Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	3586
Gene name	Interleukin 10
Gene symbol	IL10
Synonyms (NCBI Gene)	CSIFGVHDSIL-10IL10ATGIF
Chromosome	1
Chromosome location	1q32.1
Summary	The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class

231

Show/Hide all (231)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005082	hsa-miR-106a-5p	Luciferase reporter assayqRT-PCR	19307576
MIRT054365	hsa-let-7c-5p	Luciferase reporter assayqRT-PCR	22835429
MIRT054365	hsa-let-7c-5p	Luciferase reporter assayqRT-PCR	22835429
MIRT731372	hsa-miR-194-5p	Luciferase reporter assayMicroarrayqRT-PCR	26147452
MIRT731372	hsa-miR-194-5p	Luciferase reporter assayMicroarrayqRT-PCR	26147452
MIRT734608	hsa-miR-1-3p	qRT-PCRFlow cytometry	33584638
MIRT734609	hsa-miR-20a-3p	qRT-PCRFlow cytometry	33584638
MIRT734610	hsa-miR-28-3p	qRT-PCRFlow cytometry	33584638
MIRT734611	hsa-miR-95-3p	qRT-PCRFlow cytometry	33584638
MIRT734612	hsa-miR-146a-3p	qRT-PCRFlow cytometry	33584638
MIRT734613	hsa-miR-335-3p	qRT-PCRFlow cytometry	33584638
MIRT734614	hsa-miR-625-3p	qRT-PCRFlow cytometry	33584638
MIRT736457	hsa-miR-3928-5p	Western blottingqRT-PCR	33125125
MIRT736491	hsa-miR-21-3p	ImmunofluorescenceqRT-PCRELISA	33110923
MIRT756216	hsa-miR-374b-5p	Luciferase reporter assayWestern blottingqRT-PCR	36437465
MIRT1063421	hsa-miR-106a	CLIP-seq
MIRT1063422	hsa-miR-106b	CLIP-seq
MIRT1063423	hsa-miR-1236	CLIP-seq
MIRT1063424	hsa-miR-1245	CLIP-seq
MIRT1063425	hsa-miR-1321	CLIP-seq
MIRT1063426	hsa-miR-150	CLIP-seq
MIRT1063427	hsa-miR-1587	CLIP-seq
MIRT1063428	hsa-miR-17	CLIP-seq
MIRT1063429	hsa-miR-20a	CLIP-seq
MIRT1063430	hsa-miR-20b	CLIP-seq
MIRT1063431	hsa-miR-302a	CLIP-seq
MIRT1063432	hsa-miR-302b	CLIP-seq
MIRT1063433	hsa-miR-302c	CLIP-seq
MIRT1063434	hsa-miR-302d	CLIP-seq
MIRT1063435	hsa-miR-302e	CLIP-seq
MIRT1063436	hsa-miR-3074-3p	CLIP-seq
MIRT1063437	hsa-miR-3135b	CLIP-seq
MIRT1063438	hsa-miR-3652	CLIP-seq
MIRT1063439	hsa-miR-369-3p	CLIP-seq
MIRT1063440	hsa-miR-372	CLIP-seq
MIRT1063441	hsa-miR-373	CLIP-seq
MIRT1063442	hsa-miR-374a	CLIP-seq
MIRT1063443	hsa-miR-374b	CLIP-seq
MIRT1063444	hsa-miR-3914	CLIP-seq
MIRT1063445	hsa-miR-4253	CLIP-seq
MIRT1063446	hsa-miR-4270	CLIP-seq
MIRT1063447	hsa-miR-4419a	CLIP-seq
MIRT1063448	hsa-miR-4430	CLIP-seq
MIRT1063449	hsa-miR-4441	CLIP-seq
MIRT1063450	hsa-miR-4510	CLIP-seq
MIRT1063451	hsa-miR-4668-5p	CLIP-seq
MIRT1063452	hsa-miR-4674	CLIP-seq
MIRT1063453	hsa-miR-4688	CLIP-seq
MIRT1063454	hsa-miR-4731-5p	CLIP-seq
MIRT1063455	hsa-miR-4739	CLIP-seq
MIRT1063456	hsa-miR-4753-3p	CLIP-seq
MIRT1063457	hsa-miR-4756-5p	CLIP-seq
MIRT1063458	hsa-miR-4768-5p	CLIP-seq
MIRT1063459	hsa-miR-496	CLIP-seq
MIRT1063460	hsa-miR-512-3p	CLIP-seq
MIRT1063461	hsa-miR-519d	CLIP-seq
MIRT1063462	hsa-miR-520a-3p	CLIP-seq
MIRT1063463	hsa-miR-520b	CLIP-seq
MIRT1063464	hsa-miR-520c-3p	CLIP-seq
MIRT1063465	hsa-miR-520d-3p	CLIP-seq
MIRT1063466	hsa-miR-520e	CLIP-seq
MIRT1063467	hsa-miR-520g	CLIP-seq
MIRT1063468	hsa-miR-520h	CLIP-seq
MIRT1063469	hsa-miR-570	CLIP-seq
MIRT1063470	hsa-miR-640	CLIP-seq
MIRT1063471	hsa-miR-877	CLIP-seq
MIRT1063472	hsa-miR-93	CLIP-seq
MIRT1550094	hsa-miR-1	CLIP-seq
MIRT1550095	hsa-miR-206	CLIP-seq
MIRT1550096	hsa-miR-3155	CLIP-seq
MIRT1550097	hsa-miR-3155b	CLIP-seq
MIRT1550098	hsa-miR-3673	CLIP-seq
MIRT1550099	hsa-miR-484	CLIP-seq
MIRT1550100	hsa-miR-613	CLIP-seq
MIRT1063424	hsa-miR-1245	CLIP-seq
MIRT2014982	hsa-miR-197	CLIP-seq
MIRT1063437	hsa-miR-3135b	CLIP-seq
MIRT2014983	hsa-miR-3149	CLIP-seq
MIRT2014984	hsa-miR-3194-3p	CLIP-seq
MIRT1063438	hsa-miR-3652	CLIP-seq
MIRT2014985	hsa-miR-411	CLIP-seq
MIRT2014986	hsa-miR-431	CLIP-seq
MIRT1063448	hsa-miR-4430	CLIP-seq
MIRT1063453	hsa-miR-4688	CLIP-seq
MIRT2014987	hsa-miR-4716-5p	CLIP-seq
MIRT2014988	hsa-miR-4735-5p	CLIP-seq
MIRT2014989	hsa-miR-4775	CLIP-seq
MIRT2014990	hsa-miR-4797-5p	CLIP-seq
MIRT2014991	hsa-miR-483-5p	CLIP-seq
MIRT2014992	hsa-miR-5096	CLIP-seq
MIRT2014993	hsa-miR-590-3p	CLIP-seq
MIRT1063470	hsa-miR-640	CLIP-seq
MIRT2014994	hsa-miR-924	CLIP-seq
MIRT1063421	hsa-miR-106a	CLIP-seq
MIRT1063422	hsa-miR-106b	CLIP-seq
MIRT1063424	hsa-miR-1245	CLIP-seq
MIRT2247336	hsa-miR-129-5p	CLIP-seq
MIRT1063426	hsa-miR-150	CLIP-seq
MIRT1063428	hsa-miR-17	CLIP-seq
MIRT1063429	hsa-miR-20a	CLIP-seq
MIRT1063430	hsa-miR-20b	CLIP-seq
MIRT1063431	hsa-miR-302a	CLIP-seq
MIRT1063432	hsa-miR-302b	CLIP-seq
MIRT1063433	hsa-miR-302c	CLIP-seq
MIRT1063434	hsa-miR-302d	CLIP-seq
MIRT1063435	hsa-miR-302e	CLIP-seq
MIRT1063436	hsa-miR-3074-3p	CLIP-seq
MIRT1063437	hsa-miR-3135b	CLIP-seq
MIRT2014983	hsa-miR-3149	CLIP-seq
MIRT2014984	hsa-miR-3194-3p	CLIP-seq
MIRT1063438	hsa-miR-3652	CLIP-seq
MIRT2247337	hsa-miR-3672	CLIP-seq
MIRT1063440	hsa-miR-372	CLIP-seq
MIRT1063441	hsa-miR-373	CLIP-seq
MIRT1063445	hsa-miR-4253	CLIP-seq
MIRT2014986	hsa-miR-431	CLIP-seq
MIRT1063448	hsa-miR-4430	CLIP-seq
MIRT1063453	hsa-miR-4688	CLIP-seq
MIRT1063454	hsa-miR-4731-5p	CLIP-seq
MIRT2014988	hsa-miR-4735-5p	CLIP-seq
MIRT1063456	hsa-miR-4753-3p	CLIP-seq
MIRT2014989	hsa-miR-4775	CLIP-seq
MIRT2247338	hsa-miR-4783-5p	CLIP-seq
MIRT2247339	hsa-miR-5095	CLIP-seq
MIRT1063460	hsa-miR-512-3p	CLIP-seq
MIRT1063461	hsa-miR-519d	CLIP-seq
MIRT1063462	hsa-miR-520a-3p	CLIP-seq
MIRT1063463	hsa-miR-520b	CLIP-seq
MIRT1063464	hsa-miR-520c-3p	CLIP-seq
MIRT1063465	hsa-miR-520d-3p	CLIP-seq
MIRT1063466	hsa-miR-520e	CLIP-seq
MIRT1063467	hsa-miR-520g	CLIP-seq
MIRT1063468	hsa-miR-520h	CLIP-seq
MIRT2247340	hsa-miR-552	CLIP-seq
MIRT2247341	hsa-miR-562	CLIP-seq
MIRT2014993	hsa-miR-590-3p	CLIP-seq
MIRT1063470	hsa-miR-640	CLIP-seq
MIRT2247342	hsa-miR-764	CLIP-seq
MIRT2014994	hsa-miR-924	CLIP-seq
MIRT1063472	hsa-miR-93	CLIP-seq
MIRT1063436	hsa-miR-3074-3p	CLIP-seq
MIRT1063437	hsa-miR-3135b	CLIP-seq
MIRT1063438	hsa-miR-3652	CLIP-seq
MIRT1063445	hsa-miR-4253	CLIP-seq
MIRT1063448	hsa-miR-4430	CLIP-seq
MIRT1063453	hsa-miR-4688	CLIP-seq
MIRT1063427	hsa-miR-1587	CLIP-seq
MIRT1063439	hsa-miR-369-3p	CLIP-seq
MIRT1063442	hsa-miR-374a	CLIP-seq
MIRT1063443	hsa-miR-374b	CLIP-seq
MIRT2437783	hsa-miR-4263	CLIP-seq
MIRT1063452	hsa-miR-4674	CLIP-seq
MIRT2437784	hsa-miR-4799-5p	CLIP-seq
MIRT2437785	hsa-miR-576-5p	CLIP-seq
MIRT1063427	hsa-miR-1587	CLIP-seq
MIRT1063439	hsa-miR-369-3p	CLIP-seq
MIRT1063442	hsa-miR-374a	CLIP-seq
MIRT1063443	hsa-miR-374b	CLIP-seq
MIRT2437783	hsa-miR-4263	CLIP-seq
MIRT1063452	hsa-miR-4674	CLIP-seq
MIRT2437784	hsa-miR-4799-5p	CLIP-seq
MIRT2437785	hsa-miR-576-5p	CLIP-seq
MIRT1063425	hsa-miR-1321	CLIP-seq
MIRT2014983	hsa-miR-3149	CLIP-seq
MIRT2014985	hsa-miR-411	CLIP-seq
MIRT1063447	hsa-miR-4419a	CLIP-seq
MIRT1063450	hsa-miR-4510	CLIP-seq
MIRT2014988	hsa-miR-4735-5p	CLIP-seq
MIRT1063455	hsa-miR-4739	CLIP-seq
MIRT1063457	hsa-miR-4756-5p	CLIP-seq
MIRT2014989	hsa-miR-4775	CLIP-seq
MIRT2247338	hsa-miR-4783-5p	CLIP-seq
MIRT2014991	hsa-miR-483-5p	CLIP-seq
MIRT2451691	hsa-miR-577	CLIP-seq
MIRT2014993	hsa-miR-590-3p	CLIP-seq
MIRT2247342	hsa-miR-764	CLIP-seq
MIRT1063471	hsa-miR-877	CLIP-seq
MIRT1063425	hsa-miR-1321	CLIP-seq
MIRT2014983	hsa-miR-3149	CLIP-seq
MIRT2014985	hsa-miR-411	CLIP-seq
MIRT1063447	hsa-miR-4419a	CLIP-seq
MIRT1063450	hsa-miR-4510	CLIP-seq
MIRT2014988	hsa-miR-4735-5p	CLIP-seq
MIRT1063455	hsa-miR-4739	CLIP-seq
MIRT1063457	hsa-miR-4756-5p	CLIP-seq
MIRT2014989	hsa-miR-4775	CLIP-seq
MIRT2247338	hsa-miR-4783-5p	CLIP-seq
MIRT2014991	hsa-miR-483-5p	CLIP-seq
MIRT2451691	hsa-miR-577	CLIP-seq
MIRT2014993	hsa-miR-590-3p	CLIP-seq
MIRT1063471	hsa-miR-877	CLIP-seq
MIRT2550753	hsa-miR-1343	CLIP-seq
MIRT1063426	hsa-miR-150	CLIP-seq
MIRT2014982	hsa-miR-197	CLIP-seq
MIRT2550754	hsa-miR-1976	CLIP-seq
MIRT2014983	hsa-miR-3149	CLIP-seq
MIRT2014985	hsa-miR-411	CLIP-seq
MIRT2014987	hsa-miR-4716-5p	CLIP-seq
MIRT2014988	hsa-miR-4735-5p	CLIP-seq
MIRT2014989	hsa-miR-4775	CLIP-seq
MIRT2247338	hsa-miR-4783-5p	CLIP-seq
MIRT2014991	hsa-miR-483-5p	CLIP-seq
MIRT2550755	hsa-miR-498	CLIP-seq
MIRT2014992	hsa-miR-5096	CLIP-seq
MIRT2014993	hsa-miR-590-3p	CLIP-seq
MIRT2550756	hsa-miR-891b	CLIP-seq
MIRT2550753	hsa-miR-1343	CLIP-seq
MIRT1063426	hsa-miR-150	CLIP-seq
MIRT2014982	hsa-miR-197	CLIP-seq
MIRT2550754	hsa-miR-1976	CLIP-seq
MIRT1063436	hsa-miR-3074-3p	CLIP-seq
MIRT1063437	hsa-miR-3135b	CLIP-seq
MIRT2014983	hsa-miR-3149	CLIP-seq
MIRT1063438	hsa-miR-3652	CLIP-seq
MIRT2014985	hsa-miR-411	CLIP-seq
MIRT1063445	hsa-miR-4253	CLIP-seq
MIRT1063448	hsa-miR-4430	CLIP-seq
MIRT1063453	hsa-miR-4688	CLIP-seq
MIRT2014987	hsa-miR-4716-5p	CLIP-seq
MIRT2014988	hsa-miR-4735-5p	CLIP-seq
MIRT2682724	hsa-miR-4772-3p	CLIP-seq
MIRT2014989	hsa-miR-4775	CLIP-seq
MIRT2247338	hsa-miR-4783-5p	CLIP-seq
MIRT2014991	hsa-miR-483-5p	CLIP-seq
MIRT2550755	hsa-miR-498	CLIP-seq
MIRT2247339	hsa-miR-5095	CLIP-seq
MIRT2014992	hsa-miR-5096	CLIP-seq
MIRT2247340	hsa-miR-552	CLIP-seq
MIRT2014993	hsa-miR-590-3p	CLIP-seq
MIRT2247342	hsa-miR-764	CLIP-seq
MIRT2550756	hsa-miR-891b	CLIP-seq

Show/Hide all (27)

Transcription factor	Regulation	Reference
ATF1	Activation	10540320
CEBPA	Unknown	12219016
CEBPB	Unknown	12493739
CREB1	Activation	10540320;22140263
CREB1	Unknown	17202341
FLI1	Activation	20879862
FOXP3	Unknown	24315995
GATA3	Unknown	21507199
HDAC11	Repression	19011628
HDAC4	Repression	17610967
IRF1	Activation	12817009
IRF8	Unknown	20709027
MSC	Activation	19561533
NFKB1	Activation	19124729
NFKB1	Unknown	9310124
NR1I2	Activation	22285937
PARP1	Unknown	20181890
PGR	Repression	18685848
REL	Unknown	9310124
RELA	Activation	19124729
SP1	Activation	21309719
SP1	Unknown	11278848;17202341
STAT1	Unknown	20709027
STAT3	Activation	12817009;18765795
STAT3	Unknown	10903771;15034082;17404037;18403020;19124156
TBX21	Unknown	21507199
VDR	Repression	20691220

111

Show/Hide all (111)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001818	Process	Negative regulation of cytokine production	IDA	1940799
GO:0001818	Process	Negative regulation of cytokine production	IEA
GO:0001819	Process	Positive regulation of cytokine production	IDA	10443688
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0002237	Process	Response to molecule of bacterial origin	IDA	17449476
GO:0002439	Process	Chronic inflammatory response to antigenic stimulus	IEA
GO:0002639	Process	Positive regulation of immunoglobulin production	IGI	22962438
GO:0002719	Process	Negative regulation of cytokine production involved in immune response	IDA	10443688
GO:0002875	Process	Negative regulation of chronic inflammatory response to antigenic stimulus	IEA
GO:0002904	Process	Positive regulation of B cell apoptotic process	IDA	9184696
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	24994464
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	NAS	10443688
GO:0005141	Function	Interleukin-10 receptor binding	IEA
GO:0005141	Function	Interleukin-10 receptor binding	NAS	1847510
GO:0005515	Function	Protein binding	IPI	11485736, 12513909, 15837194, 16982608, 20462497, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	24994464
GO:0005615	Component	Extracellular space	IDA	10443688, 21323571
GO:0005615	Component	Extracellular space	IEA
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0008083	Function	Growth factor activity	NAS	1371884
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010468	Process	Regulation of gene expression	IDA	9184696
GO:0010507	Process	Negative regulation of autophagy	IDA	26962683
GO:0014823	Process	Response to activity	IEA
GO:0014854	Process	Response to inactivity	IEA
GO:0030097	Process	Hemopoiesis	TAS	11244051
GO:0030183	Process	B cell differentiation	NAS	8228801
GO:0030595	Process	Leukocyte chemotaxis	TAS	9405662
GO:0030886	Process	Negative regulation of myeloid dendritic cell activation	IEA
GO:0030889	Process	Negative regulation of B cell proliferation	IDA	9184696
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032687	Process	Negative regulation of interferon-alpha production	NAS	9637497
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032692	Process	Negative regulation of interleukin-1 production	TAS	19262501
GO:0032695	Process	Negative regulation of interleukin-12 production	IEA
GO:0032695	Process	Negative regulation of interleukin-12 production	TAS	19262501
GO:0032701	Process	Negative regulation of interleukin-18 production	TAS	19262501
GO:0032715	Process	Negative regulation of interleukin-6 production	IDA	10443688
GO:0032715	Process	Negative regulation of interleukin-6 production	TAS	19262501
GO:0032717	Process	Negative regulation of interleukin-8 production	TAS	19262501
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	TAS	19262501
GO:0032868	Process	Response to insulin	IEA
GO:0034115	Process	Negative regulation of heterotypic cell-cell adhesion	IEA
GO:0034115	Process	Negative regulation of heterotypic cell-cell adhesion	ISS
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	ISS
GO:0034465	Process	Response to carbon monoxide	IEA
GO:0035729	Process	Cellular response to hepatocyte growth factor stimulus	IEA
GO:0042092	Process	Type 2 immune response	TAS	11244051
GO:0042100	Process	B cell proliferation	NAS	8228801
GO:0042130	Process	Negative regulation of T cell proliferation	NAS	8499633, 14971032
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042832	Process	Defense response to protozoan	IEA
GO:0043032	Process	Positive regulation of macrophage activation	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	NAS	8312229
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	IEA
GO:0045191	Process	Regulation of isotype switching	NAS	8228801
GO:0045347	Process	Negative regulation of MHC class II biosynthetic process	IDA	1940799
GO:0045347	Process	Negative regulation of MHC class II biosynthetic process	TAS	11244051
GO:0045348	Process	Positive regulation of MHC class II biosynthetic process	IEA
GO:0045787	Process	Positive regulation of cell cycle	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	16606666
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	17875732
GO:0045930	Process	Negative regulation of mitotic cell cycle	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7749983
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IBA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IDA	16982608
GO:0046983	Function	Protein dimerization activity	IDA	16982608
GO:0050728	Process	Negative regulation of inflammatory response	IBA
GO:0050728	Process	Negative regulation of inflammatory response	IDA	10443688
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	NAS	21857966
GO:0050807	Process	Regulation of synapse organization	IEA
GO:0051045	Process	Negative regulation of membrane protein ectodomain proteolysis	IDA	18383040
GO:0051384	Process	Response to glucocorticoid	IDA	10443688
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0060302	Process	Negative regulation of cytokine activity	IMP	9847016
GO:0060670	Process	Branching involved in labyrinthine layer morphogenesis	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	23071313
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	NAS	14971032
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0071650	Process	Negative regulation of chemokine (C-C motif) ligand 5 production	TAS	19262501
GO:0072577	Process	Endothelial cell apoptotic process	ISS
GO:0097421	Process	Liver regeneration	IEA
GO:0140105	Process	Interleukin-10-mediated signaling pathway	IBA
GO:0140105	Process	Interleukin-10-mediated signaling pathway	IDA	7543512, 10443688, 16982608
GO:0140105	Process	Interleukin-10-mediated signaling pathway	IDA	7749983, 24994464
GO:1900100	Process	Positive regulation of plasma cell differentiation	IGI	22962438
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	23071313
GO:1903034	Process	Regulation of response to wounding	IEA
GO:1903034	Process	Regulation of response to wounding	ISS
GO:1903377	Process	Negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IEA
GO:1903659	Process	Regulation of complement-dependent cytotoxicity	IMP	16034134
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IEA
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IEA
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	ISS
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	ISS
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IMP	16034134

MIM	HGNC	e!Ensembl
124092	5962	ENSG00000136634

P22301

Protein name

Interleukin-10 (IL-10) (Cytokine synthesis inhibitory factor) (CSIF)

Protein function

Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric rec

PDB

1ILK , 1INR , 1J7V , 1LK3 , 1Y6K , 2H24 , 2ILK , 6X93 , 8SVE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00726	IL10	5 → 174	Interleukin 10	Domain

Tissue specificity

TISSUE SPECIFICITY: Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types. {ECO:0000269|PubMed:1940799, ECO:0000269|PubMed:7512027}.

Sequence

MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ
LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLR
LRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Sequence length

178

Interactions

View interactions

109

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hepatitis C virus, susceptibility to	Pathogenic	rs1800896	RCV005645373	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Leprosy, susceptibility to, 1	Pathogenic	rs1800896	RCV002291818	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Rheumatoid arthritis, progression of	Pathogenic	rs587776843	RCV000018370	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (106)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APHTHOUS STOMATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APPENDICITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC RHINITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE CHRONIC HEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE HEPATITIS WITH CENTRILOBULAR NECROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet disease	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET'S SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOROID DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON COLD	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE OPHTHALMOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEFICIENCY OF GLUCOSE-6-PHOSPHATE DEHYDROGENASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, OCCUPATIONAL	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 1	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENTEROCOLITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRO-ENTEROPANCREATIC NEUROENDOCRINE TUMOR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT VS HOST DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft-versus-host disease, resistance to	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft-versus-host disease, susceptibility to	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT-VS-HOST DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRANULOMATOSIS WITH POLYANGIITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES OPHTHALMOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOPHILIA A	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS B	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS C	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, AUTOIMMUNE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOLENTICULAR DEGENERATION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY, IMMEDIATE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IL10-related early-onset inflammatory bowel disease	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE DYSREGULATION, INFLAMMATORY BOWEL DISEASE, ARTHRITIS, RECURRENT INFECTION SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE DYSREGULATION-INFLAMMATORY BOWEL DISEASE-ARTHRITIS-RECURRENT INFECTIONS SYNDROME	—	ClinGen, Orphanet ClinGen, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory bowel disease	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS, CUTANEOUS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS, VISCERAL	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA-LYMPHOMA, ADULT T-CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOSITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHIC OPHTHALMOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANUVEITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT MAJOR DEPRESSIVE EPISODES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid arthritis	Conflicting classifications of pathogenicity	ClinVar ClinVar, Disgenet, GWAS catalog ClinVar, Disgenet, GWAS catalog ClinVar, Disgenet, GWAS catalog ClinVar, Disgenet, GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
RHINITIS, ALLERGIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SICCA SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGRENS SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to HIV infection	Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYMPTOMS OF DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog, Orphanet GWAS catalog, Orphanet GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC SHOCK SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1456)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Abetalipoproteinemia	Abetalipoproteinemia	BEFREE	28482239		★★★★★ ★☆☆☆☆ Found in Text Mining only
ABLEPHARON-MACROSTOMIA SYNDROME	Ablepharon macrostomia syndrome	BEFREE	28611780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acne	Acne	BEFREE	22835835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acne	Acne	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	22835835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	19249119, 7515919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	17690160, 20807264, 21481602, 26600159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute encephalopathy	Encephalopathy	BEFREE	31709864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	22836854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	18460982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	23086275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11145841, 11549518, 12145682, 15651075, 23086275, 25263239, 30791148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute otitis media	Otitis media	BEFREE	17908769, 24718616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	18815552, 20937337, 24072654, 25520280, 25730090, 26125871, 26634555, 26823862, 27173345, 28759809, 29310417, 30546828, 30690339, 31242405, 9637544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	19393234, 28679299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adamantinous Craniopharyngioma	Adamantinous Craniopharyngioma	BEFREE	31249603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10997808, 11351253, 15682481, 15842572, 16343245, 23749933, 27085036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15682481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	15034082, 28812429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	15188028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23743567, 27440266, 29145406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	31423207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16537707, 16775170, 21160427, 26724144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	17640058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	16775170, 17640058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	15536164, 29350052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	28619710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	10716685, 16148556, 19086955, 21284667, 22902304, 26656007, 28722826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11549518, 15651075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	14701701, 16389181, 17215862, 17606447, 19276283, 20087644, 22609637, 23485354, 28662433, 28870600, 30209121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	14959851, 17979488, 19201467, 21239696, 22475179, 23299779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	CTD_human_DG	23962110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	28910419, 29444188, 30563084, 8704212, 9684922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	16895750, 20843660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	LHGDN	15761493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28765149, 30288946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	10685365, 11493351, 12608917, 17968299, 18230105, 22077544, 22698805, 23587006, 27737359, 28099578, 29899423, 30030838, 30120837, 30327689, 30348144, 31028890, 31222730 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	LHGDN	18230105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	16942566, 22487280, 22533231, 23330844, 23800473, 24647473, 26316419, 26526003, 28102058, 28426164, 28802126, 28894978, 29314270, 30007011, 30106146 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	14767447, 28886863, 29314322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	21697956		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	BEFREE	17690329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	15212825, 16185274, 19698145, 21368376, 23736221, 24359497, 26402514, 26402623, 26626881, 29070909, 29201645, 30336198, 32634865, 38167125, 39266981, 39880323, 40121165 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31455413	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	16908746, 19744138, 22356904, 26014970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	27776263, 28336494, 29668503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	28493082, 29507585		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	15536164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	25311268, 30210445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	32123048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	19013651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	29081763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaphylaxis	Anaphylaxis	Pubtator	30189430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	19638576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	25860946	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	28373650	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	31598989	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	30579843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	16926419, 18972133, 23668806, 28829493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	17945537, 18972133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	38022547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	14675414, 28459238, 32761514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Autoimmune	Autoimmune hemolytic anemia	Pubtator	30784322	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	20130127, 21953592, 23720018, 26686970, 27026283, 32411797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	26135971	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	23720018, 31209247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	24707114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	17174184, 28407320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	28474494	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	18617279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	29100307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	11114280, 11352256, 12595905, 16947381, 23291587, 25256892, 26823867, 28362980, 29771402, 30178829, 30322951, 30518188, 31348182, 31711818		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anodontia	Anodontia	Pubtator	28578351	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	36675305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	30907204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	30687319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	28810156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	27189037, 28789949, 28950996, 31195034, 31470635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	27189037, 28789949, 28950996, 31103845, 31195034, 31207853, 31470635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	11735270, 24707114, 28434701, 31583844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	28434701	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	12756345, 15288631, 16899122, 17321344, 17903648, 25198969, 25854712, 26782404, 32138469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	31885770	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	24707114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	11735270, 12756345, 15288631, 17903648, 24801553, 25198969, 25854712, 26782404, 28434701, 29549671, 29880489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	LHGDN	17903648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Arch Syndromes	Aortic arch syndrome	Pubtator	17133531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	15005735, 21148041, 28373650, 30007011, 31739216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	21855833, 24903972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	LHGDN	12189567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	15548264, 21561401, 22800824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apnea	Apnea	Pubtator	26982450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	CTD_human_DG	16367942		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Appendicitis	Appendicitis	BEFREE	31615548		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	20130127	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15953127, 16300768, 16336952, 16523426, 16804000, 17098305, 19342680, 19700159, 20814021, 21418223, 23070607, 24823720, 25420919, 25421362, 25740578 View all (22 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	BEFREE	10092823, 10225943, 10366102, 10640777, 10792391, 10849557, 11327238, 11342612, 12133271, 12539154, 16573780, 16704745, 16947381, 18824530, 19534651 View all (28 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	10366102, 19565513, 22550014	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	18392953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Gouty arthritis	Pubtator	36994890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	19930904, 33613540, 7722463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	10366102, 12847694, 16959027, 17469159, 17530721, 23092393, 23094074, 23121667, 26934060, 28257625, 31958219, 9105428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	19565513	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	28012239	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	10857783, 11180010, 11564829, 16507115, 16947381, 37979213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	11348460	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Reactive	Reactive arthritis	Pubtator	10524675, 11352256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10343540, 10366101, 10447928, 10857783, 11056676, 11879539, 12384915, 12562402, 12571841, 12782719, 12847677, 15497451, 15535835, 15743469, 15761492 View all (27 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10728756, 29096690, 30915732	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15140777, 15361394, 23091349, 26711868, 28183329, 34301999	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	12011375, 16947381, 28461105, 28554321, 31209492, 9712099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	11085795, 16391840, 26521731, 26546777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	BEFREE	22580886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	10704078, 12938145, 14748015, 16341266, 19852851, 20371397, 20926789, 21179211, 21457191, 23273955, 23527710, 23683514, 23984295, 24428972, 24450586 View all (14 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	11031340, 11295668, 11668616, 12534553, 12938145, 14682393, 14748015, 15356557, 15557163, 15894599, 16008678, 16600026, 17396024, 17690329, 17848808 View all (62 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	12938145, 14682393, 18440625, 18534084		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	17349011, 22363778, 24641294	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	18780949	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	Pubtator	7856743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asymptomatic Inflammatory Prostatitis	Asymptomatic Inflammatory Prostatitis	CTD_human_DG	12050565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	29899423	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	12857749, 23811604, 31430072	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	15547296, 16523426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	15547296, 17438520, 21358010, 24707114, 30080219, 35052452, 37339167, 8621803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15953127, 16300768, 16523426, 16804000, 17098305, 19342680, 19700159, 20814021, 21418223, 23070607, 24823720, 25420919, 25421362, 25740578, 26235422 View all (21 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	17487426, 18634977, 29748196, 31813744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32345003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	20150436	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	26473365, 38066446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28664398, 31129493		★★★★★ ★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	24659220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	22226452, 29178897, 31554204, 31616420, 38288647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	30430410	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29085596, 29178897, 29763840, 30430410, 30842746, 31228728, 31252635, 31551826, 31554204, 31671361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	16360218		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	23353117	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	27730473, 31535339		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	10498633, 22371007, 29694797, 30050955, 30143451, 30735937, 31422415		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	CTD_human_DG	21227906		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10072487, 11137572, 11197608, 11342612, 12220553, 12595905, 15057267, 15128840, 15497451, 15655362, 16122836, 16380445, 17099776, 17510437, 18057536 View all (79 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	11964134, 15497451, 16380445, 18057536, 20227772, 22425265, 22882653, 23094074, 23189166, 23679256, 24130510, 24470136, 25187566, 25604082, 25966091 View all (8 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	12220553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	LHGDN	11908705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	BEFREE	22280320, 30784322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	BEFREE	11342444, 12406097, 19176318, 20360470, 23993982, 25174872, 25670364, 31057537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	11342444	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	12406097, 19176318, 20360470, 22857792, 25174872, 26113417	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	30356853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	28493082, 29507585		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	11196656, 11781245, 12688341, 1325212, 14597210, 16449530, 17049666, 23303827, 23640160, 24089328, 26147452, 27006334, 27792904, 28589243, 28624051 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	14701701, 15933064, 18479302		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	10618692, 8603006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	11889061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	18192685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	33941087	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	31415412, 36860843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
	Behcet Syndrome	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	17321902, 18281862, 19796538, 20191386, 20622878, 20622879, 21334264, 22378604, 22749664, 23291587, 23633568, 24267724, 24269690, 24286189, 24428981 View all (20 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	GWASDB_DG	20622878, 20622879, 23291587		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	CTD_human_DG	20622878, 20622879		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	GWASCAT_DG	20622878, 20622879		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	ORPHANET_DG	20622878, 26015771		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	20622878, 22378604, 24286189, 24749687, 24984193, 25941808, 26015771, 29017598, 29895319, 33393726, 35455984, 37264476	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	14666714, 21532858, 31342610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Berylliosis	Berylliosis	Pubtator	12449171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	10519993, 32581238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	28325677, 30159734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	28495135, 31207853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	29803226, 37058046	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	35136035, 38484669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16938461, 19237018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	26293297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	27449508, 31681719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	9695978	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	31682032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	36567775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	30692604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	31436254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	8297651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	31436254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast cancer, lobular	Breast Cancer	BEFREE	24762057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15803357, 15931634, 15945506, 16842617, 17762971, 17965799, 19437115, 20553628, 20646924, 20737205, 22057973, 22095765, 22818022, 23143946, 23574339 View all (22 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	29582634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15931634, 16030322, 16672066, 16710719, 17261184, 18566447, 18651178, 18685848, 20204402, 20553628, 20646924, 22353218, 24172169, 24411993, 24502445 View all (21 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	31552680	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	39518934	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bright Disease	Bright Disease	CTD_human_DG	10910440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brittle diabetes	Brittle diabetes mellitus	CTD_human_DG	19430480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	10482841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	LHGDN	16809636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	31503552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	31503552	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	14722888, 17436234, 18286551, 21829368, 26473365, 27228545, 27695990, 28368490, 29244796, 29802545, 31074014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	21910858, 26473365, 27695990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	32628310, 36561744	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	10933164, 12379886, 12565791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	30176916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	15678510, 17237722, 25409741, 30246004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	LHGDN	17237722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	19581835	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	25409741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	27716906, 31440247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	11118209, 11162833, 11669608, 1325212, 16332968, 18362887, 21791113, 23029361, 7694007, 7749063, 8157362, 8167552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	11118209, 11162833, 1325212, 17237610, 21791113, 23029361, 25071000, 29033373, 29078819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	LHGDN	15728515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	19244371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of kidney and urinary tract	BEFREE	29380920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	27002767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	33000216, 34670213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	17094460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Capillary malformation (disorder)	Capillary malformation	BEFREE	14768719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12535204, 22235320, 22594912, 23359190, 25071000, 25744234, 28675120, 29935877, 32799717, 34581419, 37530244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19823053	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12535204, 21328379, 21799775, 28812429, 8826937, 8982367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	17508019, 21760883, 21980389, 8450029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	27903846	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18479293, 19826049, 25027084, 26400525, 26783377, 27136203, 27853178, 29568203, 31448426, 31724091, 32218692, 32258134, 32387446, 32724815, 33633112, 34710996, 35637248 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19126646	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	18685848	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16938461, 19237018, 31823416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10528207, 11549573, 16276011, 17654453, 19505916, 20034810, 20112337, 20491794, 21595995, 22058059, 22160576, 23149083, 23743567, 25503130, 26956044 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	20860602, 30485902, 9649178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21917055	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33299656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10408703, 10944605	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17346426, 18344594, 20208540, 23434518, 26715281, 31781309, 32012488, 32469992, 38148073, 7656270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	16276011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	12535204, 16133109, 16343245, 19387481, 21760883, 23430974	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	12535204, 15026274, 15914210, 17307204, 20489570, 21760883, 21980389, 26609634, 30427744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	31423207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11570587, 15581980, 15870936, 17141301, 20430716, 23524894, 23877403, 26122176, 28410380, 28589429, 28875159, 28993412, 29100353, 30039195, 30485902, 30719112, 31001284, 9649178 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	19099482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	LHGDN	19099482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	34458163, 36298704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	10850534, 18654018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	26339378	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	29566367	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	22447464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic Familial	Cardiomyopathy	Pubtator	15606623	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	27430170, 29566367, 8800994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	11133172, 15084512, 15530917, 17903648, 20061995, 22825546, 26871859, 28474494, 28847894, 29442075, 30875589, 31571432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	12164877, 20662694, 28474494, 31871930, 39199367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	15780075, 17903648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	28474494	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	LHGDN	19118909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	16804000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	27001002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage Diseases	BEFREE	19534651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	22503813	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	24319335, 28622063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	39959181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	12554901, 17052299, 27368016, 27705004, 29847542, 31758443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	12198691, 12738467, 12959221, 15979955, 16182624, 16287542, 16540751, 16567828, 16579847, 18435801, 24768947, 29481982, 9038663		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	LHGDN	12959221		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	16540751, 23844808, 33054308, 34449925, 35354862, 37047806, 38040898	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	28982901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central visual impairment	Central Visual Impairment	BEFREE	7515919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	30796737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	31646585, 36439158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	38167007	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	20353760, 27363685, 27585466, 30136689, 31446341, 31801113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	24040186, 24394869, 26722562, 26722564, 27051029, 30080219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	36066144	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	18725394, 27068409, 29623066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	11720009, 18566343, 20880001, 21030268, 21844205, 22425140, 26654671, 28154551, 28990089, 29313944, 30120034, 30972077, 31004072, 31415765, 31807255, 31813744 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	17460178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	24260517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	11745479, 12104048, 16343245, 17684137, 17688234, 18798072, 19823053, 20558465, 21468579, 22157213, 22592655, 23095823, 25281063, 25412954, 26076679 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	19079205, 19908064, 20558465, 23363891, 23521696, 25281063, 30546456, 31316301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11745479, 12104048, 16343245, 17684137, 17688234, 18798072, 19823053, 20558465, 21468579, 22157213, 22592655, 23095823, 25281063, 25412954, 26076679 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	24603474, 24608170, 27115869, 34458163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	11549518, 15651075, 19621425, 26142334, 27107085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	14748015, 18440625, 20371397, 21624746, 21779975, 23984295, 24709010, 26473365, 27323141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	22290731, 23159283, 29420117, 30517305		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	22290731, 31976810	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangitis	Cholangitis	BEFREE	27965154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	25953611, 29720090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	29671891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	29671891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	11910576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis progressive familial intrahepatic 1	Cholelithiasis	Pubtator	29104077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	36837507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	16391840, 30759730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chorioretinitis	Chorioretinitis	BEFREE	18436829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choroidal Neovascularization	Choroidal neovascularization	Pubtator	27558944	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	8964596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	15843082, 17028239, 21869607, 24129165, 24239644, 24472848, 24716225, 24992474, 25072499, 27085036, 27993998, 30312415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	12857749	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	18490762, 27977792, 28662328, 30700717, 31586435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	22496237	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	12694256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	15708894, 17173255, 19196047, 20551628, 22424164, 22617684, 28360429, 7723241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28360429, 28380480, 29229532, 31311999, 7723241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic leukemia (category)	Leukemia	BEFREE	7694007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	16425355, 28616049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10618692, 11133769, 16408101, 19573080, 22945689, 23225254, 25393804, 27890932, 28166196, 29379494, 29450641, 29712773, 31034584, 8603006, 9864930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	30647074, 31297883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	15663746, 17331973, 17690329, 19279357, 24528166, 24720797, 24805101, 25051954, 26044852, 27793775, 28795606, 28976240, 29042607, 29067126, 29149779 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	17331973, 18510721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	16871547, 39231552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	12423294, 12631183, 15142213, 17305874, 18725394, 19210338, 19419438, 20718895, 21848614, 22010076, 22077544, 22537751, 22698805, 22763734, 25129246 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	LHGDN	17209781, 17335372, 18315435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	21815905, 24670840, 25129246, 25530681, 26211001, 27737359, 28410151, 28662328, 29489938, 29899423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	31944625	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Prostatitis with Chronic Pelvic Pain Syndrome	Prostatitis With Chronic Pelvic Pain Syndrome	CTD_human_DG	12050565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Prostatitis with Chronic Pelvic Pain Syndrome	Prostatitis With Chronic Pelvic Pain Syndrome	BEFREE	28497911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Q Fever	Q Fever	BEFREE	22711637, 25722298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	24092408, 28122135, 28494026, 30281939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	30316748, 31257460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	10719024, 15729365, 16940525, 22390924, 25027084, 25514046, 28082235, 28325677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	11781245, 31443525	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	25139022	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	22174866, 25129246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	30688042	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	31944625	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	17174184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coffin-Siris syndrome	Coffin-Siris Syndrome	BEFREE	18512809, 19864953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	20083555, 28705468, 30256904, 32634865, 35950445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	26971470, 30586550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	29201645, 30256904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	11285204, 11683684, 12584217, 14711688, 16012947, 16298681, 16437604, 17030181, 17056509, 17207256, 17611628, 17631136, 18536750, 18586081, 19238344 View all (135 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	Pubtator	11772962, 19890111	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	LHGDN	15246967		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	CTD_human_DG	19238344, 21807089, 22119709, 24314293		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis Ulcerative	Ulcerative colitis	Pubtator	10719056, 12974765, 30369485, 31584460, 31798282, 31842582, 36169258, 7664489	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	16566641, 18190460, 18442197, 19309553, 20509889, 21304977, 22543157, 22550014, 24379584, 24971461, 25076849, 26090671, 27558476, 28453768, 29765931 View all (4 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11179476, 11179490, 15034082, 17617560, 17678726, 18628251, 27912148, 28680752, 29954431, 30377564, 30540937, 31088266, 8826937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18628251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	27085036, 30808659, 30855275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	28812429	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11285204, 16030091, 16035616, 17261758, 18448485, 19578817, 19760027, 19863607, 22108198, 22594912, 23053983, 23079832, 24015034, 24194923, 24557062 View all (19 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11282551, 15188028, 19760027, 22594912, 24015034, 24194923, 25076849, 25209180, 26509874, 27619682, 29368606, 30973070, 32358386, 32390702, 33294886 View all (4 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19760027, 27494857	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33294886, 39227608	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Combined Saposin Deficiency	Combined saposin deficiency	Pubtator	16038043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	11196660, 19249119, 23993982, 27288995, 29345621, 30193889, 7515919		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	18254984, 20629103, 29345621, 31827477, 33190167, 35589883, 9042433, 9486401	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	20498672, 24597698, 25501140, 27245049, 29235226, 30058578, 31840342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital anomaly of brain	Brain malformation	BEFREE	21940735, 22310223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	28325677, 30159734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	29420117, 30415063, 31533404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	25308608, 27926976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1A	Congenital disorder of glycosylation	Pubtator	35711443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	31785499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital neurologic anomalies	Drachtman Weinblatt Sitarz syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11260510, 27605566, 27660015, 28565777, 29437117, 30356307, 30795907, 8800994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conjunctivitis	Conjunctivitis	BEFREE	21749458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	10651163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	BEFREE	31568781, 9767235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11894117, 15711248, 18721274, 19027043, 23633487, 27127124, 31781309, 7591233, 7790111, 8242311, 9723777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy, Juvenile Epithelial of Meesmann	Corneal Dystrophy, Epithelial Of Meesmann	BEFREE	29660650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal Ulcer	BEFREE	19450443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	17413867, 24659220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	24659220, 26097597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	11168433, 11689215, 17174184, 20519163, 21626471, 22168225, 26314610, 26634554, 27813553, 29734056, 30073578, 31077265, 31430072		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	11168433, 11689215, 16570020, 17174184, 18617279, 20519163, 21284833, 21626471, 22168225, 22825546, 26314610, 26345772, 26505399, 26634554, 26936111 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	11882051, 33731531	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	17174184, 20339193, 20519163, 21889313, 24699044, 26505399, 27173291, 27813553, 28596642, 30392493, 31411246, 33029103, 37824465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	17706223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease Autosomal Dominant 1	Coronary artery disease	Pubtator	20519163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	17690160, 27997991, 34861059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	28390432	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	11168433, 11689215, 16570020, 17174184, 17413867, 20519163, 21626471, 22168225, 26314610, 26634554, 27813553, 28390432, 29734056, 30073578, 31075237, 31430072, 31785499 View all (2 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Restenosis	Coronary restenosis	Pubtator	25253465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	22927709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cranial nerve palsies	Cranial Nerve Paralysis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	28859336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	28315920, 30316748, 31257460, 31611936		★★★★★ ★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	BEFREE	12867583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	15288631, 33041191, 9218830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	10210767, 10551422, 10719056, 11196710, 11271474, 11478505, 11683684, 12584217, 12759436, 12825869, 15214053, 15843082, 15879155, 15937090, 16043989 View all (60 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	10719056, 11772962, 12231473, 14678275, 15937090, 16461743, 16489646, 19237638, 19673019, 20509889, 21304977, 23598818, 24074435, 24718601, 26090671 View all (9 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	12857749, 35665507	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	LHGDN	16043989, 16911685		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	CTD_human_DG	21102463		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	34383142, 38201264, 7664489	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GENOMICS_ENGLAND_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	21102463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	21102463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryopyrin-Associated Periodic Syndromes	Cryopyrin-Associated Periodic Syndromes	BEFREE	24773462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	29086221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	11294564, 12394188, 15714121, 17565341, 19458621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	27757545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	24853301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	10226079, 11823525, 12507912, 15463896, 15871134, 18093884, 22520513, 24853301, 31742967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	10515411, 10844532, 12507912, 15373916, 15463896, 18026571, 18093884, 25803862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	16933851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	24098711	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystinosis	Cystinosis	BEFREE	31601865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	22184725, 31776239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	30973927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	24374045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deficiency of glucose-6-phosphate dehydrogenase	Deficiency Of Glucose-6-Phosphate Dehydrogenase	BEFREE	15718915		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	BEFREE	10211885, 10447928, 16078336, 16391840, 19534651, 20407468, 22119941, 22939867, 25252624, 26521731, 27044824, 27519904, 28316377, 28799796, 29196771 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	29350052, 29713131, 30118915, 30312415, 31805674, 31849652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	23385102, 29549829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	27474414, 28705468, 31414991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	28705468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	30229836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	29518260	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	30452090, 9762678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression Postpartum	Major depressive disorder	Pubtator	34856750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	BEFREE	31693974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	10229162, 22921153, 22990943, 24143878, 28778811, 29500107, 29574669, 29995777, 30054585, 30148175, 30654383, 30711869, 30792669, 31063941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	14632756, 23149083, 31205078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	24143878, 37058046	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	17610667, 37058046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	29856741	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	12443893, 21332458, 22547651, 24698321, 31679013, 31732776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	16185274, 17960185, 20232770, 22533231, 22968402, 26124183, 28821884, 30286163, 30515983, 33390552, 33975024, 38302650	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	22427475	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	12938145, 20232770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	25465638	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	15347381		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Allergic Contact	Dermatitis	BEFREE	27714845, 28493082, 9187837		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	10563471, 10831012, 11496247, 11994107, 12828754, 14767447, 16076299, 16185274, 17188628, 17596153, 19552724, 21426411, 21749458, 22000570, 22427475 View all (17 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	CTD_human_DG	18249437		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Occupational	Dermatitis	CTD_human_DG	29477354		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	10651163, 11180010		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	BEFREE	16895750, 20843660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	LHGDN	16895750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	34997119, 37985458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	29988398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	12756169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Dysplasia of the Hip	Developmental dysplasia of the hip	Pubtator	25578529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10746656, 10946317, 15057267, 15622443, 16437243, 16690414, 17130572, 17173255, 17611256, 21861711, 21909800, 22043012, 23602201, 26797873, 28108611 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	20536548, 28846666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	30539027, 36203592	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	36499008	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10746656, 10946317, 11133172, 15057267, 15622443, 16437243, 16690414, 17130572, 17173255, 17611256, 21861711, 21909800, 22043012, 23602201, 26797873 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	11896938, 26268591, 26823869, 29513874, 30256013, 33114431, 34517005	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22385239, 32265833	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27001002, 30539027	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	11092695, 18163472, 19127455, 19430480, 20176734, 23494449, 24523574, 24773525, 31558544, 31849037, 33365026, 35404688, 35754999, 36766809, 39464889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	26636339	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	39273664	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21289232, 36313784	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23768819, 24758873, 26064986, 27706650, 28225860, 29227971, 29947343, 30256013, 33858419, 34944529, 37626843, 39202464, 40080435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29752628, 34079246	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10843746, 11717448, 11821159, 11899074, 12121678, 14679088, 14735147, 15041043, 15057267, 15855327, 16720211, 16907917, 17130572, 17315139, 17498265 View all (37 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	11896938, 15057267		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	19430480		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	21980299		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Ketosis-Prone	Diabetes Mellitus	CTD_human_DG	19430480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15622443, 16437243, 16644716, 16690414, 17173255, 18616700, 19031431, 19608431, 20388104, 20809684, 21289232, 21861711, 22298356, 22732092, 22886309 View all (24 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Sudden-Onset	Diabetes Mellitus	CTD_human_DG	19430480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	12628339, 15057267, 18779928, 22484814, 26797873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	CTD_human_DG	19430480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	33096729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	26823869, 28060893, 29227971, 30345559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	17173255, 18616700, 19031431, 20809684, 21861711, 25280384, 25806430, 26823869, 27173343, 27186953, 28060893, 29227971, 30015512, 30345559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	31557408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	26064986, 28262614, 28386366, 29227971, 29382585, 30890581, 31298360		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	26268591	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	27525838, 36766809	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	29227971, 30890581, 32117292	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	21876975, 29168186, 30711567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	14701701, 16389181, 17056605, 17215862, 17408400, 17510437, 17606447, 19276283, 20047977, 20087644, 21902578, 22609637, 23485354, 23640160, 25733167 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Scleroderma	Scleroderma	BEFREE	12867583		★★★★★ ★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	23353117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	28252221, 28514870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated intravascular coagulation	Pubtator	9695978	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disturbance in mood	Mood Disorder	BEFREE	22227623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	16182624, 30186038, 31785499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25222269, 30186038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	33206953	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	27247515, 37876509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	30175615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	29904427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	29904427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	17716348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	22912426	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	23073467, 25670364, 28222379, 28692864, 28699612, 29516281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	23073467, 35274685	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	28316372	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	24845156		★★★★★ ★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	28098755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	15085177, 18705845, 28348564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	24962617, 26112140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	10831012, 11496247, 11994107, 12828754, 14767447, 16076299, 16185274, 17188628, 17596153, 19552724, 21426411, 22000570, 22427475, 22533231, 23857017 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema, Infantile	Eczema	CTD_human_DG	18249437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	34439789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Elejalde Disease	Hereditary elliptocytosis	Pubtator	35455984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	24805101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	21376661, 22263663, 28003589, 28935853, 30123051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	28935853, 31678190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalocele	Encephalocele	Pubtator	21863566, 27807886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	12934185, 30922332		★★★★★ ★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	11192323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23051953	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35403529	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36263059, 36675305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	28376925, 31418859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	30579999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	11883743, 12700072, 17178764, 18684450, 18687423, 18930197, 20618176, 21705369, 23237776, 28004192, 28300844, 28470452, 28971893, 29308924, 30367890 View all (5 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	LHGDN	11883743, 12700072, 17178764, 17207568		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	16359969, 18684450, 18687423, 18930197, 28300844, 29308924, 29771400, 32311852, 35403529, 36263059, 36869723	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	CTD_human_DG	30579999		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	34360900	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Enteritis	Enteritis	BEFREE	17130251, 18586081, 23541212, 31831090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	BEFREE	12759436, 21631466, 22236434, 22890722, 23158016, 23839161, 24797915, 25761563, 31509557, 31608070		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Enterocolitis	Enterocolitis	CTD_human_DG	17574631		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Enterocolitis	Enterocolitis	Pubtator	18259614, 20011655, 34032699	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Enterocolitis	Enterocolitis	Pubtator	33891982	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Enterocolitis Necrotizing	Enterocolitis	Pubtator	23472217	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	24732104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	11714825, 18485518, 21257225, 26047816, 26265500, 29580813, 30453907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	29580813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	29790577, 38013163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia Verruciformis	BEFREE	14512909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex	Epidermolysis bullosa	Pubtator	34536484	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsies Partial	Partial epilepsy	Pubtator	39259090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	27695956, 29393419, 30922332, 31757102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	15870936, 30485902, 31001284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythema Nodosum	Erythema nodosum	BEFREE	9110151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Achalasia	BEFREE	21641950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	12119553, 23886125, 24969402, 26464722, 27002767, 30951709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	12119553, 23886125, 24969402, 26464722, 27002767, 30951709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	23886125, 26464722, 39896813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	11889061, 15682481, 23886125, 31276257, 32744314, 34799871, 36437782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	15842572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	18163209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Evans syndrome	Evans Syndrome	BEFREE	30784322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	23566546	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	22290731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	17353161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	17353161, 31221509, 38304433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	32100077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	25921117, 26277868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Familial mediterranean fever	Pubtator	15544632	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	23265747		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	23265747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	19647494, 30929860, 9201656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	21619669, 9874656	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	25834308	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	16425360, 19401628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	LHGDN	18267346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29163491, 31563650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28659437, 28852433, 30944419, 31101239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	19055487, 20486195, 22911481, 26076859, 27871023, 30658331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	27903846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromuscular Dysplasia	Fibromuscular Dysplasia	BEFREE	31004723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	12421951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis of pancreas	Fibrosis Of Pancreas	BEFREE	27314021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	10734016, 15587930, 16698276, 17038628, 17526009, 17645476, 22544759, 22659050, 25013899, 25514046, 30243650, 30631870, 30800002, 31252263, 31730896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	29162878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	29162878	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	15200436, 16361810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	LHGDN	15200436, 16361810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	28040582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Folliculitis	Folliculitis	BEFREE	25004811		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	23265747		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRONTOMETAPHYSEAL DYSPLASIA 1	Frontometaphyseal Dysplasia	BEFREE	31004723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	11407990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	12297850, 17559370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	29410961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	17826353, 27516059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	16181351, 17716348, 17717744, 20659236, 24121150, 30771733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	LHGDN	17717744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	26088449	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	26088449, 34471638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	27196487	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	30205739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	19013788, 30205739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastro-enteropancreatic neuroendocrine tumor	Digestive system neuroendocrine neoplasm	CTD_human_DG	29915428		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal inflammation	Gastrointestinal inflammation	BEFREE	31755523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	15682481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	11286472, 16332968	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	17133531, 17552041, 24395029, 24983912, 26314610, 27974093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	LHGDN	17133531, 17552041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	17133531, 37703805	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	17961716, 21699407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	15972593, 16171432, 16945026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	34234776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	35665507	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	22355254	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	26820987, 32050932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	28622063, 31637197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10360813, 23663500, 31059805, 31143512, 31634400, 7953624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23663500	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23663500, 31791385, 32457755, 35177622, 36230961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21511480, 23663500, 31059805, 31143512, 31634400, 7953624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10360813, 14530312, 15383564, 20406895, 21304408, 23613317, 23741072, 25342742, 26516307, 27811370, 28490949, 28657431, 28713019, 31436254, 7953624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20406895, 22752645, 23525950, 23613317, 25342742, 26516307, 27287871, 27811370, 31152305, 31436254, 7856743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28107450	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	CTD_human_DG	10910440		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	BEFREE	15200436, 16361810, 17173255, 24536045, 9669428		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	Pubtator	15200436, 16361810	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	LHGDN	16396704		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis IGA	Iga nephropathy	Pubtator	15200436, 16361810, 28359052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	24219615	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	15954921	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	15200436, 16361810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	28765149, 30288946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	10572111, 30142416, 35114361	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft vs Host Disease	Graft-versus-host disease	Pubtator	11520812, 12239181, 12472598, 14657427, 15931634, 16109775, 18234053, 19295315, 19409109, 20446793, 20457266, 21358669, 34152493, 34404616, 36056390, 36555525, 9808588 View all (2 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	10572111, 12239181, 12393699, 12623423, 12756021, 14657427, 15449032, 15931634, 15940053, 16109775, 17000688, 19295315, 19409109, 22262800, 22692497 View all (9 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft-vs-Host Disease	Graft-Vs-Host Disease	LHGDN	12239181		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft-vs-Host Disease	Graft-Vs-Host Disease	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	10951408, 11715070, 11838849, 14697748, 18512809, 19864953, 26213801		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	LHGDN	11838849		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	15708894, 25939343	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	9459621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	10843746, 11101869, 15497451, 17208210, 19882211, 21424183, 23638863, 25817259, 28742402, 29259988, 31055979, 31809586, 8045947		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	23189166, 26016954, 33943012	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	31790305	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	12799024, 28147379, 31379477, 31479869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	28147379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	7807997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	11196710, 16489646, 28064415, 30305562, 31845094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	31315247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	21876975, 22366404, 23757290, 26821743, 27774749, 28742402, 28827034, 30356853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	21876975, 26821743, 31790305, 33578562, 33943012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	32348468	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	26612133, 26747525, 28410223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	26747525, 30762321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	36593740	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	21729106, 30734265, 31244833, 31833408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	24091885, 30356307, 31632400, 36255356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	10614840, 18353715, 25984539, 31124999, 31632400, 35409075, 35775773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11260510, 27605566, 27660015, 29437117, 30356307, 30795907, 8800994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	LHGDN	18923248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	34744513	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	26039365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	31067191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	24205307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	24256874	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	31983108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	7913409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematoma	Hematoma	Pubtator	28282868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	12663233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	31924826	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	40149873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	21969092, 29248444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophagocytic Syndrome	Hemophagocytic Syndrome	BEFREE	10931148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	16380445, 20082647, 20846164, 22116520, 22176207, 25930091, 28393618		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemophilia A	Hemophilia a	Pubtator	16380445, 21362111, 31194850	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemophilia B	Hemophilia	BEFREE	25700434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	31217347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	24659122, 28963667, 29556266, 30653104, 31324059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	27655254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Form of Wilson Disease	Hepatolenticular degeneration	CTD_human_DG	25002079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	25953611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	31422415	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	11737614, 23872054, 25027084, 32387446, 32532356, 33506937	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B Chronic	Hepatitis b	Pubtator	18479293, 23395388, 26617910, 26909998, 32387446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	16940525, 17634507, 21467695, 22535775, 24081683, 25797191, 32532356, 33125400, 34710996	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C	Hepatitis c	Pubtator	26783377, 31952232	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C Chronic	Hepatitis c	Pubtator	12046093, 15057302, 16425360, 16940525, 17634507, 24081683, 25613737, 29247709, 32532356, 32994477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	22139496		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatolenticular Degeneration	Hepatolenticular Degeneration	CTD_human_DG	25002079		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	20646924, 26112140, 32393308	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	8443970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	29459177, 31610314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	30140888, 31191873, 31721309		★★★★★ ★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	BEFREE	11781245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	36248794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11162833, 12688341, 14959851, 15730400, 16523426, 17408400, 17979488, 19201467, 21061265, 21239696, 22070668, 22475179, 23299779, 25613737, 29481790, 8167552 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	17496310, 17979488, 19021042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	17496310, 17979488, 21385932, 23299779, 24008079, 33684151, 8639912, 9680372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	25041527	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Holoprosencephaly	BEFREE	11479728, 11810641, 12522553, 12756169, 15221788, 15831469, 16475235, 16962354, 17001669, 17158784, 17998248, 20104616, 21995818, 22310223, 22383895, 28640243, 29749689 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	15730400, 16523426, 22070668, 25613737, 29481790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	37674148	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyaline Membrane Disease	Hyaline Membrane Disease	BEFREE	9683557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyper-IgM Immunodeficiency Syndrome, Type 1	Hyper-IgM Immunodeficiency Syndrome	BEFREE	22154528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyper-Immunoglobulin E Syndrome, Autosomal Dominant	STAT3 Deficiency	BEFREE	29898959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	24736312, 27121486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	27121486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	22891927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	BEFREE	31581545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	BEFREE	30050955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	Pubtator	9808566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	20145925, 25420919, 28108611, 28256812, 29032727, 29081777, 29621477, 29675435, 29982291, 30416020, 30759730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	27001002	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	27294162, 40080435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	25944984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	30759730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	30944794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity	Hypersensitivity	Pubtator	11511310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	20232770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	39201708	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	25973747, 26064986, 26198819, 28537431, 29504915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Portal	Portal hypertension	Pubtator	24705150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	35186226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	37985458	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18163209, 25979722, 26064986, 26198819, 28327099, 28847894, 29100513, 29140820, 29939225, 30074152, 30075176, 30095157, 30144156, 30536406, 30606987 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	18163209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	22447464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	28894116, 30345559, 30425273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	33879070	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy of tonsils	Hypertrophy Of Tonsils	BEFREE	28894116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	26722554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	BEFREE	30782610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypofibrinogenemia	Hypofibrinogenemia	BEFREE	31681719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogammaglobulinemia	Hypogammaglobulinemia	BEFREE	15761493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	22080961	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	31350776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	31350776	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	31560937, 39185088	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotrichosis simplex	Hypotrichosis simplex	BEFREE	17001671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27558590	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34367731, 35457151	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	31410171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Ichthyosis Bullosa Of Siemens	BEFREE	23595519, 29201045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic achalasia of esophagus	Idiopathic achalasia	BEFREE	21641950, 24468584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	15954921, 30034290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	17673672, 29673911, 30229666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	11282543, 12761561, 16573560, 26709222, 29598007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	12882453	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	15303638, 15809201, 23815594, 26709222, 39896814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	21309737	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
IgA Deficiency	Selective immunoglobulin a deficiency	Pubtator	16803619, 9099927, 9649225	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	11158399, 15200436, 16361810, 17988266, 19034880, 27796698, 28359052		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	15200436, 16361810		★★★★★ ★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	BEFREE	11683684		★★★★★ ★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	CTD_human_DG	21102463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	24583477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	CTD_human_DG	27580383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	10334386, 24639111, 24762057, 25014110, 29696721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	16030322, 16617566, 18490780, 20722464, 24762057, 35013572, 35222434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	12176899, 15755291, 21463487, 22669326, 22677268, 24994465, 25051072, 26436850, 27007229, 28300523, 28466476, 29696721, 31102993, 31129375, 31380412, 31493564 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	BEFREE	16386644, 16758339, 16803619, 20012054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10367687, 22550014, 22693231, 26518043, 26776123, 26986868, 31830622, 7500020, 8656012, 9748147, 9811676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	17913303, 23485736, 26830320, 26971470, 28977146, 29325450, 29610037, 29876882, 30253800, 30256904, 30586550, 30877874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	16247433, 17321603, 28485322, 28877383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Industrial Dermatosis	Industrial Dermatosis	CTD_human_DG	29477354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	29771400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	30117603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Disease 25 Autosomal Recessive	Inflammatory bowel disease	Pubtator	33849446, 37986047	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10367687, 10551422, 10859210, 10954907, 11196710, 11271474, 11285204, 11478505, 12808464, 12825869, 15223609, 16043989, 16566641, 16573780, 16638698 View all (120 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	12165551, 18836448		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	12625840, 15020649, 15762887, 16566641, 19673019, 20509889, 20629103, 22158873, 22543157, 22550014, 24089328, 25200001, 25314644, 26660358, 26822028 View all (24 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	23291587, 27783946, 28411859		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	26192919		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	28675120, 29459177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	22547651, 31732776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	19401628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	25944984	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin-dependent diabetes mellitus secretory diarrhea syndrome	Insulin-Dependent Diabetes Mellitus Secretory Diarrhea Syndrome	BEFREE	21400500		★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	28376584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Interleukin 2 Receptor, Alpha, Deficiency of	Interleukin 2 Receptor Deficiency	BEFREE	17196245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Internal Carotid Artery Stenosis	Internal Carotid Artery Stenosis	BEFREE	28623743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	27807886, 29636026, 29992506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	27807886, 29636026, 40426248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	21863566, 24971599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disk Displacement	Intervertebral Disk Displacement	BEFREE	11979160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	10859210, 11478505, 28464953, 29588183, 30542112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	16540751, 19822020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	30808659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Perforation	Intestinal perforation	Pubtator	31931724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal polyposis	Pubtator	25228656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	26198819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	26198819, 35711443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Hypertension	Intracranial hypertension	Pubtator	35812382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	12104048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	35643225	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	29111167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	CTD_human_DG	12404228		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	12477767, 16043989, 16279907, 19655247, 20177758, 20337945, 21519361, 22287022, 22740130, 22897390, 23595519, 24206549, 24409078, 26366730, 27272011 View all (6 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	12477767, 22158028, 24206549, 24667736, 30246694, 31205078, 34115808, 37404119	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	31205078	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ischemic stroke	Ischemic Stroke	BEFREE	20880001, 21030268, 24040186, 24732312, 24782217, 24991091, 26654671, 26722562, 26722564, 27051029, 27363685, 28459600, 28659854, 28725658, 30080219, 31446341, 31722572 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	31721299, 35441431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	10366102, 11371669, 11469477, 12195624, 21205466, 23094074, 28012239, 28247163, 28257625, 29494710, 29748155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	LHGDN	16959027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	30204240, 31629226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	19474209, 29977799, 30690344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	36051483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratosis Seborrheic	Seborrheic keratosis	Pubtator	8450029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	24404580, 29100307, 9777954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	11737614, 17173255, 18616700, 19031431, 20809684, 21861711, 22886309, 26064986, 26393580, 30345559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	17622313, 24610932, 26064986, 30345559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	17173255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	22617684, 7723241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	31875015	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	12215823, 15036247, 22278021, 23607333, 27788614, 28214022, 28688148, 28912860, 28953574, 30216653, 30700847		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	18460982		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	LHGDN	11737614, 15086488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	15708894, 17173255, 19196047, 20388104, 20551628, 22424164, 22617684, 28352125, 28360429, 7723241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	17346426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lambert-Eaton Myasthenic Syndrome	Lambert-Eaton Myasthenic Syndrome	BEFREE	12864989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lambert-Eaton Myasthenic Syndrome	Lambert-Eaton Myasthenic Syndrome	LHGDN	12864989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal cleft	Laryngeal cleft	BEFREE	31006277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	30762321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	29257349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	8800994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	34256950	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leishmaniasis	Leishmaniasis	Pubtator	22570089, 32966326	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leishmaniasis Cutaneous	Leishmaniasis	Pubtator	15716079, 25139022, 8112853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leishmaniasis Visceral	Visceral leishmaniasis	Pubtator	12641659, 25200768, 25941808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	15306847, 16163478, 19058987, 21917900, 23619473, 23966553, 24065643, 26340474, 30083152, 30300363, 31422044, 31781675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	19058987, 20640364, 23563829, 23966553, 24065643, 24578538, 25941808, 25992795, 31781675, 32433683, 37153623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	32849660	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	10844525, 10903757, 19058987, 22556091, 22570089, 22851198, 23449998, 32849660, 9893041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	25412496	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11549518, 22326931, 24908319, 26142334, 29946742		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12538698, 15152368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23349302, 7540066, 8228801, 8704212, 8879210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Lymphoid leukemia	Pubtator	38415531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	25409436, 33054128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	28807569, 8879210	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23179394, 23616009, 23725154, 25730030, 26081440, 28528702, 30197353, 31350948, 31373163, 34459452, 34504191, 8805932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	28084439	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33083479	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	30026572, 8879210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	29148541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	8443970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11549518, 12028020, 23179394, 23616009, 23725154, 24269703, 25287662, 25319656, 25730030, 27486989, 30013668, 30181021, 30197353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	30026572, 8879210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	29712773, 8704212, 9684922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte Disorders	Leukocyte disorders	Pubtator	32862238	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	BEFREE	21527907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	18559596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	27299734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lhermitte-Duclos disease	Lhermitte-Duclos disease	BEFREE	21863566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	19838195, 20728533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	29056901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	17980158, 18383862, 22981868, 24982395, 25744234, 27002767, 28157558, 28982581, 29037125, 29913322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	BEFREE	28189545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	28189545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipogranuloma	Lipogranuloma	BEFREE	30078223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12668613, 15643599, 15763337, 16425355, 16441483, 16481285, 18479293, 19054267, 19093253, 19126646, 19480854, 19826049, 21107607, 22025883, 22390924 View all (26 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15534100, 16441483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	10719024, 12668613, 15729365, 16940525, 19480854, 22390924, 22544759, 23840511, 25027084, 25514046, 25730061, 26163635, 26617910, 26909998, 27432540 View all (5 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	16718780, 20473581, 21467695, 23840511, 26617910, 26909998, 36608595, 36674897, 39315805	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	LHGDN	18582197		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	10896923, 19737238, 24835349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	12765479, 12847677, 17158635, 20638239, 34367180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	10673067, 24835349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	10716685, 21467695, 24409064, 25953611, 26783377, 34497613	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	10716685	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	10716685, 28838891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	29174983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	36308662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	19413695, 26512422, 28833919, 29545840, 30772394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	12940515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	24520384, 25774942, 30564277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	26301107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lumbar disc disease	Lumbar Disc Disease	BEFREE	21863566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	20883321, 24853301, 34427644, 36255321, 39298399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	24292748	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	24853301, 30852423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	20404807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	20674506, 28575534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10997808, 11549573, 16276011, 19124500, 19505916, 20112337, 23149083	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	12926133, 16122836, 16276011, 17537769, 17654453		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	14587096		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	20034810, 23743567, 23749933, 26956044, 29016555, 9515807		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	21507199, 21595995, 30953795, 31552680	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	10712664, 10952745, 10979237, 12165544, 17703177, 25187566, 26568585, 29963056, 30148175, 31216373, 31297111, 31735515, 8601623, 9746856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	15800006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10025928, 10343522, 10447736, 10643707, 11014347, 11226290, 11238636, 11359450, 12097418, 12562402, 15800006, 16030322, 16412052, 16507146, 17082661 View all (34 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10446864, 11122256, 12480667, 15498048, 20589076, 24062776, 25187566, 27814627, 29271478, 31871930, 33198645, 33882880, 39818255, 9010506	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Cutaneous	Lupus Erythematosus	BEFREE	10979237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	10712664, 10952745, 10979237, 12165544, 17703177, 25187566, 26568585, 29963056, 30148175, 31216373, 31297111, 31735515, 8601623, 9746856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10343522, 10446864, 10525320, 10529131, 10556270, 10643707, 10712664, 10952745, 10979237, 11014347, 11122256, 11223972, 11226290, 11238636, 11698495 View all (105 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	12097418, 12220553, 12486603, 12791314, 15295621, 16507146, 17092253, 18397303		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	19838195, 20728533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	ORPHANET_DG	19838195, 20576226, 22654485, 23936042		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	26502338, 28714469		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	16396704, 18771958, 18802705, 20850528, 21635228, 25979722, 9746856, 9819501, 9884094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	LHGDN	16396704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	17324967, 21635228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	30594048	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	10712664, 10952745, 10979237, 12165544, 17703177, 25187566, 26568585, 29963056, 30148175, 31216373, 31297111, 31735515, 8601623, 9746856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	BEFREE	20883321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17537769, 21595995, 24762057	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	30485902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30485902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	24502445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	21325597, 35510179, 40262247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	10931148, 11042520, 28332776, 28869447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	LHGDN	11960393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	11781245, 17237610, 17408400, 18024395, 20191326, 20207982, 20299965, 22016619, 22156547, 22323454, 22628023, 26121143, 26314692, 26464657, 26987877 View all (7 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12688341, 1330578, 14597210, 16971956, 17408400, 18559596, 19299742, 20207982, 20299965, 21791113, 22019587, 22562117, 22628023, 23570798, 25171480 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	14592815, 17310845, 18024395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	26230952, 26381553	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	23297127, 24162786, 27228053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Cutaneous Anaplastic Large Cell	Primary cutaneous anaplastic large cell lymphoma	Pubtator	8941669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	17510437, 25977148, 26448050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	LHGDN	17990180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Intermediate-Grade	Intermediate Grade Lymphoma	BEFREE	12688341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	15077178, 17049666, 17408400, 17510437, 18559596, 20299965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	11238122, 15077178, 16389181, 16449530, 17049666, 17056605, 17215862, 17227481, 17408400, 17510437, 17606447, 17653830, 18024395, 18201362, 18559596 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	16690518, 17408400, 18201362, 18559596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	15077178, 16389181, 17049666, 17215862, 17227481, 17408400, 17510437, 18201362, 18559596, 19573080, 20299965, 22058059, 23225254, 23640160, 24684230, 25977148, 27006334, 28840502 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Noncleaved-Cell	Lymphoma	BEFREE	8677742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	10664008, 11407990, 11453809, 16428475, 18245523, 24908319, 25681335, 30277131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Lymphomatoid Papulosis	BEFREE	8941669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	26584349, 9746856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	16807647, 9126962, 9395354, 9415559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	LHGDN	17700165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	26147452, 40262247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	30671214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	33953642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	35370941	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Edema, Cystoid	Cystoid macular edema	BEFREE	24319335, 25923230, 28328965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular retinal edema	Macular edema	BEFREE	24319335, 25923230		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	18996917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	30591371		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	11952921, 19087313, 19786281, 23608119, 28122130, 28445690, 28895492, 29856741, 30033161, 30662368, 30677547, 31063941, 31124079, 31207853, 31693974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	29882480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	9876876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	26612133, 26747525, 28410223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	20047977, 20087644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15803357, 15931634, 15945506, 16842617, 17762971, 17965799, 19437115, 20553628, 20646924, 20737205, 22057973, 22095765, 22818022, 23143946, 23574339 View all (21 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	29582634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	12119553, 23886125, 24969402, 26464722, 27002767, 30951709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	29410961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	25091209, 26886630, 29720026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	15711248, 7591233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26400525, 31006277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10528207, 11549573, 16276011, 17654453, 19505916, 20034810, 20112337, 20491794, 21595995, 22058059, 22160576, 23149083, 23743567, 25503130, 26956044 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	14587096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	17980158, 18383862, 22981868, 24982395, 25744234, 27002767, 28157558, 29037125, 29913322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	27002767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	20112337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11570587, 15581980, 17141301, 20430716, 23524894, 23877403, 28410380, 28589429, 28875159, 28993412, 29100353, 30039195, 30719112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	14560157, 25725585, 28476581, 29336814, 30304975, 31424683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11238122, 12067976, 16618781, 17182240, 17999153, 18174250, 19145440, 19267370, 19474090, 19908237, 19996656, 20735825, 21211963, 21339768, 22850906 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	16284379, 17999153, 18174250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	14512909, 18173702, 25759212, 27620176, 29467923, 30427744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15579481, 15978325, 16114018, 17716348, 17992202, 18707865, 19077731, 19132772, 19544559, 19669876, 20087693, 20233508, 20359252, 20363151, 20953818 View all (31 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	16452205, 17545635, 24464184, 27858102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	16938461, 19237018, 31823416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10360813, 10570747, 11179490, 11285204, 11509647, 11745479, 12145682, 12220553, 12594817, 15585401, 15803357, 16912197, 17103073, 17141301, 17182825 View all (93 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	11745479, 12104048, 16343245, 17684137, 17688234, 18798072, 19823053, 20558465, 21468579, 22157213, 22592655, 23095823, 25281063, 25412954, 26076679 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11179476, 15034082, 17617560, 17678726, 18628251, 27912148, 28680752, 29954431, 30377564, 30540937, 31088266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	18496743, 23777202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	29582634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15803357, 17762971, 17965799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28274688, 9192989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	29582634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	29582634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	20047977, 20087644, 27614429, 30940906, 8443970		★★★★★ ★☆☆☆☆ Found in Text Mining only
MEGALENCEPHALIC LEUKOENCEPHALOPATHY WITH SUBCORTICAL CYSTS	Megalencephalic Leukoencephalopathy With Subcortical Cysts	BEFREE	31164242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	27903619		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10464712, 11294564, 12394188, 14585195, 15265902, 15564140, 15714121, 16783343, 16835788, 16912197, 17278711, 17479109, 17565341, 17574964, 18074024 View all (34 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	14585195, 17574964, 18221542, 18249038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15579430, 16615096, 16801397, 16835788, 17565341, 18249038, 19142637, 19240164, 21317876, 21327637, 21853302, 24130734, 25604082, 25720800, 25944800 View all (8 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15809206	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	29201645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	28700093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	10229162, 22921153, 22990943, 24143878, 28778811, 29500107, 29574669, 29995777, 30054585, 30148175, 30654383, 30711869, 30792669, 31063941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	27397081, 28314127, 28969939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesial temporal lobe epilepsy with hippocampal sclerosis	Mesial temporal lobe epilepsy with hippocampal sclerosis	BEFREE	29153613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	25249575, 31060892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	17652887, 25329057, 26734798, 30256013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	21289232, 31798282	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	29067980	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	LHGDN	16872712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	20388104, 21328800, 25329057, 28077381, 28222379, 28242034, 28268030, 29067980, 29408929, 31075237, 31798282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	18049335, 21317876, 21853302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	30121258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	30121258	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular Angina	BEFREE	26058672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	21812905, 28950996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	39187749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	29248892, 30253800, 30256904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	21481059, 22131390, 24626804, 24689510, 26345847, 26682645, 27401590, 28648621, 29040297, 29103803, 30832584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	29078758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	10416508, 11054484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	30847948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	11161463, 31679013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	18832862, 29611101, 31207853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	25412496	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	34539639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	17980158, 18383862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	18383862, 25744234, 29037125, 30912418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	16475235, 31727941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	31727941	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	16475235, 31727941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	10233729, 15270865, 19543506, 20339193, 21048327, 21508509, 24659220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	17413867, 19543506, 20339193, 21508509, 24490882, 24659220, 28108813, 29447181, 29765083, 31583766, 9672143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	LHGDN	17413867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	32884012, 34035116	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	37506144	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	16540751	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	10214873, 11122145, 11307152, 11698282, 12148907, 15585329, 19762082, 19922463, 26653800, 27405747, 27611810, 27732933, 28393658, 28702457, 30128739, 30154111, 8916964 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11122145, 11886382, 15180863, 18512025, 18830264, 22567049, 23152910, 23232072, 24340030, 25469832, 26545722, 27039771, 27268602, 27732933, 27983725 View all (8 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25341809	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	10193428, 11422209, 11956029, 12101075, 15182256, 17944900, 18200504, 20227772, 20357264, 25738751, 25780887, 29067976, 29518260, 34596589, 36870061, 37715818, 9771978 View all (2 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	10320650, 23144765, 36754216	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10360761, 10416508, 10580805, 10683520, 11054484, 11592112, 12039409, 12101075, 12220553, 12220699, 12458048, 14616291, 15057267, 15693804, 16183136 View all (47 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	12101075, 12220553, 15693804, 18200504		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	CTD_human_DG	23517930		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Acute Fulminating	Multiple Sclerosis	CTD_human_DG	23517930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	15693804, 22978757, 25586466, 25794663, 28273784, 8632062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	LHGDN	18793860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	24659498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	31004723		★★★★★ ★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	19470169, 25335775, 28293095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	10376939, 11137572, 14592887, 17509455, 18071035, 19299022, 22835429, 28265257, 28599652, 29718870, 8982119, 9335010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	LHGDN	17917921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	23049601, 30945700, 33136553, 33813453, 34936242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	25518708, 26826242	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	32508812	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	8941670	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10692674, 12028020, 25941112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	21511336, 33050756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	23453286	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	28807569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	11549518, 24819026		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	25371165, 29785404, 30608868, 30695099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative Syndrome Transient	Transient myeloproliferative disorder	Pubtator	11966768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	11168433, 11689215, 14572794, 16516951, 17617027, 17690160, 17981284, 18566343, 18832728, 19005292, 20388104, 26505348, 28322445, 28439731, 28810626 View all (6 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	15466015, 17587715, 18056971		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	15883752, 16310260		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	26505348	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	36759072	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	37811136	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	15378163, 22592860		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	24394869	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	21354997, 27913008, 28134069, 30622430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	17048038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	27811060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	39946176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis Ossificans	Myositis	Pubtator	30429363	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonia Fluctuans (disorder)	Myotonia Fluctuans	BEFREE	29032984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	11896938, 21414848, 26211001, 26354610, 34830017	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	33287713	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	16437243, 25157497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myxoma	Myxoma	BEFREE	28875159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	18793874, 19639723, 28388587, 29580813, 31611936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	19250527, 19639723, 28388587, 29417576, 29580813, 31870738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	31928947	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	10197635, 16995954, 17559576, 18312596, 21328379, 22320262, 23898109, 24982395, 25544502, 25547230, 26782544, 26842763, 27002767, 27289016, 28881764, 31737947, 9247280, 9395354 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	16059673, 21543473, 22320262, 22745579, 25948470, 36039641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	25544502, 30762321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	29135655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	14523823, 28013313, 28379923, 30542485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10100726, 10400827, 10464712, 10516719, 10528207, 10688378, 11162833, 11238122, 11265771, 11285204, 11294564, 11493471, 11549573, 11570587, 11696695 View all (225 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	17173255, 29126311, 29866800, 30779760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Interstitial nephritis	Pubtator	30779760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	20420800, 30779760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	20420800, 30779760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	35293350	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	20446793	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	30062391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	30062391	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	35293350	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	24394869, 31166487, 32038109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	23318105, 28456715, 28659854, 28822691, 29625335, 30692604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	21940735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25961062, 27322426, 28687069, 33252831, 8640845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23570798, 25619653, 28495517, 30117603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	30128872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	30603902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	26220165, 27063619, 28657431, 29349658, 30423585, 31287367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	17606879, 25371017, 29084866, 29367208, 29372388, 29414152, 29928964, 30847948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy, Painful	Neuropathy	BEFREE	17606879, 29372388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropsychiatric Systemic Lupus Erythematosus	Neuropsychiatric Systemic Lupus Erythematosus	BEFREE	10343522		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	30524320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	LHGDN	17961177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	26047816, 29368547, 31329326, 31503548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	27903619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	20473581, 28699612, 29399077, 30034633, 31480575, 31563650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11351253, 12926133, 16122836, 20034810, 20471133, 21507199, 21595995, 22848356, 23658645, 27000869, 28715437, 29016555, 29916282, 30278439, 30429024 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	20471133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29399077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	17440433		★★★★★ ★☆☆☆☆ Found in Text Mining only
NOONAN SYNDROME 8	Noonan Syndrome	BEFREE	30357910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15749027, 16644716, 17510437, 19760027, 19798061, 20508843, 22835835, 24690978, 25249575, 27918843, 27939689, 28243360, 28321033, 28440716, 28479226 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19267370, 19760027, 19798061, 20825686, 24690978, 27977792, 28225860, 30256013, 34296200, 34620218, 35205336, 36313784	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21901025, 22912426, 25944984, 27494857, 28537431	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24741586, 29405562, 32469992, 34330510, 34382943	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	28103807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	32545403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	31415412	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	26112140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligoarticular Juvenile Idiopathic Arthritis	Oligoarticular Arthritis	BEFREE	11371669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Omenn Syndrome	Omenn Syndrome	BEFREE	22664165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	30452090, 9443483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	BEFREE	20576226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	GWASCAT_DG	30837455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	20112337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	20112337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	15880595, 27519904, 28316377, 29763932, 33953899, 36619785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	26711868, 31017304	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27044824	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	16173237, 28810626, 31590365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 3	Osteogenesis imperfecta	Pubtator	16343245	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	31801113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	26135971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	30711175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	22975999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	27795360, 28872184, 30684915, 31389012, 31538345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	21200384, 25384921, 32080087, 34207210, 36032115, 37495941, 38567587, 39375626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	23583365, 31538345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	18490762, 26503210, 29228633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	26503210, 32016959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	LHGDN	17908769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	18560870, 26957492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	29595664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	11570587, 20430716, 23524894, 28410380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	28868628	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	30581430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	26823856	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15581980, 17141301, 23877403, 28589429, 28875159, 28993412, 29100353, 30039195, 30719112		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	19071030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11570587, 1502188, 16617566, 17579858, 17593856, 19398128, 22083345, 24446182, 28327095, 28410380, 28589429, 36056141, 37155466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20430716, 37322531	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	12584217, 29332347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	14560157, 18347814, 25725585, 26210045, 28476581, 29336814, 30304975, 31424683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10433946, 16094523, 21455317, 22731825, 26191284, 27589570, 31424683, 32867538, 33299656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25557640	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37455016	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	11855927, 14726611, 16038043, 20163933, 22836854, 27314021, 28912860, 29435045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	15316224, 16038043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	19442309, 26634555, 26823862, 27173345, 28293095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Alcoholic	Pancreatitis	Pubtator	24835349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	17962362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	11441115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	14560157, 15841043, 17962362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	19786281, 27264274, 28146444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panuveitis	Panuveitis	Pubtator	15606623	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18997484, 24464184, 30089122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	36154611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paracoccidioidomycosis	Paracoccidioidomycosis	Pubtator	20643858, 25204704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic syndrome	Pubtator	32771066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	BEFREE	20393813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	28376092, 28910419, 30466392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	17652449, 29375563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15648059, 17923267, 18284424, 18362084, 18545225, 20880267, 22387064, 23485736, 23563022, 24397502, 24948069, 26830320, 28799796, 29478949, 30063943, 30871733, 30954070 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	24593806, 35279225, 38231411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	27220776, 27230441	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31455413, 34349163	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	31559531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	21777343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	31559531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	15548264, 17869646, 22800824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	29308326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	10951408, 11715070, 11838849, 14697748, 18512809, 19864953, 26213801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	28735358, 29895283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peeling Skin Syndrome	Peeling skin syndrome	Pubtator	32749463	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	8964596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	11710918, 35140724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	29335495, 31440247	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	15650893, 27716906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	16946717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	19470040, 29749496, 31342641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	18192685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	10655986, 17716348, 25888319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	10655986, 25888319, 33851594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	29306532, 29397217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	25867228, 28565777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	BEFREE	25867228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	11196688, 11493351, 17335372, 18447856, 18725394, 22537751, 23643609, 26782428, 27469563, 28266114, 28691456, 28800160, 28906456, 28985543, 29538476, 30405072, 31577700, 31677089 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	LHGDN	18447856, 18725394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	27737359, 29538476, 35665507, 39337647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	10632663, 15972593, 16128836, 17335372, 17944678, 17968299, 18315435, 18602070, 18725394, 19210338, 21309719, 22077544, 22324464, 22698805, 22763734 View all (18 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	10632663, 29538476, 29899423, 32236319, 36214094, 37240180, 39266981, 39336814, 8608641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35665507	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	12164877, 20385468, 24699044, 40761788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	20385468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	20385468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	19608431, 28702476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	19608431, 22672183, 28702476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	34360900	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	31671361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Petechiae	Petechiae	BEFREE	15543094		★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	22105495, 28572674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	28749078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	34257554	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	11934729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	CTD_human_DG	11181422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	BEFREE	31720991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	Pubtator	27491076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	18218037, 26141422, 28585716, 28868943, 31005728, 31722718, 31781027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	21478181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	28868943	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	23121980, 31170996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	9731054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polydactyly	Polydactyly	BEFREE	18178536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyalgia Rheumatica	Polymyalgia rheumatica	Pubtator	17133531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	16775170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Popliteal pterygium syndrome	Popliteal Pterygium Syndrome	BEFREE	15081258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28160656, 28933225, 29179015, 29913077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior reversible encephalopathy syndrome	Leukoencephalopathy	BEFREE	29271478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	17709502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	12145682, 15001471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	23086275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	28802664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	27474414, 28705468, 31414991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	10634216, 12765479, 15880308, 15884119, 17158635, 17518371, 20638239, 30274824, 31555703, 9625317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	22628023, 23570798, 27709813, 28278715, 28657431, 28922238, 31778838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary hyperoxaluria type 1	Hyperoxaluria	Pubtator	27161247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	10898307, 11454808, 11492971, 29694797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	22105495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	30807515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11238122, 12067976, 16618781, 17182240, 17999153, 18174250, 19145440, 19267370, 19474090, 19908237, 19996656, 20735825, 21211963, 21339768, 22850906 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	21532858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	17094460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11238122, 12771930, 17094460, 19267370, 19474090, 20735825, 22647697, 22859398, 23754304, 25921117, 28073842, 28317149, 28631559, 31892550, 35821621, 38087324, 39518934 View all (2 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	16284379, 17999153, 18174250		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17999153		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26528857	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31348843, 33402974	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
prostatitis	Prostatitis	CTD_human_DG	12050565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	12584217, 29332347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	10634216, 15729365, 21377504, 24674682, 26148246, 27543394, 27793650, 29611873, 30591371, 30734130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	15186319, 31362906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	10469306, 10651163, 11180010, 11298547, 11407990, 11851889, 12011375, 12702141, 12932247, 12944983, 15186319, 16185274, 17970693, 18093240, 18311435 View all (26 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	10469306, 11180010, 11407990, 29696068, 35848967	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	LHGDN	15659329, 16464746, 18093240, 18797896		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	18311435, 25735363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	17440433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	10779401, 14567558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	LHGDN	14567558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Pulmonary alveolar proteinosis	Pubtator	14567558	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	12376215	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	17673672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17690329, 19279357, 23537276, 24805101, 26043025, 28976240, 29535517, 31503552, 32273692, 33223825, 34079246, 34206428, 34426754, 35186226, 36253785, 36780897 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22363778, 29149779	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	27199554, 30154651	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	33393628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	24805101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	10781421, 20674506, 21072213, 21131395, 29598007, 29601941, 29690905, 30816470, 30852423, 31162951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rachischisis	Rachischisis	BEFREE	21940735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Prolapse	Rectal Prolapse	BEFREE	29136128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	14629328, 17052682, 24564196, 29384969, 29550839, 29641282, 29800802, 30341786, 9681346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	16192631, 31123968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Regional enteritis	Crohn Disease	CTD_human_DG	21102463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Artery Stenosis	Renal Artery Stenosis	BEFREE	15104679, 28242034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	15711248, 7591233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10944605, 11894117, 15711248, 18721274, 23633487, 27127124, 7591233, 7790111, 8242311, 9723777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29787737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	11244168, 31072913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	21357384, 26086642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	17314689, 28298812, 31478351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	16585075, 17314689, 21138342, 22033829, 28298812, 28432351, 29072959, 29266409, 29402831, 29520236, 29649066, 30280795, 30651808, 31013737, 31111072, 31200579, 31478351 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	17314689, 28298812, 28616049, 30511622, 31478351, 31773706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	21357384, 31936183, 35456412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	26086642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	20484443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	24718616	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	8941669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Artery Occlusion	Retinal Artery Occlusion	BEFREE	17438520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Artery Occlusion	Retinal Artery Occlusion	LHGDN	17438520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	28128370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28386366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	31814701		★★★★★ ★☆☆☆☆ Found in Text Mining only
RETINITIS PIGMENTOSA 27	Retinitis Pigmentosa	BEFREE	31639404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retrobulbar Neuritis	Retrobulbar Neuritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	29720131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	23797008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	29568872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Fever	Rheumatic fever	Pubtator	24896159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	16043936, 16406300, 17607501, 23168096, 26255050, 27118427, 27918954, 29552315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	LHGDN	17607501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10088772, 10366101, 10447928, 10553089, 10685365, 11055825, 11269532, 11508575, 11791644, 11824970, 11879547, 12030433, 12509628, 12539154, 12562402 View all (112 more)		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12782719, 14994383, 16859503, 17665434, 17929139		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	22450443		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Rheumatoid Arthritis	Rheumatoid arthritis	HPO_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Rhinitis	Rhinitis	BEFREE	21749458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	20232770, 21625018, 22533231, 31598989, 33224143, 35064698, 35415925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	35190755	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	29100513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	16189158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ruptured Appendicitis	Appendicitis	CTD_human_DG	16367942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	11436536, 19117745, 21086908, 22393278, 27755127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	12746045, 15303638	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	18654018, 19117745, 22927996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	12746045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	8690910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	34440851	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	31629226, 37740179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11922883, 11952921, 12667161, 14563376, 15374585, 16378687, 17066477, 19153889, 21216474, 21658228, 23951054, 24603720, 26481614, 26491028, 26971470 View all (9 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	11922883, 16378687		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	20132993, 23951054, 26462458, 32038109	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	21216474, 21658228, 23951054, 24603720		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	24984193, 30630651	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	15772682, 30009261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	33809015	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	11710721, 23237063, 28103916, 34504485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	29689251	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizure, Febrile, Complex	Seizure	BEFREE	31709864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	23614351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures Febrile	Seizures	Pubtator	26076859, 35022648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Selective immunoglobulin A deficiency	Selective Immunoglobulin A Deficiency	BEFREE	12738467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	17220333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	11137576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	BEFREE	23777929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	16444434, 18949559, 20835611, 21048935, 22180561, 22187279, 24470136, 26632390, 27368016, 32996896, 35720398, 37304268	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	10623443, 11197608, 11441115, 11553765, 11907099, 12117955, 12406851, 12411588, 12544990, 12925485, 12970043, 15036247, 16051275, 16162776, 16435103 View all (61 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	CTD_human_DG	11441115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	16672072, 17052299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	10415042, 8381174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	7905018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	30943938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	15223781, 17048038, 19060265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe T-cell immunodeficiency	Immunodeficiency	BEFREE	10415042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	10491012, 11594572, 8695857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	7923918	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	16305644, 29649320		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sinus Node Dysfunction (disorder)	Sinus Node Dysfunction	BEFREE	29982291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	15761496, 30196302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	11212157, 14872501, 17470266, 26332048, 29504848, 30882006, 33228011, 35705251, 37418983, 39337678, 39819714, 7578884, 9867125	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	39480501	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	12535204, 18173702, 21760883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	11348460	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	11564829, 19479852, 21357384, 23273955, 25759212, 26015771, 31440247, 7923918, 8941669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	16185274, 37740179	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	15221281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	10664008, 11348460, 12457984, 15908402, 16185274, 16428475, 18424735, 21357384, 25759212, 26748443, 28239875, 29409331, 29479352, 30154801, 31440247, 31670995, 8941669 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	12535204, 21760883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	25944984	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep apnea	Pubtator	31882693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	17174184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28500380, 29482817, 30213594, 31313021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Fiber Neuropathy	Small Fiber Neuropathy	BEFREE	20513817		★★★★★ ★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	24784322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	21940735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	LHGDN	18391721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	12595905, 16947381, 22494514, 26068404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	22494514, 26823867, 34290697, 35420296, 38346238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SPONDYLOCARPOTARSAL SYNOSTOSIS SYNDROME	Spondylocarpotarsal Synostosis Syndrome	BEFREE	20386338, 29033373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10997808, 11351253, 12535204, 18383862, 18950955, 21760883, 22981868, 23118878, 23749933, 28157558, 28982581, 30427744, 7636270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15682481, 18273643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15682481, 19440651, 21258967, 23886125, 24768599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17465207, 18547033	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18383862, 20592893, 22167499, 23118878, 23679256, 28052009, 28053372, 28496107, 30912418, 33419896, 33569630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	23749933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	23430974, 27086490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	12535204, 30427744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17465207, 20592893, 28915597, 29456743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Neoplasms	Neoplasm	LHGDN	12119553		★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	18179752, 23602281, 28558042, 31828271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	28407320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stage IV Skin Melanoma	Skin Melanoma	BEFREE	18049335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28235602, 29186698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	19401628, 28710554, 29163491, 31563650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stickler syndrome type 1	Stickler syndrome	Pubtator	22306269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12594817, 15579481, 15978325, 16114018, 17716348, 17992202, 18707865, 19077731, 19132772, 19544559, 19669876, 20087693, 20233508, 20359252, 20363151 View all (36 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	19295440, 25888319, 31983108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12730860, 15652446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15682481, 19132772, 19822020, 21455338, 22126569, 22235320, 23725178, 24120241, 25884934, 26088449, 26378021, 28002581, 28111424, 28596683, 29742730 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22526791, 31092242	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28488547, 30785523, 31233202, 37153541	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
STRIATONIGRAL DEGENERATION, INFANTILE (disorder)	Striatonigral Degeneration	BEFREE	29510394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	24394869, 39199367, 40362194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	34201498	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28415958, 28659854, 30646897, 31518664		★★★★★ ★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	22628023, 29680372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sveinsson Chorioretinal Atrophy	Sveinsson chorioretinal atrophy	Pubtator	28434701	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	16305644, 29649320		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	16305644, 29649320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	20012054, 22129793, 28696534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	22494514, 9358757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic lupus erythematosus	Systemic lupus erythematosus	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	16959027, 21205466, 30266771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	12867583, 15772682, 17389013, 17444587, 18493769, 18588853, 19255934, 21535076, 22307790, 23045159, 23237063, 28502678, 28522286, 28556548, 29193892 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	17389013, 18493769		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	11286472, 11453809, 11781245, 14984496, 23640160, 30622214, 9777954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	28778711, 30171380, 31816847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	26792515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	23121980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	25589894	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocytosis	Thrombocytosis	BEFREE	29751991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	29088744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	12608932, 12970294, 21067483, 30888403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	24379064, 32348468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	16452205, 17545635, 24464184, 27858102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	16452205, 17545635, 24464184, 27858102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	16452205, 21876975, 27858102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	21876975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	31350776	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	21876975, 33620087, 9697995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	31790305	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	8242311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Toxic Shock Syndrome	Toxic Shock Syndrome	BEFREE	15325406, 17562770, 31358568		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tracheomalacia	Tracheomalacia	BEFREE	31316955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	26090964	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichiasis	Trichiasis	BEFREE	15789056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30253648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35255925, 35960749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tyrosine Kinase 2 Deficiency	Tyrosine kinase 2 deficiency	Pubtator	29725107	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10484006, 10551422, 10719056, 11173905, 11196710, 11271474, 11478505, 12974765, 16566641, 16573780, 17070109, 18569989, 18836448, 18942752, 19184348 View all (44 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	LHGDN	18836448		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	18836448, 20228799		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASDB_DG	19915572, 20228798		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	19915572, 20228798, 26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Undifferentiated carcinoma	Carcinoma	BEFREE	16059673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	11952921, 19087313, 19786281, 30662368, 30677547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	11737614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ureteral Calculi	Ureteral calculi	Pubtator	30484290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25050631, 31823416, 35909123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Overactive	Overactive bladder	Pubtator	31166487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Tract Infections	Urinary tract infection	Pubtator	30484290	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	31440247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	10209502, 23521696, 32277624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	19079205, 31316301	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	19089920, 35313793	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	11509647, 19823053, 22592655, 23280621, 23587428, 23656504, 25412954, 27220278, 27525910, 27721577, 29935877, 30453149, 30517305, 31316301, 32277624 View all (5 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25309919	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31943744, 32277624	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	24260517, 36263059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	15606623, 33639877	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	BEFREE	18802119, 20335604, 20350837, 21294722, 21357402, 28157416, 29135797, 30510488, 30761764, 30779760, 9856775		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	Pubtator	18802119, 24612100, 27028890, 29774027, 30779760, 40433375	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	Pubtator	25354724	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis Anterior	Anterior uveitis	Pubtator	15606623	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis Anterior	Anterior uveitis	Pubtator	25200001, 38346238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis Intermediate	Uveitis	Pubtator	16024856, 23378732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis, Posterior	Uveitis	BEFREE	29037906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	20591073, 26015771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	20591073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	28522271, 29266409, 30285148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	12799207, 16935932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	20385468, 28693373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Malformations	Vascular malformation	Pubtator	31727941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	19543506	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	14697748, 19543506, 19811264, 22880107, 26213801, 29765083, 30249047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	25376552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis of the skin	Vasculitis	BEFREE	12233881, 15846589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis, Leukocytoclastic, Cutaneous	Vasculitis	BEFREE	28951703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	20031567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	34424286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	18057536, 18717682, 20560952, 22333690, 23878221, 25283497, 26370050, 28247923, 31499059, 31620869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	18057536, 32295963	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	26370050	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	18057536, 18717682, 20560952, 22333690, 23878221, 25283497, 26370050, 28247923, 31499059, 31620869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	28572674	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	19573080, 29496671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	19573080, 29496671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
X-linked agammaglobulinemia	Agammaglobulinemia, X-Linked	BEFREE	12823285		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-Linked Lymphoproliferative Disorder	Lymphoproliferative Syndrome, X-Linked	BEFREE	15761493, 21996454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xanthomatosis, Cerebrotendinous	Cholestanol storage disease	BEFREE	30186419		★★★★★ ★☆☆☆☆ Found in Text Mining only

IL10 (interleukin 10)