IL18 (interleukin 18)

Gene

• Entrez ID: 3606
• Gene name: Interleukin 18
• Gene symbol: IL18
• Synonyms (NCBI Gene): IGIF, IL-18, IL-1g, IL1F4
• Chromosome: 11
• Chromosome location: 11q23.1
• Summary: The protein encoded by this gene is a proinflammatory cytokine of the IL-1 family that is constitutively found as a precursor within the cytoplasm of a variety of cells including macrophages and keratinocytes. The inactive IL-18 precursor is processed to

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004304	hsa-miR-346	qRT-PCR, Luciferase reporter assay, Western blot, Northern blot	19342689
MIRT054556	hsa-miR-197-3p	Microarray, qRT-PCR	23710316
MIRT438748	hsa-miR-130a-3p	ELISA, Luciferase reporter assay, qRT-PCR	24801815
MIRT438748	hsa-miR-130a-3p	ELISA, Luciferase reporter assay, qRT-PCR	24801815
MIRT1064132	hsa-miR-129-5p	CLIP-seq
MIRT1064133	hsa-miR-4252	CLIP-seq
MIRT1064134	hsa-miR-4304	CLIP-seq
MIRT1064135	hsa-miR-4438	CLIP-seq
MIRT1064136	hsa-miR-5095	CLIP-seq
MIRT2015262	hsa-miR-1307	CLIP-seq
MIRT2015263	hsa-miR-197	CLIP-seq
MIRT2015264	hsa-miR-4284	CLIP-seq
MIRT2015265	hsa-miR-4638-5p	CLIP-seq
MIRT2015262	hsa-miR-1307	CLIP-seq
MIRT2247554	hsa-miR-143	CLIP-seq
MIRT2015263	hsa-miR-197	CLIP-seq
MIRT2247555	hsa-miR-3149	CLIP-seq
MIRT2247556	hsa-miR-3155	CLIP-seq
MIRT2247557	hsa-miR-3155b	CLIP-seq
MIRT2247558	hsa-miR-3663-5p	CLIP-seq
MIRT2247559	hsa-miR-411	CLIP-seq
MIRT2015264	hsa-miR-4284	CLIP-seq
MIRT2247560	hsa-miR-4635	CLIP-seq
MIRT2015265	hsa-miR-4638-5p	CLIP-seq
MIRT2247561	hsa-miR-4716-5p	CLIP-seq
MIRT2247562	hsa-miR-4770	CLIP-seq
MIRT2247563	hsa-miR-4781-3p	CLIP-seq
MIRT2247564	hsa-miR-484	CLIP-seq
MIRT2247565	hsa-miR-5096	CLIP-seq
MIRT2015262	hsa-miR-1307	CLIP-seq
MIRT2015263	hsa-miR-197	CLIP-seq
MIRT2015264	hsa-miR-4284	CLIP-seq
MIRT2015265	hsa-miR-4638-5p	CLIP-seq
MIRT2015262	hsa-miR-1307	CLIP-seq
MIRT2015263	hsa-miR-197	CLIP-seq
MIRT2015264	hsa-miR-4284	CLIP-seq
MIRT2015265	hsa-miR-4638-5p	CLIP-seq
MIRT2015262	hsa-miR-1307	CLIP-seq
MIRT2015263	hsa-miR-197	CLIP-seq
MIRT2015264	hsa-miR-4284	CLIP-seq
MIRT2015265	hsa-miR-4638-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HDAC9	Unknown	11944905
NFKB1	Activation	15963597;17399992
NFKB1	Unknown	10227974
RELA	Activation	15963597;17399992
RELA	Unknown	10227974
SPI1	Unknown	14991611

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IDA	11466388
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	14528293, 25500532
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	ISS
GO:0005125	Function	Cytokine activity	TAS	8666798, 11598150
GO:0005515	Function	Protein binding	IPI	19104048, 25261253, 28514442, 32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	11598150
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	33883744, 37993712, 37993714
GO:0005615	Component	Extracellular space	IDA	21323571
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007267	Process	Cell-cell signaling	TAS	9792649
GO:0008283	Process	Cell population proliferation	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IEA
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0030101	Process	Natural killer cell activation	IEA
GO:0030155	Process	Regulation of cell adhesion	IDA	11477102
GO:0030431	Process	Sleep	ISS	11506998
GO:0032722	Process	Positive regulation of chemokine production	TAS	11598150
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	20027291
GO:0032729	Process	Positive regulation of type II interferon production	IDA	10653850, 14528293, 19088061, 20027291
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	TAS	10227975
GO:0032736	Process	Positive regulation of interleukin-13 production	TAS	10227975
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	16482511
GO:0032819	Process	Positive regulation of natural killer cell proliferation	IDA	19088061
GO:0034105	Process	Positive regulation of tissue remodeling	IC	16482511
GO:0035655	Process	Interleukin-18-mediated signaling pathway	IDA	14528293, 21321938, 25500532, 37993714
GO:0035655	Process	Interleukin-18-mediated signaling pathway	IEA
GO:0042088	Process	T-helper 1 type immune response	IDA	8766574
GO:0042092	Process	Type 2 immune response	TAS	11905033
GO:0042104	Process	Positive regulation of activated T cell proliferation	IDA	8766574
GO:0042119	Process	Neutrophil activation	IEA
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IEA
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	10903731
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0045515	Function	Interleukin-18 receptor binding	IDA	14528293, 25500532, 37993714
GO:0045630	Process	Positive regulation of T-helper 2 cell differentiation	IEA
GO:0045630	Process	Positive regulation of T-helper 2 cell differentiation	ISS
GO:0045662	Process	Negative regulation of myoblast differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24615654
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	21321938
GO:0050729	Process	Positive regulation of inflammatory response	IC	16482511
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	25500532
GO:0051142	Process	Positive regulation of NK T cell proliferation	IDA	19088061
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	21321938
GO:0061436	Process	Establishment of skin barrier	IEA
GO:0061436	Process	Establishment of skin barrier	ISS
GO:0070328	Process	Triglyceride homeostasis	IEA
GO:0070328	Process	Triglyceride homeostasis	ISS
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	26656097
GO:0150078	Process	Positive regulation of neuroinflammatory response	TAS	26753638
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA
GO:2000556	Process	Positive regulation of T-helper 1 cell cytokine production	IDA	10653850

Other IDs

• MIM: 600953
• HGNC: 5986
• e!Ensembl: ENSG00000150782

Protein

• UniProt ID: Q14116
• Protein name: Interleukin-18 (IL-18) (Iboctadekin) (Interferon gamma-inducing factor) (IFN-gamma-inducing factor) (Interleukin-1 gamma) (IL-1 gamma)
• Protein function: Pro-inflammatory cytokine primarily involved in epithelial barrier repair, polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses (PubMed:10653850). Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex whi
• PDB: 1J0S, 2VXT, 3F62, 3WO2, 3WO3, 3WO4, 4EEE, 4EKX, 4HJJ, 4R6U, 4XFS, 4XFT, 4XFU, 7AL7, 8J6K, 8SPB, 8SV1, 8URV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00340	IL1	72 → 185	Interleukin-1 / 18	Domain

• Tissue specificity: TISSUE SPECIFICITY: [Isoform 2]: Expressed in ovarian carcinoma but undetectable in normal ovarian epithelial cells. Resistant to proteolytic activation by caspase-1 and -4. {ECO:0000269|PubMed:15326478}.
• Sequence:

  MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ
  GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK
  EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL
  GDRSIMFTVQNED

• Sequence length: 193

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC RHINITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE CHRONIC HEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE HEPATITIS WITH CENTRILOBULAR NECROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY ATRESIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CALCINOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF EYE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GIANT CELL ARTERITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE PROLAPSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS B	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS C	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, AUTOIMMUNE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY, IMMEDIATE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME X	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA SYNDROMES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Three Vessel Coronary Disease	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URTICARIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AA amyloidosis	AA amyloidosis	BEFREE	15257727		★☆☆☆☆ Found in Text Mining only
Acne	Acne	BEFREE	12554798		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	25747584, 28456882, 28689006, 29685010, 31596518		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	24778454		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	30217873, 30997931, 31764513		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	12163048, 26342105, 27928589		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	27706625		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	28630305		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10371355, 28811967		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	22664470, 22951876		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	28087305		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30217873, 31764513		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	27098789, 30102381		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	24012762, 25363549, 26760997, 31438981		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	18983635		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	12532106, 16406079, 17252172, 17620074, 22840759, 23023653, 28692122		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	24446726, 29349811		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	24446726, 29349811		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17299019, 21368376, 22272623, 26626881, 27229914, 28984607, 33101286, 34209408, 36835494, 36918839, 38178159	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22898493, 26939933	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	19073159		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30903865		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29472887		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	32515902	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	12738632		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	15257727, 26946405		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	30907293, 40481763	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	15257727	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	27636371, 31448710		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	37752552	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	31257469	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	24040261	Associate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	LHGDN	15927856		★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	28059484		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	32347623	Stimulate	★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	Pubtator	39566744	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	30832404		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	16971411		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anterior uveitis	Pubtator	16971411	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	27430614, 28540928		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	27430614, 35082268	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	27430614, 28540928		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29956759, 31445353, 31821481		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	31427887	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	15005735		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	39986193	Associate	★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	23334427		★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	29151018		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11581135, 14527086, 15860756, 16043644, 16554298, 17487222, 18599493, 19473509, 19561311, 20350254, 20428172, 20663688, 21842238, 22015107, 22141572, 26381780, 28345767, 28394319, 28547701, 28950870, 29129476, 29352570, 29478963, 30246263, 30400655, 30680020, 30782961, 31281442, 31294625		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12626794, 14640907, 15104599, 15834055, 19031096, 19684151, 20565717, 29854762, 29941463, 30269670, 31515542, 9916738		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	14640907, 16563174		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	15479888, 15834055, 22687048	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	15188370, 16563174, 30619348	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	34963488, 35189047	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16728461	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Reactive	Reactive arthritis	Pubtator	22229864	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11229457, 11477102, 11598150, 11879550, 12105209, 12117680, 12571841, 12571842, 12632414, 12695561, 14872485, 15022319, 15479886, 15479888, 15769913, 17530707, 20478055, 21834067, 22355377, 23856797, 24762050, 31376255, 31992083, 33101286	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26749303, 34530864, 37386795	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	16406656		★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	LHGDN	16406656		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10543274, 11342664, 11703360, 12911784, 15230817, 15932380, 16243298, 16316892, 16433859, 16516851, 17767553, 18093181, 18200581, 18250135, 18382474, 19247692, 19288449, 19910030, 21611751, 22069270, 23023653, 23085113, 24167151, 24711060, 26214524, 26869672, 27460807, 27913952, 28922563, 29505668, 29545090, 31522432		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	11703360	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	16516851, 17767553, 18093181, 18200581		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	18200581, 19288449, 29515128, 32633386, 34591794	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	11581135, 14527086, 15860756, 16043644, 16554298, 17487222, 18599493, 19473509, 19561311, 20350254, 20428172, 20663688, 21842238, 22015107, 22141572, 26381780, 28345767, 28394319, 28547701, 28950870, 29129476, 29352570, 29478963, 30246263, 30400655, 30680020, 30782961, 31281442, 31294625		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	11805151, 19204428, 19473509, 19561311, 22141572, 24040261, 31427887, 33936102	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	15860738, 17626902		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28526653, 30103053		★☆☆☆☆ Found in Text Mining only
ATRIAL SEPTAL DEFECT 1	Atrial Septal Defect	BEFREE	11263769, 11752512, 30404814		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	11263769, 11752512, 30404814		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	31591201, 39481220	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	11263769, 11752512, 26728085, 30404814, 31125917, 31591201		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	26728085		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	CTD_human_DG	21227906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12554798, 14615579, 15380044, 15985430, 16571086, 18250135, 19584085, 19758166, 20424918, 20478055, 20663688, 21163704, 21636628, 23271701, 23556537, 23651166, 23892891, 24742099, 26005048, 26362438, 27063085, 27600402, 27649785, 29478963, 29705848, 29915579, 29930297, 30316805, 30992532		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	14991611, 15147347, 15380044, 17302897, 18684981, 20478055, 20586818, 22531046, 24742099, 27600402, 29915579, 29930297, 32826615, 35398099	Associate	★☆☆☆☆ Found in Text Mining only
AUTOINFLAMMATION WITH INFANTILE ENTEROCOLITIS	Autoinflammation With Enterocolitis	BEFREE	28957823		★☆☆☆☆ Found in Text Mining only
Autoinflammatory disorder	Autoinflammatory Disease	BEFREE	22512814, 29742060, 30388107		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	39712014	Stimulate	★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	14734463		★☆☆☆☆ Found in Text Mining only
Bardet-Biedl Syndrome	Bardet-Biedl Syndrome	BEFREE	27826889		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	22664470, 22951876, 23600758		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	15654836	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	BEFREE	16273766, 17055358, 22197901, 24935632, 28377641, 29600486		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	LHGDN	17055358		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	29534057	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	21273262		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	24615654, 25892571, 27881017		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	21464751, 30059753		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	30383306		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	30575805, 34758379	Stimulate	★☆☆☆☆ Found in Text Mining only
Bladder Exstrophy	Bladder Exstrophy	BEFREE	20418295		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23403235		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	26448366	Associate	★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	27821270		★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	22343120	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	36539847	Inhibit	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	30596792	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	15829914		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	BEFREE	31794744		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	15869409		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11131641, 19152241, 19535202, 24898701, 25335731, 25727011, 26214646, 27082857, 28415798, 29725393, 29926984, 31519608		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11471895, 21931812, 29926984, 33507690, 34196131, 35233921	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38031068	Stimulate	★☆☆☆☆ Found in Text Mining only
Bright Disease	Bright Disease	CTD_human_DG	18462998		★☆☆☆☆ Found in Text Mining only
Bronchial Diseases	Bronchial Diseases	BEFREE	15230817		★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	28684545		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	LHGDN	12938205		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	24167151		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	36561744	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	20971720, 27821270		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	14734463, 15498855		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	15498855	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	30127645		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	27903846	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21719740, 27429592, 29341496, 33773554, 37501379	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	39173282	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23403235		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19642044, 27121382		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19064572, 24963217	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34691034, 36131941, 37533202	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22493490, 29905412, 30925760, 36707882, 38148073	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	12594574	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11948465, 15581980, 16217764, 19064572, 19263242, 23873689		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	17948066, 27888626, 29862462		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies, Primary	Cardiomyopathy	BEFREE	14522416		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	17948066	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	15371332		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	15941925, 16043644, 16472051, 17962365, 17984243, 18628791, 19473509, 19712260, 20150558, 21842238, 22015107, 23856797, 26438531, 27741477, 30939472, 31419967		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	16306550		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	19473509, 20150558, 31427887, 35069552, 36012132	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	22898493	Stimulate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	29151018, 38167983	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	29151018, 30680020		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	29485097		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	29485097, 32927275	Stimulate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	29485097, 38167983	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	10806046, 15834055	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	15176994	Inhibit	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	17100768, 18435801, 19103669, 25374428, 27063085, 28934294		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	35705047	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	36439158	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	23739747, 35862251	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30628668		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	33678651	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	LHGDN	11895335		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	17072982, 22837141		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	17965486		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	17981284, 31525735		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23603311, 31554368		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	18773860, 23603311, 31554368		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	25743241		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30217873, 31764513		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	38221530	Associate	★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	23302036		★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	28697498		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	15257727, 17072982, 28077069, 35563697	Associate	★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	31681257		★☆☆☆☆ Found in Text Mining only
Chronic Infantile Neurological, Cutaneous, and Articular Syndrome	Neurological, Cutaneous And Articular Syndrome	BEFREE	15476236, 30388107		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	28990414, 29097485, 31119516		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	20688930, 28054933, 28476556, 29371912, 29948504, 30357395, 30803749		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	14734463		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17237446, 17436040, 19208460, 23171362, 23392573, 24565845, 28830544, 29123531, 29656319, 31066258		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	17237446		★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	37304287	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	LHGDN	18279187		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	19664151, 19811440, 30422379, 30483730		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	31065235	Associate	★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	BEFREE	30782515		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	26147061, 28013112, 30392846		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	14993881		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	17299019, 20083555	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	31731189		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	11606501, 27280937, 27966619, 28155620, 29963998, 31017261		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	22135309	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	22135309, 37228614	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26698117, 33201212, 34944097	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10371355, 10673399, 11739524, 17589921, 26216891, 31017261		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18225542, 19638090, 22699929, 25051201, 27234655, 30231985, 31289546		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17160410, 18225542, 33507690, 33660570, 35969377	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18225542		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33294056	Inhibit	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	34146579	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	12858406, 15138116, 23376086, 30911280, 31084469		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	21464751, 30059753		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital contractural arachnodactyly	Pubtator	21395662	Inhibit	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	15371332, 17303764, 17765248, 18678419, 24531812, 24585936, 26228789, 28072632, 28935571, 31019174, 31535629		★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15044962, 19305163, 19961892, 29905412, 30925760		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	16043644, 17445542, 17962365, 18599493, 19687159, 20096599, 20735470, 21481392, 22141572, 24040261, 24585936, 25822970, 27813570, 28786243, 30939905, 31584380, 31661113		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	16043644, 17445542, 17962365, 18599493, 19687159, 20096599, 20735470, 21481392, 22141572, 24040261, 24585936, 25822970, 27813570, 28059484, 28786243, 30939905, 31584380, 31661113		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	16043644, 16405895		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	22141572, 24040261, 25822970, 26304941, 27813570, 32039564	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	26749303, 27727089	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	16043644, 17445542, 17765248, 17962365, 18599493, 19687159, 20096599, 20735470, 21481392, 22141572, 24040261, 24585936, 25822970, 27813570, 28786243, 30939905, 31584380, 31661113		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	17765248, 17951325		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	10384110, 11282552, 11606501, 11739524, 12572878, 14527086, 16306764, 16306765, 17318554, 21273776, 26229413, 26698117, 28139755, 28352119, 29247988, 30462201, 31017261		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	11282552, 11739524, 12594843, 15996200, 26698117, 33201212	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	12572878, 12594843, 16306764		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	22135309	Stimulate	★☆☆☆☆ Found in Text Mining only
Cryopyrin-Associated Periodic Syndromes	Cryopyrin-Associated Periodic Syndromes	BEFREE	20179416, 24084736, 25217959, 25730877, 30388107		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	LHGDN	11888846		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	31731729		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	15463896, 25648527		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	15463896		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	15463896, 32118580	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	20026745	Inhibit	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	31532390	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystinosis	Cystinosis	BEFREE	24525029		★☆☆☆☆ Found in Text Mining only
Dandy-Walker Syndrome	Dandy-Walker Syndrome	BEFREE	28569153		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	29105174, 29786104, 30103053, 30221660		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10562301, 11508579, 14640907, 14738910, 15104599, 16368150, 18374640, 22201856, 22825306, 29138829, 29663159, 30644275, 31545916		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	30231985		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	27816188		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	17988833, 31414991		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	30552710		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	10359806	Associate	★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	27876501, 30041275		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	11226333, 21962565, 27001087, 27430614, 27590137, 28096677, 28582802, 28689006, 29520075, 30092066		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	11226333, 16289586, 21962565		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	27430614, 31931428, 40403713	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	31931428	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	40226698	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	12151598, 20179416, 28299442, 30741833		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	31276585	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	17274000	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	11703360, 17274000, 22069270, 32896640, 36736455	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	27585668		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Allergic Contact	Dermatitis	BEFREE	29723367		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	11590389, 11703360, 12151598, 14527086, 14769879, 15488700, 15806006, 16914167, 17517100, 19637196, 20060272, 22069270, 22840759, 24995282, 27543731, 27805275, 29672867		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	LHGDN	17517100, 18922682		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	LHGDN	15955098		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	28588486		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	16968394, 32644977, 36012289	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	27098789, 30102381		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	27098789	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	14709415, 16186395, 16306329, 17445542, 18448614, 19110334, 22141572, 26517838, 27741477, 29217651, 29885882		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28580570, 38326276	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	36499008, 38029485	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	14709415, 16186395, 16306329, 17445542, 18448614, 19110334, 22141572, 26517838, 27741477, 28652186, 28858634, 29151018, 29217651, 29885882, 30981863, 31338905		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	15646011		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22141572, 28834572	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26517838, 33323459	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18435801, 25576800, 39273664	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22069270, 23557801, 23891168, 24677179, 28973736, 32035746	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18853133, 20150558, 20227263, 22141572, 23086037, 25587543, 26362438, 28508444, 34789800, 34917685, 39202464, 39434299	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22898493, 31077210, 31551515	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11317661, 12401730, 14679107, 14709415, 15585330, 15674367, 16443795, 16492204, 16568259, 16909454, 17373930, 17911429, 18435801, 20061784, 22069270, 23137633, 23557801, 23891168, 25576800, 26116895, 28973736		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	16358956, 18359638		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15941925, 16186395, 16472051, 17445542, 18853133, 19110334, 20150558, 20960175, 22141572, 26362438, 27741477, 28125566, 28935571, 29151018, 29217651, 29256638, 29520075, 30422379, 30527256, 30971430, 31024619, 31077210, 31253830		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	29217651		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	33323459	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36726458	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	16306550		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	18256353, 19110334, 19712260, 28125566, 28798291, 28954270, 29514038, 30086405, 30417374, 30534570, 30571313, 30632070, 31593848		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29450537, 29571734		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	36430950	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	21876975		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	16571086		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dissection of aorta	Aortic dissection	BEFREE	31427887		★☆☆☆☆ Found in Text Mining only
Diverticulitis	Diverticulitis	BEFREE	17318554		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	25962072		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	23746337		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	29514661, 30453990		★☆☆☆☆ Found in Text Mining only
Dyspepsia	Dysphasia	Pubtator	18946358	Stimulate	★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	31427887		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	29039974		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	11590389, 11703360, 12151598, 14527086, 14769879, 15488700, 16914167, 17517100, 20060272, 22069270, 22840759, 27543731, 28839348, 29672867		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	15955098, 22761702, 31276585	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	24330827	Stimulate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	26728085		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30586414		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	14556808, 14998974		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	14556808, 18295214, 20797704, 36233009	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	14998974, 16084898, 16963127, 20797704, 22537218		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36469254	Stimulate	★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	BEFREE	31253830		★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	Pubtator	31253830	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	25638412, 25801352, 29363170, 30779114		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	25638412	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	25638412, 25801352		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	25638412	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	31796120		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	16217764, 19064572, 23873689		★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Esophageal achalasia	Pubtator	27511445	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24130810, 26214646, 26681034, 28231690, 29264744		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24130810, 26214646, 26681034, 28231690		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28231690	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23175214, 35789548	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28231690	Inhibit	★☆☆☆☆ Found in Text Mining only
Esophageal Varices	Esophageal varix	BEFREE	30392846		★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	30123073		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	27888626	Associate	★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	25921117, 26277868		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	22664470		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28683730, 29854715		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28730512, 29956204		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	17222831		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	25952099, 31301646		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	29137483		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	37268663	Stimulate	★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	21645364		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	21751146	Associate	★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	14527086		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	18178861, 31511355		★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	Pubtator	22229864	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	23600758		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	29363170		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	20331879	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gingivitis	Gingivitis	BEFREE	18930181, 19664151		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	26820987	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	15985430		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	39523551	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26252165, 27813570		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35302191	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	14615579, 20545903		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	CTD_human_DG	18462998		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	Pubtator	24701032	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis IGA	Iga nephropathy	Pubtator	29137483	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28052869		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	29137483	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	27738386	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	BEFREE	21487696		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	14993881	Stimulate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	31680001, 34539656	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	LHGDN	12819633		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	25814531, 28119258		★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	31681257	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	16433722, 16571086, 28515387		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	28515387	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	36561758	Stimulate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	14688108		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	14688108		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	20586818, 23073298, 28515387		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	20586818	Stimulate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	21876975, 28515387	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29185028, 30127645		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	14960579	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	15371332, 17303764, 17765248, 18678419, 24531812, 24585936, 26228789, 28072632, 28935571		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37707956	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	CTD_human_DG	21335463		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangioma	Hemangioma	BEFREE	31710248		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	12775234, 14630085		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	12775234, 30997931		★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	27982687		★☆☆☆☆ Found in Text Mining only
Hemophagocytic Syndrome	Hemophagocytic Syndrome	BEFREE	29247988		★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	22289535		★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	25149528	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	11091279	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	24872585, 26320490, 26986131, 27429592, 37585994	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C	Hepatitis c	Pubtator	12165091, 18781864, 21984735, 28300059, 29341496	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C	Hepatitis c	Pubtator	19740312	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C Chronic	Hepatitis c	Pubtator	19740312	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	34840527	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	19740312	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	36553538	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	33507690, 34196131	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytosis haematophagic	Histiocytosis Haematophagic	BEFREE	20072626, 29979096		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	21061265, 22863216, 25880879		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	22863216		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	25798846	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	16280123		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	11298325	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	21842238, 27648697, 28394363, 28408434, 30417374, 30657854		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	28394319		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	17893261		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	28137856		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	16280123		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22141572, 31427887	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19687159, 22141572, 24565845, 27413021, 27993956, 31379247		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30101852		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30101852		★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	27888626	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy of parotid gland	Hypertrophy Of Parotid Gland	BEFREE	22326205		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	26722554, 29780394, 31059009		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	26722554	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30459756, 34691034, 35789548	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	31410171		★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	15005726		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31692724		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	15308504, 16315783		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	18216050	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	26743485	Stimulate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	27028244, 29137483		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	23675517, 23739747	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	23739747		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	19077159, 19797730, 23556537, 24231118, 24742099, 24801815, 24897237, 26306997, 27600402		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	12654794		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	17299019, 17988833, 26830320, 30524241, 31030091		★☆☆☆☆ Found in Text Mining only
Infertility Female	Female infertility	Pubtator	40226698	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	12572878, 15663745, 16306764, 16306765, 16316892, 17318554, 17948929, 18786924, 19230040, 21273776, 23651166, 27460807, 28139755, 28155620, 29203393, 29515025, 30811631, 31017261, 31139196, 31253830, 31276585, 31632367		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19230040, 22135309, 31253830, 31276585, 33201212, 34944097, 36726458, 38031150	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	37228614	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	28766916		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	12151598, 28299442, 30741833		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	16464907, 17299108, 20227263, 20964873, 23675517, 28508444, 28834572, 29342149	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	29648472	Stimulate	★☆☆☆☆ Found in Text Mining only
Internal Carotid Artery Stenosis	Internal Carotid Artery Stenosis	BEFREE	29485097		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	24971599	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	37752552	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	22229864, 31632367		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	15371332		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	20097272, 23739747, 30172704, 30431529, 30878372, 31525735		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	39394477	Stimulate	★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	15230817, 16563174, 31379071		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	LHGDN	17343316, 17597334		★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	BEFREE	25962072		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	12390326, 19110334, 22258321, 30922667		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	12390326, 24701032, 37707956, 37942539	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	29930551	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	17517876, 19758166, 24585936, 26465326		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	25587543, 28651949	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	26496326	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	22854644, 27387432, 27741065, 28011057, 28089174, 28131602, 28222674, 28417544, 28430754, 28755073, 28759707, 28844586, 29261164, 29285155, 29627485, 29684255, 29881239, 30278563, 30429237, 30552306, 30700847, 30736871, 31206554, 31405732, 31827648		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	31119516		★☆☆☆☆ Found in Text Mining only
Large cell carcinoma of lung	Lung Carcinoma	BEFREE	22699929		★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Autoimmune Diabetes	BEFREE	15585330		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	27888626, 28382080		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	23103228	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	11855785		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12775234, 18336908, 18706445		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	18593530	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	26076658	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	LHGDN	15645140		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12163048, 12775234, 14630085, 17308068, 26342105, 27928589, 29344132, 30997931		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	26076658		★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	LHGDN	11895335		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	18225563, 24349532, 25398690, 30420792		★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	BEFREE	16847472		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	16847472, 20331838, 29342149		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	Pubtator	29342149	Stimulate	★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	28052869		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12175634, 15643599, 16108033, 17462500, 18297714, 19757044, 23632060, 26292095, 26893476, 27429592, 28000712, 29113394, 29341496, 29935904, 30556857, 31830994		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17708609		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	18297714, 26147061, 26320490, 28013112, 29113394, 30236988, 30392846		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	26320490	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	11413118	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	11091279, 28922472	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	19740312, 26320490	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	12165091, 30392846		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	12165091, 25512222	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	LHGDN	12679613		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12175634, 26292095		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	16420594, 16971411, 20971720, 31379071		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	16420594, 16971411, 22489883, 36255321	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	31379071	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases, Interstitial	Lung Diseases	BEFREE	20089076, 21257923, 30269670		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25910707, 27121382, 31939449, 35012533	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29241547		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	19758166, 22841963, 24992143		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	22761702	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	12390326, 17364073, 18050226, 19288449, 28288675, 29930297, 32644977, 33919154, 38031150	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15373921, 21149337, 29550813, 29930551	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Cutaneous	Lupus Erythematosus	LHGDN	18821674		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	19758166, 22841963, 24992143		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12390326, 17117487, 17361200, 18250135, 19031096, 19074166, 19288449, 19387647, 19584085, 19758166, 21149337, 21470492, 22841963, 23153245, 23238919, 23263551, 23914907, 24992143, 26005048, 26026656, 26465326, 28288675, 29422069, 29550813, 29892303, 29930297, 29930551, 30857465, 31110478, 31842967		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17117487, 17361200, 17364073, 18250135, 18399311		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	12390326, 16978540, 19074166, 20140691, 29874961, 30388519, 30857465		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	LHGDN	12390326, 18163476		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	15373921, 16978540, 36610524	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	17324967, 18163476, 19021013, 27738386	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	19758166, 22841963, 24992143		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24349532, 29926984	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	10444185	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	34925545	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	24084330, 28815559, 29695416		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	14734463, 15498855, 25880879, 29312552, 29517616, 29551295		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	18050195	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	35965624	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	19508433, 21418175		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	16428475		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	LHGDN	16428475		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	10393857	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	14734463		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	LHGDN	14734463		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	28503820	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Syndrome, X-Linked, 2	Lymphoproliferative Disorder	BEFREE	24084330		★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	25963521, 26196376, 27846755, 28815559, 29247988, 29295842, 29326099, 29870499, 30671214, 30877950, 31192813, 31299380, 31326996, 31379071, 31710506		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	33364081	Stimulate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28122130, 28263786, 30981863		★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	29079540		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29185028, 30127645		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	24431405		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11131641, 19152241, 19535202, 24898701, 25727011, 26214646, 27082857, 28415798, 29725393, 29926984, 31519608		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30586414		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24130810, 26214646, 26681034, 28231690		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	19638090, 24066061, 26681034		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	19961892		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19642044, 27121382		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	18225563, 24349532, 25398690		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	CTD_human_DG	24349532		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	30127645		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11948465, 15581980, 19263242, 23873689		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29599908, 31753718		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12918059, 17688413, 23546966, 24061634, 25351720, 25892571, 25921117, 26277868, 27881017		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17688413		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16650813, 25776473, 29322421, 29396054		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	26041375		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23403235		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10673399, 11739524, 11848485, 11948465, 17462500, 17888032, 18773860, 19152241, 19263242, 19305163, 19535202, 20490717, 21697887, 23739747, 23794112, 24066061, 24130810, 24898701, 25051201, 25548255, 25727011, 25776473, 25892571, 26214646, 27133472, 27206676, 28153032, 28415798, 29226090, 29312552, 29478963, 29514661, 29517616, 29768210, 30127645, 30464617, 30538296, 31731729, 31753718		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	21273262		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23603311, 31554368		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17589921, 26216891, 31017261		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	23429441, 26658898, 30832404		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	23429441	Inhibit	★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	27810076		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16645618, 16650813, 18386818, 21697887, 23707237, 23938462, 25727011, 31731729		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18386818		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25889680, 30149677, 37620327	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	38052629	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	11226333, 21962565, 27001087, 27430614, 27590137, 28096677, 28689006, 29520075, 30092066		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	11226333, 16289586, 21962565		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	29195684		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29514661		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20227263, 22141572, 28508444	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	CTD_human_DG	16644639		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	17445542, 20227263, 21842238, 22141572, 27133472, 28531131, 29168426, 29217651, 29854715, 30515292		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metastatic melanoma	Metastatic Melanoma	BEFREE	28282548		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	30199767	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	30541566		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	21840518, 25690033		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	34216617	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	35712242	Associate	★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	28582647		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	CTD_human_DG	24349532		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth neoplasm	Pubtator	24349532, 25398690	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muckle-Wells Syndrome	Muckle-Wells Syndrome	BEFREE	22512814		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	18484687, 19288449, 28730667, 29625336, 30541507, 31611559		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	LHGDN	18484687		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	19288449, 28707750	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	34035116	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	21248470, 26146985, 34282497	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29551594		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	11960649, 15471361		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	15471361, 20644165, 24402877, 26743536, 27050759, 27177146, 28582647, 30367882, 30658261, 31736980		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	27916909	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	29780394	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	25586466		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	38325197	Associate	★☆☆☆☆ Found in Text Mining only
MYD88 Deficiency	MYD88 Deficiency	BEFREE	28951422		★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	26076658		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	26076658, 27737891		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	37420006	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	14630085		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	14630085		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	18835036, 29097263		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17981284, 21481392, 28673582, 31645662, 31661113		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	17981284, 24040261, 31257469	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	35558073, 37811136	Inhibit	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28673582, 29862462		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	16968394	Stimulate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	30102381		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	27498356	Associate	★☆☆☆☆ Found in Text Mining only
Nail-Patella Syndrome	Nail-Patella Syndrome	BEFREE	24577461		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	21538928	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	16059673	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18555694, 19622039, 20490717, 23794112, 24066061, 24130810, 24460336, 29185028, 30127645, 30464617		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	19740312	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	16146753		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10371355, 10805213, 11358987, 11739524, 11948465, 12189722, 12918059, 14734463, 16059673, 16650813, 17182598, 17727254, 18003981, 18555694, 19016763, 19265133, 19642044, 19961892, 20385749, 20490717, 21876975, 22664470, 22699929, 23175214, 23546966, 24349532, 25725098, 26252165, 26600055, 26893476, 27242376, 27810076, 27894857, 28415798, 28766916, 28811967, 29226090, 29241547, 29296541, 29599908, 29690614, 29725393, 29768210, 29985074, 30231985, 30500835, 30524946, 31749214		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	21273262		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	19074166, 29422069		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	LHGDN	19074166		★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Interstitial nephritis	Pubtator	25587543	Associate	★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	25587543		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	25587543		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	LHGDN	18391570, 18819819		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	29731827		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	19110334		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31675164		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	18947885		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	32941527	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30658261		★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	27810076		★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	27826889		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28245087, 29854715, 30576537, 31551515		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28002583, 28811967, 31670094, 31692261		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	31207429		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	31761332		★☆☆☆☆ Found in Text Mining only
Norrie disease	Norrie Disease	BEFREE	29344132		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15941925, 16472051, 17299108, 17445542, 17637700, 17893261, 18448614, 20227263, 22531046, 22553983, 23675517, 27648697, 28394363, 29168426, 29854715, 30002491, 31507607, 31551515		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	17299108, 22898493, 29737494, 31551515	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20227263, 22531046, 23675517, 28508444, 29146643, 29926984, 32188105, 32251712, 35712242	Associate	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 1A	Oculocutaneous albinism	BEFREE	28013112, 30041275		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	24286485	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	40165317	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	21245324, 22136483		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	38401466	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30422379		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36553538	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29226090		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	11948465		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	LHGDN	15212675, 15302292		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	26823856	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12527894, 19064572		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15581980, 19263242, 23873689		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24510590	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24963217	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29599908, 31753718		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	31753718		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15684607, 32347623, 36199146, 36743929	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	17907957, 19102398		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	22415665, 31753718		★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	17072982	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	17072982		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	30316805		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	26600055		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	24449512	Associate	★☆☆☆☆ Found in Text Mining only
Paracoccidioidomycosis	Paracoccidioidomycosis	Pubtator	17302897	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	11091279	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21241672, 26830320, 29700781		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	15842270, 17586702, 19664151		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	LHGDN	17586702		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	15842270, 24129807, 24476546, 29129846, 31739483		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	29129846, 31065235, 31739483	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	26438531		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	26438531		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Peripheral vascular disease	Pubtator	26496326	Associate	★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	28271611		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	22258321		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	22258321		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	20236632, 20964873	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	20964873, 27313119, 27809669, 29105530, 29648472, 31399035, 31722718		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	20964873, 21478181, 29648472	Stimulate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	16968394	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	27098789	Stimulate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	30102381		★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	30392846		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28623707		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	30997931, 31764513		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	28405496		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	17988833, 31414991		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	20303781		★☆☆☆☆ Found in Text Mining only
Prolidase Deficiency	Prolidase deficiency	Pubtator	38088248	Associate	★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	28271611		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12918059, 17688413, 23546966, 24061634, 25351720, 25892571, 25921117, 26277868, 27881017		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	32375790, 37847180	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17688413		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17688413		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23546966, 24061634, 25351720, 28663562, 33507690	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proteinuria	Proteinuria	Pubtator	26517838, 38401467	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	27859256		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	10571732, 15099362, 15542445, 16898079, 26707913, 27859256, 28299442, 30092066, 30741833		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	15955098, 17274000, 22761702, 35082268	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	17611614		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	31761332		★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Pulmonary alveolar proteinosis	Pubtator	31874111	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31692724		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22489883	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35583006	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	17237446, 23392573		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30527805, 30870716		★☆☆☆☆ Found in Text Mining only
Pyogenic arthritis pyoderma gangrenosum and acne	Pyogenic arthritis-pyoderma gangrenosum-acne syndrome	Pubtator	34492165	Stimulate	★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	15257727		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	23587914		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	19961892		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15044962, 19305163, 19961892, 29905412, 30925760		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	21511702, 23027874, 23904224, 27413021, 30119258, 30301527, 30527805		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	17517876, 27707982, 31593848		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	16146753		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	16146753, 16689659, 22461369, 31124933, 31206358		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	16146753		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	24490166	Stimulate	★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	30366444		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	31606551	Stimulate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10562301, 11508579, 11879550, 12365719, 12632414, 12695561, 14617033, 14640907, 14738910, 15104599, 15188356, 15517632, 15789055, 15896202, 16368150, 16671950, 16898079, 17367819, 17396252, 17530707, 18250135, 18516710, 19229765, 19342689, 20424918, 20565717, 21225442, 22945280, 23153245, 23587914, 23687262, 23856797, 23883285, 23914907, 24437572, 25192895, 26005048, 26302971, 26909913, 27649785, 28352119, 30001644, 30269670, 31119302, 31372853		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	11466388, 12105209, 12847274, 17396252, 17530707		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	16368150		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis	Rhinitis	LHGDN	17252172		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	34596583, 36032502	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	10543274, 11035116, 11123348, 11580222, 12366781, 12735669, 16053025, 16420594, 17671745, 27063085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	LHGDN	12366781, 16053025, 16420594, 16556702		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	Pubtator	12735669	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	CTD_human_DG	16100009		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	Pubtator	16420594	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Kaposi	Sarcoma	Pubtator	23388709	Associate	★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	28923068		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18092318, 21510800, 26736035, 26974498, 28923068, 29195684		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	18092318		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18092318, 21510800		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	34758379	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	39940697	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schnitzler Syndrome	Schnitzler Syndrome	BEFREE	19825519, 29284595, 30668200		★☆☆☆☆ Found in Text Mining only
SCLEROSING CHOLANGITIS, NEONATAL	Sclerosing Cholangitis	BEFREE	31634439		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	14500502, 36551320, 36923408, 39692606	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	35502507	Stimulate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	11236899, 12947340, 14500502, 16316892, 17572009, 22461369, 24292568, 24815843, 27142195, 27648697, 28974614, 29465571, 30971430, 31003186, 31129625, 31206358, 31710506		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	30316805		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	27269786		★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	27001087		★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	29282220, 29780394		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	36902104	Associate	★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	29611111		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	15380044, 29846789	Stimulate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	18050195, 18684981, 23819992, 23906036, 25880879, 28503820, 34295332	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	15955098, 17274000	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	12151598, 16428475, 30519061, 30741833		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	14993881		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	LHGDN	18685607		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	30736871		★☆☆☆☆ Found in Text Mining only
Spastic cerebral palsy	Spastic Cerebral Palsy	BEFREE	22837141		★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	20418295		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	38031150	Associate	★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	29926984		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17851835		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19642044, 25398690		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17851835, 28231690, 29264744		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22613414, 25398690	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25591548	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	14719133, 18940019, 28865486		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	22613414		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	24389343, 29685010		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	29685010, 31257469		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28245087, 29735977, 29854715		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16650813, 17461482, 25776473, 29322421, 29396054		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	18946358	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16049975, 17461482		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17461482, 18442334, 36158129	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	21478439	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	22167233, 38167983	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	39394477	Stimulate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29163015		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	11879550, 15934126, 26005048		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	11879550	Associate	★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	27846755, 28225869, 28730667, 29801971, 29870499, 30863782, 31192813, 31326996		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	19865096, 25739168, 30997045		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	29979096		★☆☆☆☆ Found in Text Mining only
Testicular Diseases	Testicular disease	Pubtator	37033952	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	35891358	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	16571086		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35515000	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	26041375		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	26041375		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	21876975	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	20586818	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	21876975		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	21876975	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28415798		★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	CTD_human_DG	21335463		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10384110, 16306765, 17318554, 21273776, 24621393, 26698117, 27966619, 28139755, 28533995		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	16059673		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34550451	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neurogenic	Neurogenic bladder	Pubtator	36012289	Associate	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	CTD_human_DG	18204966		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urticaria	Urticaria	BEFREE	21692767, 31837215		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urticaria	Urticaria	Pubtator	24490166, 36539847	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Dysplasia	Uterine disease	Pubtator	26079218	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31554368	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	17222831		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	22197901		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	27709650		★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	28860220	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	19178691, 26496326	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	LHGDN	16514436		★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	29105174	Associate	★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	BEFREE	24168677		★☆☆☆☆ Found in Text Mining only
VEXAS syndrome	Vexas syndrome	Pubtator	38291039	Stimulate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	33101286, 35712242	Associate	★☆☆☆☆ Found in Text Mining only