	BEFREE	28617889, 29910817		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	16947381, 19900269, 22312160, 7622181		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	15309690, 16361275, 20062062, 28423679, 33480001	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21146373, 22796477, 8098727, 8555013, 9039974		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17465207, 37391526	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25981582, 26460957, 31548455, 33232279, 35267186, 35334093, 36614130	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	25981582, 27121322		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17465207, 25712126, 26460957, 27738319, 30890189, 8820364		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CTD_human_DG	27738319		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29853279		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29549796, 30278465, 30843525		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	21664615, 25216251		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11606496, 12530098, 12594817, 12854083, 12883469, 15233701, 15481335, 15551344, 15570075, 15688413, 15704154, 15927855, 16128937, 16143884, 17006981, 17096351, 17596959, 20200422, 23900673, 24557417, 24615437, 25172489, 25740226, 26632693, 26889982, 27460807, 28608600, 29344744		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	20574123	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	22714811		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10746728, 1331059, 20482626, 23323013, 23900673, 23995914, 26632693, 26889982, 27832202, 28110439, 39781526, 9414656, 9422527	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16101131, 18395750		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16101131	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	25172489		★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	LHGDN	17960403		★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	28403570		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	23076369	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	23076369, 32503645	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	15726267, 20495422, 28682429, 31554320		★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	22512814		★☆☆☆☆ Found in Text Mining only
Sveinsson Chorioretinal Atrophy	Sveinsson chorioretinal atrophy	Pubtator	37747561	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	9739785		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	11561109, 1707461, 30653843		★☆☆☆☆ Found in Text Mining only
SYNOVITIS, GRANULOMATOUS, WITH UVEITIS AND CRANIAL NEUROPATHIES (disorder)	Arthrocutaneouveal granulomatosis	BEFREE	19180500, 28032234		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	15851489, 17724127, 17963170, 18418395, 29663156, 29848367, 29922038, 29928998, 30647180, 31599092, 31829244		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11083268, 12528118, 12528119, 1375465, 14705223, 16636934, 17440718, 17444587, 17584583, 18396211, 18576303, 24982919, 26416393, 27098064, 29203183, 30042768, 30997045, 31320452, 31572353, 8082299, 9373715		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	12528118, 12528119, 12913118, 14705223, 15468358, 17440718		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	3494073		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	23472661		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	20920788		★☆☆☆☆ Found in Text Mining only
Tendinitis	Tendinitis	BEFREE	30256459		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	30256459		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	17215863		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	21839492		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	19702713, 23633206, 24446657, 26578206, 31399042, 8954062, 9112998		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	24453029, 35515000	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	1322431, 31499272		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31499272		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	17964974, 32182948	Associate	★☆☆☆☆ Found in Text Mining only
Tooth Diseases	Tooth disease	Pubtator	32952230	Associate	★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de Pointes	BEFREE	28490617		★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	26097611	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	16698387		★☆☆☆☆ Found in Text Mining only
Transposition of Great Vessels	Transposition of the great arteries	Pubtator	35590253	Associate	★☆☆☆☆ Found in Text Mining only
Treatment related secondary malignancy	Treatment Related Secondary Malignancy	BEFREE	28483765		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	29766377		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37551997	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38305604, 40528195	Associate	★☆☆☆☆ Found in Text Mining only
TUMORAL CALCINOSIS, HYPERPHOSPHATEMIC, FAMILIAL	Tumoral calcinosis	BEFREE	27164190		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	12572877, 18942751, 20975573, 23195532, 26530134, 29366788, 31102937, 7586694, 8440434, 8899101, 9414973, 9933456		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	10483047, 24103372, 7506108		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	11161396, 33267794	Associate	★☆☆☆☆ Found in Text Mining only
Urolithiasis	Urolithiasis	BEFREE	18186699		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	17300660, 23527164, 31837215		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23099807, 25925136, 27866212	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37580647	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	21519029		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	19657978, 26487500, 27981463, 28032234, 29424312, 30148652		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	23124805	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	17293495, 24063019, 24612355, 30089839, 31081038		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	2103309, 24063019, 24612355	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	10948142	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	11094434, 27455075, 27981463, 28148962, 30996002, 31758701, 9186886		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	34809655, 3491091, 9186886	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	37762110	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	23583823	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	19129082		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	CTD_human_DG	28836394		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	19129082		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	8137887		★☆☆☆☆ Found in Text Mining only
X-Linked Lymphoproliferative Disorder	Lymphoproliferative Syndrome, X-Linked	BEFREE	20682698		★☆☆☆☆ Found in Text Mining only
Young onset Parkinson disease	Parkinson disease	BEFREE	15050696		★☆☆☆☆ Found in Text Mining only