TNF (tumor necrosis factor)

Gene

• Entrez ID: 7124
• Gene name: Tumor necrosis factor
• Gene symbol: TNF
• Synonyms (NCBI Gene): DIF, IMD127, TNF-alpha, TNFA, TNFSF2, TNLG1F
• Chromosome: 6
• Chromosome location: 6p21.33
• Summary: This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1800629	G>A	Drug-response	Upstream transcript variant
rs281865419	C>T	Pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006787	hsa-miR-19a-3p	Luciferase reporter assay	21271217
MIRT006857	hsa-miR-203a-3p	Luciferase reporter assay	22917968
MIRT006857	hsa-miR-203a-3p	Luciferase reporter assay	22917968
MIRT053456	hsa-miR-452-5p	Microarray	23807165
MIRT054325	hsa-miR-187-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	23071313
MIRT006787	hsa-miR-19a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23795660
MIRT006787	hsa-miR-19a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23795660
MIRT437418	hsa-miR-143-3p	Luciferase reporter assay, qRT-PCR	23804075
MIRT054762	hsa-miR-130a-3p	qRT-PCR, Western blot	26045761
MIRT054762	hsa-miR-130a-3p	ChIP, Luciferase reporter assay, qRT-PCR, Western blot	26435691
MIRT054762	hsa-miR-130a-3p	ChIP, Luciferase reporter assay, qRT-PCR, Western blot	26435691
MIRT736380	hsa-miR-34a-5p	PCR array	28097098
MIRT006787	hsa-miR-19a-3p	Luciferase reporter assay	26041742
MIRT006787	hsa-miR-19a-3p	Luciferase reporter assay	26041742
MIRT732884	hsa-miR-182-5p	qRT-PCR	31990371
MIRT733152	hsa-miR-146a-3p	qRT-PCR, ELISA	33376728
MIRT733305	hsa-miR-23a-5p	RNA-seq	33262617
MIRT733306	hsa-miR-183-5p	RNA-seq	33262617
MIRT733307	hsa-miR-193a-5p	RNA-seq	33262617
MIRT733307	hsa-miR-193a-5p	RNA-seq	33262617
MIRT733309	hsa-miR-941	RNA-seq	33262617
MIRT733677	hsa-miR-100-5p	qRT-PCR, Western blotting	33980036
MIRT735823	hsa-let-7c-5p	qRT-PCR	34198264
MIRT735824	hsa-miR-149-5p	qRT-PCR	34198264
MIRT735944	hsa-miR-155-3p	Microarray, Immunoprecipitaion (IP)	31641696
MIRT736023	hsa-miR-708-5p	Western blotting, qRT-PCR, ELISA	33776573
MIRT736380	hsa-miR-34a-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR, Immunocytochemistry (ICC)	33305319
MIRT737366	hsa-miR-381-3p	Luciferase reporter assay, Western blotting, RNA-seq, qRT-PCR, Flow cytometry	32411707
MIRT755647	hsa-miR-124-3p	Luciferase reporter assay, Western blotting, qRT-PCR	38146363
MIRT1442045	hsa-miR-130a	CLIP-seq
MIRT1442046	hsa-miR-130b	CLIP-seq
MIRT1442047	hsa-miR-19a	CLIP-seq
MIRT1442048	hsa-miR-19b	CLIP-seq
MIRT1442049	hsa-miR-301a	CLIP-seq
MIRT1442050	hsa-miR-301b	CLIP-seq
MIRT1442051	hsa-miR-34b	CLIP-seq
MIRT1442052	hsa-miR-3666	CLIP-seq
MIRT1442053	hsa-miR-4295	CLIP-seq
MIRT1442054	hsa-miR-4457	CLIP-seq
MIRT1442055	hsa-miR-454	CLIP-seq
MIRT1442056	hsa-miR-4803	CLIP-seq
MIRT1442057	hsa-miR-513b	CLIP-seq
MIRT1442058	hsa-miR-519a	CLIP-seq
MIRT1442059	hsa-miR-519b-3p	CLIP-seq
MIRT1442060	hsa-miR-519c-3p	CLIP-seq
MIRT2132326	hsa-miR-1208	CLIP-seq
MIRT2132327	hsa-miR-1299	CLIP-seq
MIRT2132328	hsa-miR-1972	CLIP-seq
MIRT2132329	hsa-miR-3944-5p	CLIP-seq
MIRT2132330	hsa-miR-4310	CLIP-seq
MIRT2132331	hsa-miR-4420	CLIP-seq
MIRT2132332	hsa-miR-4717-5p	CLIP-seq
MIRT1442056	hsa-miR-4803	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF2	Activation	10688670;10748079;10913190;20068037
CEBPB	Unknown	10629048;9566900
CEBPD	Unknown	10629048
E2F1	Unknown	17707233
EGR1	Activation	10913190;14767560
ETV4	Unknown	7896795
HDAC11	Repression	21239696
HDAC3	Unknown	15356147
HMGB2	Activation	18218727
HSF1	Unknown	18689673
IRF5	Unknown	20237317
JUN	Activation	10318823;10688670;10748079;10913190
JUN	Unknown	7896795;9566900
LRRFIP1	Repression	16199883
NFAT5	Unknown	11485737
NFKB1	Activation	10079106;10748079;11749970;12058956;12686724;15013838;16707469;16916598;17407192;18057724;20066113;7876168;8219230;8679226
NFKB1	Unknown	10551799;10837498;10963848;11297551;14960579;15812247;16040075;16433741;17442180;17707233;18285351;20237317;9916895
NR4A1	Repression	19213954
RELA	Activation	10079106;10748079;11749970;12058956;12686724;15013838;16707469;16916598;17407192;18057724;20066113;7876168;8219230;8679226
RELA	Unknown	10551799;10837498;10963848;11297551;14960579;15812247;16040075;16433741;17442180;17707233;18285351;20237317;9916895
SIRT1	Unknown	21245135
SP1	Activation	10688670;10913190
SP1	Repression	12759366
SPI1	Unknown	10748079

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	1618860
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15345745
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	17350185
GO:0001666	Process	Response to hypoxia	IEA
GO:0001774	Process	Microglial cell activation	IEA
GO:0001774	Process	Microglial cell activation	ISS
GO:0001774	Process	Microglial cell activation	NAS	26753638
GO:0001819	Process	Positive regulation of cytokine production	IDA	10443688, 17922812
GO:0001891	Component	Phagocytic cup	IEA
GO:0001891	Component	Phagocytic cup	ISS
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	17389591
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IEA
GO:0002020	Function	Protease binding	IEA
GO:0002020	Function	Protease binding	IPI	12777399
GO:0002037	Process	Negative regulation of L-glutamate import across plasma membrane	IEA
GO:0002281	Process	Macrophage activation involved in immune response	IEA
GO:0002439	Process	Chronic inflammatory response to antigenic stimulus	IMP	14512626
GO:0002637	Process	Regulation of immunoglobulin production	IEA
GO:0002639	Process	Positive regulation of immunoglobulin production	IEA
GO:0002719	Process	Negative regulation of cytokine production involved in immune response	IDA	10443688
GO:0002876	Process	Positive regulation of chronic inflammatory response to antigenic stimulus	IEA
GO:0002925	Process	Positive regulation of humoral immune response mediated by circulating immunoglobulin	IEA
GO:0003009	Process	Skeletal muscle contraction	IEA
GO:0003085	Process	Negative regulation of systemic arterial blood pressure	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	10748004, 27830702
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	TAS	24966471
GO:0005164	Function	Tumor necrosis factor receptor binding	IDA	14512626
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005164	Function	Tumor necrosis factor receptor binding	IPI	9435233
GO:0005515	Function	Protein binding	IPI	2848815, 11878931, 12887920, 14743216, 17681535, 19838188, 20080539, 20103630, 21784977, 22028622, 23032186, 23104095, 23955153, 24070898, 25241761, 25911380, 26649818, 30561431, 32296183, 32814053, 33961781, 36179048, 36555597
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	24966471
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	23552949, 27830702
GO:0005615	Component	Extracellular space	IDA	3932069, 10443688, 12594207, 18355445, 21323571
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IDA	18355445
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006952	Process	Defense response	IEA
GO:0006954	Process	Inflammatory response	IDA	10748004, 21147091, 22267480
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0006959	Process	Humoral immune response	IEA
GO:0007254	Process	JNK cascade	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	ISS
GO:0007623	Process	Circadian rhythm	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IBA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	10521396, 18202225, 18676776
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	NAS	21319131
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009615	Process	Response to virus	IDA	10490959
GO:0009617	Process	Response to bacterium	IEA
GO:0009651	Process	Response to salt stress	TAS	18355445
GO:0009750	Process	Response to fructose	IEA
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009897	Component	External side of plasma membrane	ISS
GO:0009986	Component	Cell surface	IDA	18355445
GO:0010459	Process	Negative regulation of heart rate	IEA
GO:0010573	Process	Vascular endothelial growth factor production	IDA	12794819
GO:0010628	Process	Positive regulation of gene expression	IDA	25327529, 28159925, 31824476
GO:0010628	Process	Positive regulation of gene expression	IDA	23608026, 31824476
GO:0010628	Process	Positive regulation of gene expression	IDA	11085990, 21559518, 22267480, 22952837, 23817958, 24998411, 26371161, 31124343
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IGI	24299952
GO:0010628	Process	Positive regulation of gene expression	IMP	16203728, 23892569
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	IDA	22499991
GO:0010629	Process	Negative regulation of gene expression	IDA	20164187, 31124343, 31824476
GO:0010629	Process	Negative regulation of gene expression	IDA	15345745, 22267480, 26371161
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IGI	24299952
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IDA	19032770
GO:0010888	Process	Negative regulation of lipid storage	NAS	16464856
GO:0014823	Process	Response to activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	24966471
GO:0019222	Process	Regulation of metabolic process	IEA
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	12813029
GO:0031349	Process	Positive regulation of defense response	IEA
GO:0031622	Process	Positive regulation of fever generation	IEA
GO:0031622	Process	Positive regulation of fever generation	ISS
GO:0031642	Process	Negative regulation of myelination	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	IDA	10443688
GO:0032722	Process	Positive regulation of chemokine production	IDA	10490959
GO:0032724	Process	Positive regulation of fractalkine production	IEA
GO:0032724	Process	Positive regulation of fractalkine production	ISS
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	31124343
GO:0032741	Process	Positive regulation of interleukin-18 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	24299952
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	23608026, 31824476
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	20551324
GO:0032757	Process	Positive regulation of interleukin-8 production	IGI	23608026
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	24790089
GO:0032991	Component	Protein-containing complex	TAS	24966471
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IBA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IDA	7758105, 11907583
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IDA	10443688, 12813029, 15310755, 28159925, 31824476
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEP	12761501
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	10748004
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	ISS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	NAS	23878390
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS	24966471
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS	24966471
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	IDA	10604883, 20551324
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	IEA
GO:0034138	Process	Toll-like receptor 3 signaling pathway	IEA
GO:0034250	Process	Positive regulation of amide metabolic process	IEA
GO:0035900	Process	Response to isolation stress	IEA
GO:0036005	Process	Response to macrophage colony-stimulating factor	IEA
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IDA	8565075
GO:0038177	Function	Death receptor agonist activity	IDA	10748004
GO:0038177	Function	Death receptor agonist activity	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042311	Process	Vasodilation	IEA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042802	Function	Identical protein binding	IDA	14512626
GO:0042802	Function	Identical protein binding	IPI	2922050, 19838188, 23815148
GO:0043025	Component	Neuronal cell body	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	16723520, 17389591, 22173242
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	9343261
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043068	Process	Positive regulation of programmed cell death	IDA	16611992
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IDA	10748004
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	11374864, 15310755, 17922812, 20551324
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	15121867
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	18201371
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	NAS	23878390
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	TAS	18309324
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	TAS	29702085
GO:0043242	Process	Negative regulation of protein-containing complex disassembly	IDA	17389591
GO:0043243	Process	Positive regulation of protein-containing complex disassembly	IDA	12813029, 17389591
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	17389591
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	10748004, 15310755
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	12813029, 18440775
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0043507	Process	Positive regulation of JUN kinase activity	IDA	17389591
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	ISS
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IDA	22499991
GO:0045071	Process	Negative regulation of viral genome replication	IDA	10490959
GO:0045087	Process	Innate immune response	IEA
GO:0045121	Component	Membrane raft	IDA	17010968
GO:0045121	Component	Membrane raft	IEA
GO:0045123	Process	Cellular extravasation	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IDA	8383325
GO:0045471	Process	Response to ethanol	IEA
GO:0045598	Process	Regulation of fat cell differentiation	ISS
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	NAS	16464856
GO:0045662	Process	Negative regulation of myoblast differentiation	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045670	Process	Regulation of osteoclast differentiation	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	IDA	17888176
GO:0045732	Process	Positive regulation of protein catabolic process	IDA	18632959
GO:0045760	Process	Positive regulation of action potential	IEA
GO:0045785	Process	Positive regulation of cell adhesion	IMP	23892569
GO:0045834	Process	Positive regulation of lipid metabolic process	IEA
GO:0045840	Process	Positive regulation of mitotic nuclear division	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	16895791, 17350185
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	10748004, 14512626, 17350185
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045930	Process	Negative regulation of mitotic cell cycle	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15345745, 20551324
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	16803872
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0045994	Process	Positive regulation of translational initiation by iron	IEA
GO:0046325	Process	Negative regulation of D-glucose import	IEA
GO:0046325	Process	Negative regulation of D-glucose import	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IDA	17389591
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048018	Function	Receptor ligand activity	ISS
GO:0048143	Process	Astrocyte activation	NAS	26753638
GO:0048566	Process	Embryonic digestive tract development	IEP	20875417
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	16518841
GO:0050708	Process	Regulation of protein secretion	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	TAS	24966471
GO:0050768	Process	Negative regulation of neurogenesis	TAS	20018408
GO:0050793	Process	Regulation of developmental process	IEA
GO:0050796	Process	Regulation of insulin secretion	IDA	8383325
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050806	Process	Positive regulation of synaptic transmission	IEA
GO:0050806	Process	Positive regulation of synaptic transmission	ISS
GO:0050807	Process	Regulation of synapse organization	IEA
GO:0050807	Process	Regulation of synapse organization	ISS
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050890	Process	Cognition	TAS	22277195
GO:0050900	Process	Leukocyte migration	IEA
GO:0050900	Process	Leukocyte migration	IEA
GO:0050901	Process	Leukocyte tethering or rolling	IDA	10820279
GO:0050966	Process	Detection of mechanical stimulus involved in sensory perception of pain	IEA
GO:0050995	Process	Negative regulation of lipid catabolic process	IDA	19032770
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IDA	18373975
GO:0051046	Process	Regulation of secretion	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	15790681
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	16280327, 16611992, 25193116
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	24790089
GO:0051222	Process	Positive regulation of protein transport	IDA	15310755
GO:0051222	Process	Positive regulation of protein transport	IEA
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0051384	Process	Response to glucocorticoid	IDA	10443688
GO:0051798	Process	Positive regulation of hair follicle development	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0051966	Process	Regulation of synaptic transmission, glutamatergic	TAS	22277195
GO:0055037	Component	Recycling endosome	IEA
GO:0055037	Component	Recycling endosome	ISS
GO:0060252	Process	Positive regulation of glial cell proliferation	IDA	2104886
GO:0060252	Process	Positive regulation of glial cell proliferation	IGI	1752215
GO:0060557	Process	Positive regulation of vitamin D biosynthetic process	IDA	1690216
GO:0060664	Process	Epithelial cell proliferation involved in salivary gland morphogenesis	IEA
GO:0060693	Process	Regulation of branching involved in salivary gland morphogenesis	IEA
GO:0061044	Process	Negative regulation of vascular wound healing	IDA	22499991
GO:0061048	Process	Negative regulation of branching involved in lung morphogenesis	IDA	17350185
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	NAS	18606301
GO:0070886	Process	Positive regulation of calcineurin-NFAT signaling cascade	IDA	16803872
GO:0071219	Process	Cellular response to molecule of bacterial origin	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0071316	Process	Cellular response to nicotine	IDA	18676776
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0071479	Process	Cellular response to ionizing radiation	IDA	22836756
GO:0071677	Process	Positive regulation of mononuclear cell migration	NAS	21319131
GO:0071803	Process	Positive regulation of podosome assembly	IDA	15220135
GO:0072577	Process	Endothelial cell apoptotic process	IEA
GO:0072659	Process	Protein localization to plasma membrane	IDA	25816133
GO:0090324	Process	Negative regulation of oxidative phosphorylation	IEA
GO:0090594	Process	Inflammatory response to wounding	IDA	27830702
GO:0090594	Process	Inflammatory response to wounding	IEA
GO:0097190	Process	Apoptotic signaling pathway	IDA	8565075
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	11577081, 16611992
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0097237	Process	Cellular response to toxic substance	IEA
GO:0097421	Process	Liver regeneration	IEA
GO:0097527	Process	Necroptotic signaling pathway	IDA	11101870, 22265413, 22265414, 22817896
GO:0097527	Process	Necroptotic signaling pathway	IEA
GO:0120190	Process	Negative regulation of bile acid secretion	IEA
GO:0140374	Process	Antiviral innate immune response	IDA	11773383
GO:0140460	Process	Response to Gram-negative bacterium	IEA
GO:0150078	Process	Positive regulation of neuroinflammatory response	TAS	22277195, 26753638
GO:0150129	Process	Positive regulation of interleukin-33 production	IDA	31824476
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IDA	31824476
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IGI	23608026
GO:1900222	Process	Negative regulation of amyloid-beta clearance	IEA
GO:1900222	Process	Negative regulation of amyloid-beta clearance	ISS
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	31124343
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	10383454, 17922812, 20041225
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1901647	Process	Positive regulation of synoviocyte proliferation	IDA	31124343
GO:1902004	Process	Positive regulation of amyloid-beta formation	IEA
GO:1902004	Process	Positive regulation of amyloid-beta formation	ISS
GO:1902065	Process	Response to L-glutamate	IEA
GO:1902565	Process	Positive regulation of neutrophil activation	IEA
GO:1902894	Process	Negative regulation of miRNA transcription	NAS	23878390
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	22499991
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IEA
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	ISS
GO:1903140	Process	Regulation of establishment of endothelial barrier	IDA	25816133
GO:1903347	Process	Negative regulation of bicellular tight junction assembly	IDA	25816133
GO:1903829	Process	Positive regulation of protein localization	IEA
GO:1904646	Process	Cellular response to amyloid-beta	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IEA
GO:1904996	Process	Positive regulation of leukocyte adhesion to vascular endothelial cell	IDA	26371161
GO:1904999	Process	Positive regulation of leukocyte adhesion to arterial endothelial cell	IDA	22267480
GO:1905038	Process	Regulation of membrane lipid metabolic process	IEA
GO:1905242	Process	Response to 3,3',5-triiodo-L-thyronine	IEA
GO:1990268	Process	Response to gold nanoparticle	IEA
GO:2000010	Process	Positive regulation of protein localization to cell surface	IDA	19366699
GO:2000334	Process	Positive regulation of blood microparticle formation	IDA	24998411
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	IDA	20551324
GO:2000347	Process	Positive regulation of hepatocyte proliferation	IEA
GO:2000351	Process	Regulation of endothelial cell apoptotic process	IMP	10843670
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IDA	22836756
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IEA
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IEA
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IGI	31124343
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IBA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IEA
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IDA	10666185, 10748004

Other IDs

• MIM: 191160
• HGNC: 11892
• e!Ensembl: ENSG00000232810

Protein

• UniProt ID: P01375
• Protein name: Tumor necrosis factor (Cachectin) (TNF-alpha) (Tumor necrosis factor ligand superfamily member 2) (TNF-a) [Cleaved into: Tumor necrosis factor, membrane form (N-terminal fragment) (NTF); Intracellular domain 1 (ICD1); Intracellular domain 2 (ICD2); C-doma
• Protein function: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretio
• PDB: 1A8M, 1TNF, 2AZ5, 2E7A, 2TUN, 2ZJC, 2ZPX, 3ALQ, 3IT8, 3L9J, 3WD5, 4G3Y, 4TSV, 4TWT, 4Y6O, 5M2I, 5M2J, 5M2M, 5MU8, 5TSW, 5UUI, 5WUX, 5YOY, 6OOY, 6OOZ, 6OP0, 6RMJ, 6X81, 6X82, 6X83, 6X85, 6X86, 7ASY, 7AT7, 7ATB, 7JRA, 7KP9, 7KPA, 7KPB, 7QLF, 7TA3, 7TA6, 8Z8M
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00229	TNF	102 → 233	TNF(Tumour Necrosis Factor) family	Domain

• Sequence:

  MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
  EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
  DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
  TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

• Sequence length: 233

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
TNF receptor binding, altered	Pathogenic	rs281865419	RCV000013187	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Alzheimer disease, protection against	protective	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, HYPOCHROMIC MICROCYTIC, WITH IRON OVERLOAD 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, HYPOCHROMIC MICROCYTIC, WITH IRON OVERLOAD 2	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, REFRACTORY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, SICKLE CELL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGINA, STABLE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTERIOR UVEITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTHRACOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APLASTIC ANEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, INFECTIOUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, PSORIATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASBESTOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA, OCCUPATIONAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BERYLLIOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BETA THALASSEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN EDEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES, TRAUMATIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIECTASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHOPULMONARY DYSPLASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CACHEXIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CALCINOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, TRANSITIONAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARREST	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL DISC DEGENERATIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS OF PREGNANCY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC PERSISTENT HEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON MIGRAINE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPRESSION OF SPINAL CORD	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE OPHTHALMOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY RESTENOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA, VASCULAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS HERPETIFORMIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOMYOSITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESMOID TUMORS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 1	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC ANGIOPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC PERIPHERAL ANGIOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF PREGNANCY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	drug response	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ESOPHAGITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
etanercept response - Efficacy	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXTRINSIC ALLERGIC ALVEOLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FANCONI ANEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GAUCHER DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA, OPEN-ANGLE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES OPHTHALMOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOCHROMATOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOLYTIC-UREMIC SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATIC ENCEPHALOPATHY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS B	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, ALCOHOLIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOLENTICULAR DEGENERATION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUMAN IMMUNODEFICIENCY VIRUS DEMENTIA, SUSCEPTIBILITY TO	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERBILIRUBINEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERBILIRUBINEMIA, HEREDITARY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERCALCEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERHOMOCYSTEINEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERINSULINISM	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, PULMONARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC POLYMYOSITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 127	—	ClinVar, HPO ClinVar, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFECTIVE ARTHRITIS OF SHOULDER REGION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inherited susceptibility to asthma	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERVERTEBRAL DISC DEGENERATION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRAHEPATIC CHOLESTASIS OF PREGNANCY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS, CUTANEOUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS, VISCERAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, ALCOHOLIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER FAILURE, ACUTE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malaria, cerebral, susceptibility to	drug response; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine with or without aura, susceptibility to, 1	Uncertain significance	ClinVar CTD, ClinVar CTD, ClinVar	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MITOCHONDRIAL MYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHIC OPHTHALMOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NAUSEA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUTROPENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL CAVITY CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOSAL FIBROSIS, INCLUDING OF TONGUE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOUS FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, SPINE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOLYSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS, POSTMENOPAUSAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OTHER SPECIFIED IRON DEFICIENCY ANEMIAS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARACOCCIDIOIDOMYCOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYMYOSITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYMYOSITIS OSSIFICANS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY OPEN ANGLE GLAUCOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriatic arthritis, susceptibility to	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY EDEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
REFRACTORY ANEMIAS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY TRACT DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS, PULMONARY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLERODERMA, LOCALIZED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORINEURAL HEARING LOSS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SICCA SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGRENS SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA, OBSTRUCTIVE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to severe coronavirus disease (COVID-19)	Uncertain significance; drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to severe coronavirus disease (COVID-19) due to high plasma levels of TNF, TNFR, and/or TNFR4	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to severe coronavirus disease (COVID-19) due to high plasma levels of TNF, TNFR, and/or TNFR5	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYNOVITIS, ACNE, PUSTULOSIS, HYPEROSTOSIS, AND OSTEITIS SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic lupus erythematosus, susceptibility to	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC SHOCK SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIGEMINAL NEURALGIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNSPECIFIED INFECTIVE ARTHRITIS INVOLVING ANKLE AND FOOT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNSPECIFIED INFECTIVE ARTHRITIS INVOLVING FOREARM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNSPECIFIED INFECTIVE ARTHRITIS INVOLVING HAND	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNSPECIFIED INFECTIVE ARTHRITIS INVOLVING LOWER LEG	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNSPECIFIED INFECTIVE ARTHRITIS INVOLVING PELVIC REGION AND THIGH	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNSPECIFIED INFECTIVE ARTHRITIS INVOLVING UPPER ARM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URTICARIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEITIS, INTERMEDIATE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR SYSTEM INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AA amyloidosis	AA amyloidosis	BEFREE	28834898, 30400666		★☆☆☆☆ Found in Text Mining only
ABLEPHARON-MACROSTOMIA SYNDROME	Ablepharon macrostomia syndrome	BEFREE	29608374		★☆☆☆☆ Found in Text Mining only
Acanthosis Nigricans	Acanthosis Nigricans	BEFREE	30724385		★☆☆☆☆ Found in Text Mining only
Achondroplasia	Achondroplasia	BEFREE	30822345		★☆☆☆☆ Found in Text Mining only
Acne	Acne	BEFREE	20386917, 20861605, 22835835, 24334867, 24498378, 26373312		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	20386917, 20861605, 22835835, 24334867, 24498378, 26373312		★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	25738867, 29018206		★☆☆☆☆ Found in Text Mining only
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	11472434, 9550427		★☆☆☆☆ Found in Text Mining only
Acro-Osteolysis	Acrosteolysis	BEFREE	31371452		★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	23379751		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	10950380		★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	17192785		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	12747595, 15808757, 16098388, 17892998, 18997459, 22872639, 26618233		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	16024973, 18997459		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	CTD_human_DG	20981132		★☆☆☆☆ Found in Text Mining only
Acute encephalopathy	Encephalopathy	BEFREE	31709864		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	1611082, 24961464, 7530072		★☆☆☆☆ Found in Text Mining only
Acute Inflammatory Demyelinating Polyneuropathy	Inflammatory Demyelinating Polyneuropathy	BEFREE	18717726, 29153605		★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	17712006, 19276869		★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	16595132, 18460982, 20623750		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	17031469, 26782504, 28403570, 8417962		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11549518, 12145682, 12472577, 21875833, 21933669, 25263239, 25545232, 28061377, 28646023, 8417962		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	28218970		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	10089914, 2541714		★☆☆☆☆ Found in Text Mining only
Acute otitis media	Otitis media	BEFREE	24463810, 30551453		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	11331456, 15714129, 16886168, 17529903, 18580445, 18815552, 20396411, 20937337, 21343291, 22487393, 22487520, 24371374, 27917949, 27959400, 28300832, 28836936, 28963856, 29033186, 29117667, 29235373, 29288273, 29393354, 29439880, 29517628, 29525967, 29859191, 29890468, 30031606, 30047498, 30106134, 30144357, 31034353, 31054479, 31518341, 31542607, 31832004, 9637544		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	15256426, 1655285, 18385818, 28343272, 29055789, 31078158, 3126739, 3163919, 8193361, 9593784		★☆☆☆☆ Found in Text Mining only
Addison Disease	Addison`s Disease	BEFREE	12366785, 7860358		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10657935, 10749746, 10960444, 15645141, 16313841, 16467113, 17058067, 18078328, 1906154, 28694750, 29028942, 7592709, 7635448, 8001927, 8227158		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12032830, 15870936, 18316608		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	1733439, 19028472		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	12761580, 17142966, 25102301, 28087739		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	16580499, 21396625, 22243485, 27821804		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	16166279, 25194678, 2662193, 31642560		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	11053014, 18089811, 22269403, 28470556, 29207489, 30606988, 30942468, 31086598, 31540489, 7657294, 9371773, 9685865		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	19152246		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	15041704		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	28394749		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	1733439, 19028472		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	1733439, 19028472		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	1733439, 19028472		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	29577454		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	29286110		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	28348498, 29593647		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	19383900, 24379584, 24501326		★☆☆☆☆ Found in Text Mining only
Adrenal Cortex Diseases	Adrenal Cortex Diseases	BEFREE	30366345		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	17102096, 31635070, 31738032		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	26768118		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	10726843, 16148556, 16751174, 17728075, 19086955, 19212208, 19755636, 24400890, 26656007, 28722826, 28849499, 31159489, 7593551, 9660302		★☆☆☆☆ Found in Text Mining only
Adrenomyeloneuropathy	Adrenomyeloneuropathy	BEFREE	28722826		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11549518, 21875833, 21933669, 25545232, 28061377		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	16293872, 16389181, 17606447, 26722496, 28544905, 31335688, 31731887		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	27121136, 28115787, 31781194		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	11418184, 12014672, 17261581, 17496310, 19131627, 24033107, 30065253, 30857150, 30952099, 31616638, 8391931		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	17550129, 21327638		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	12175864		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11163081, 11325850, 20706274		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	10399751, 10805105, 12147628, 12230503, 12485445, 15338498, 15577608, 16895750, 16970978, 17586554, 19953283, 22913362, 25101759, 30367666, 30645753		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	CTD_human_DG	19035492		★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	LHGDN	17090647		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	15249366, 21060270, 21411747, 23959158, 24439028, 29548329, 30662836		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	10519368, 11453117, 11759867, 12691703, 12919285, 15627647, 23996710, 24905365, 25647273, 26750615, 31028890		★☆☆☆☆ Found in Text Mining only
Agranulocytosis	Agranulocytosis	BEFREE	9166860		★☆☆☆☆ Found in Text Mining only
Aicardi Goutieres syndrome	Aicardi goutieres syndrome	Pubtator	23408864	Associate	★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	22566509, 28378198		★☆☆☆☆ Found in Text Mining only
AL-RAQAD SYNDROME	AL-Raqad Syndrome	BEFREE	29228130		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	15120189, 20924287, 21313996, 22687252, 23472126, 24654309, 27216347, 29560095, 29849816, 30459816, 30469322, 30980570		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	20210814, 28758900		★☆☆☆☆ Found in Text Mining only
Alloimmunisation	Alloimmunisation	BEFREE	28769101, 29845661		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	22515582, 22897480, 30294905, 31673980, 7557966		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	22515582, 22897480, 30294905, 7557966		★☆☆☆☆ Found in Text Mining only
Alopecia universalis	Alopecia	BEFREE	30666488		★☆☆☆☆ Found in Text Mining only
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	BEFREE	17937578		★☆☆☆☆ Found in Text Mining only
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	LHGDN	18620570		★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	32305453, 34629327	Associate	★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	BEFREE	10934117		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	11394717, 16324872, 17266442, 25216247, 26368622		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18186919, 18715507, 18769539, 19531281, 20110607, 21509504, 21845541, 21891866, 21942811, 22509108, 22832605, 24359497, 28943632, 31175839, 31353852, 31618972, 31870643, 32171317, 32426945, 32980851, 34625123, 35139885, 36142143, 40121165	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19767111, 21298033, 29361890, 32114455, 35689551, 37679689, 9013604	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	17192785		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	26014970		★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	20643858, 26502815		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	11121190, 16908746, 25159669, 26014970, 26553058		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	17192785		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	17192785		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	17192785		★☆☆☆☆ Found in Text Mining only
Amaurosis congenita of Leber, type 1	Leber congenital amaurosis	BEFREE	31702035		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	27868311		★☆☆☆☆ Found in Text Mining only
Amenorrhea	Amenorrhea	Pubtator	20065129	Associate	★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	28752224		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	12762136, 14613268, 22593232, 23294492, 24345324, 26095531, 27776263, 28099324, 28336494, 28669260, 28826177, 28834898, 29234273, 29668503, 29714500		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	14613268, 22593232	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	18384449, 24283919		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	10552245, 11847479, 15379894, 18083240, 20849956, 25311268, 26002422, 27288458, 27814735, 28831083, 28856541, 29218049, 29294332, 29380416, 30134252, 31058354		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	18083240		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	26198021, 26212797, 27814735, 35853630	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	29246232, 32123048	Stimulate	★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	CTD_human_DG	11796754		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	21062492	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis 2 Juvenile	Amyotrophic lateral sclerosis	Pubtator	18422522	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	CTD_human_DG	11796754		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	CTD_human_DG	11796754		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	21062492		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	26387540, 28740254, 29548329, 30953519		★☆☆☆☆ Found in Text Mining only
Anaplastic Large Cell Lymphoma, ALK-Positive	Anaplastic Lymphoma	BEFREE	20393185		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	17327374, 26637867, 28730964, 29481652, 30174788		★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	23904164, 25860946	Stimulate	★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	30579843		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	25815338		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	10229321, 12232842, 12518848, 14613268, 16619186, 16926419, 18716131, 20572589, 21983349, 22426798, 23451225, 24286116, 25270909, 25656761, 26572590, 27392760, 28515118, 28604144, 29408596, 29451472, 30546074, 30705878, 31814801, 9841857, 9844760		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	LHGDN	12091338, 17397790, 18547996		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	Pubtator	14613268, 18547996, 2066357, 31814801	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	CTD_human_DG	16566752		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	Pubtator	1824252, 20460119, 21859849, 24286116, 26572590, 30546074	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia Aplastic	Aplastic anemia	Pubtator	11754394, 3134066	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	11843845, 12100146, 15345281, 1586705, 17373677, 18477039, 19109204, 21506940, 34220798, 36334505	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	23451225	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Autoimmune	Autoimmune hemolytic anemia	Pubtator	38022547	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia Iron Deficiency	Iron deficiency anemia	Pubtator	18716131	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	10641497, 11001897, 11553004, 14965870, 21173096, 21802960, 24290434, 24391023, 25596272, 26686970, 34956203, 7691241	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	12152923, 23192499, 23922670	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	23720018	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia, Diamond-Blackfan	Anemia	BEFREE	25270909		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	11001897, 17600229, 21160173, 21173096, 27758820, 28699284, 30893386, 31672902		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia, Sickle Cell	Anemia	CTD_human_DG	14965870		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia, Sickle Cell	Anemia	LHGDN	17600229		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aneuploidy	Aneuploidy	Pubtator	27592797	Associate	★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	32721809, 35909487	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	12775581, 35942210	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	28407320	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	12775581	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	20467748	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	12747595, 15808757, 16098388, 18842422, 28414590		★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	LHGDN	12747595, 18996291		★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	24611904	Inhibit	★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	26654922, 36142237	Stimulate	★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	34778454	Associate	★☆☆☆☆ Found in Text Mining only
Angioedemas, Hereditary	Angioedema	BEFREE	30885236		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	28953529		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	30905119		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	Pubtator	34502316	Associate	★☆☆☆☆ Found in Text Mining only
Anhydrotic Ectodermal Dysplasias	Hypohidrotic ectodermal dysplasia	BEFREE	16379012		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	10027781, 10332976, 10717805, 11114280, 11196671, 11409121, 15479754, 16720636, 1672816, 16947419, 17459079, 17472990, 18678578, 18719920, 19059800, 19318316, 19720680, 19758203, 19772798, 19822042, 20349238, 20535510, 21078719, 21885496, 22661255, 23057546, 23831259, 23861136, 23969080, 24065540, 24618052, 24643503, 25005770, 25028373, 25494292, 25567370, 25962691, 26082376, 26125893, 26321488, 26531724, 26731089, 27369645, 27479149, 27643888, 27696754, 27729625, 27749222, 27816498, 27855973, 27909080, 27920336, 28035438, 28108800, 28248857, 28261616, 28275260, 28298566, 28361330, 28362980, 28391592, 28421263, 28530020, 28534699, 28548546, 28551170, 28597133, 28601821, 28610765, 28640088, 28640818, 28711878, 28717941, 28835680, 28837372, 28880727, 28939631, 29028148, 29044146, 29148281, 29201209, 29210147, 29212085, 29230494, 29283375, 29299476, 29335342, 29449501, 29449504, 29546695, 29575262, 29611287, 29611349, 29623390, 29689112, 29744553, 29792084, 29849019, 29880011, 29979389, 29984487, 30008173, 30075559, 30076542, 30100567, 30157966, 30208882, 30220240, 30225952, 30251059, 30322951, 30385705, 30415451, 30422733, 30430682, 30473179, 30476367, 30557124, 30576610, 30621746, 30657103, 30690799, 30732563, 30746581, 30793255, 30886835, 31094932, 31140397, 31172410, 31195969, 31335881, 31398658, 31471416, 31474599, 31556231, 31584431, 31647182, 31674159, 31736377, 31830775, 31851643, 8033419, 9568723, 9583811, 9704649		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	LHGDN	17472990		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	14982858, 28578351, 39778225	Stimulate	★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	19623212, 37894839	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21109943, 24567526, 25213764, 26479921, 28173980, 28578701, 30426611, 30764482, 30927045		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	Pubtator	17674351	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia	Anorexia	BEFREE	20012999, 20353817, 26472017, 29655943, 29775631, 30690107, 30919010, 31281956, 8217192		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia	Anorexia	Pubtator	20012999	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia	Anorexia	CTD_human_DG	25392278		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia Nervosa	Anorexia	BEFREE	11702059, 14575726, 29906710		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	LHGDN	11774563, 18773665		★☆☆☆☆ Found in Text Mining only
Anterior uveitis	Uveitis	LHGDN	15851552		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anterior uveitis	Uveitis	BEFREE	16581430, 30719968, 31674159		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anthracosis	Anthracosis	BEFREE	12162435, 15940715, 18702109, 20005085, 20514989, 30257124, 30467847, 30907204, 7599837, 9750937		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anthracosis	Anthracosis	CTD_human_DG	20005085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anthracosis	Anterior uveitis	Pubtator	8973625	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	11246532, 22964479, 29410969, 29730433		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	19423430	Associate	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	37914735	Stimulate	★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	28810156		★☆☆☆☆ Found in Text Mining only
Antisynthetase syndrome	Antithrombin deficiency	Pubtator	34905301	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	25249351	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	25813148, 28300056, 28336920, 28374419, 28452210, 28950996, 28969445, 30459574, 30469423, 30870771		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	20194079		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety Disorder	BEFREE	25813148, 28300056, 28336920, 28374419, 28452210, 28950996, 28969445, 29244900, 30459574, 30469423, 30870771		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	20194079		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	17478756	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	31583036		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	15288631, 17321344, 22694979, 24853957, 30686933, 32138469	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	31885770, 35602104	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	37445606	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	20615646, 22365948, 24853957, 26783750, 28446225, 28478022, 29217508, 29393364, 29956759, 31506475, 31658493		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Thoracic	Aortic Aneurysm	BEFREE	30088482		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	18439917	Associate	★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	21917259, 28024939		★☆☆☆☆ Found in Text Mining only
Aortic valve disorder	Aortic Valve Disease	BEFREE	30700131		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	29194865, 30007011		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	15958363, 30266917		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	29653899	Associate	★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	Pubtator	35259429	Inhibit	★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	12424537, 15548264, 20953611, 21561401, 22800824, 25248876, 25895473, 26214243, 30361263		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aplastic Anemia	Aplastic anemia	LHGDN	12424537, 15182332		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Apnea	Apnea	Pubtator	26982450	Stimulate	★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	15273551		★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	29653899		★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	Pubtator	29361849	Associate	★☆☆☆☆ Found in Text Mining only
Arachnoid Cysts	Arachnoid cysts	Pubtator	31743616	Associate	★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	14965870	Stimulate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11031205, 11257271, 11728452, 12753658, 12818408, 14593215, 15292354, 15531779, 15808757, 16224057, 16487030, 17046548, 17276892, 17346438, 17347550, 17460178, 17485328, 17892998, 18061141, 18078928, 18285570, 18349535, 18602074, 19473660, 19754391, 19803813, 19858416, 19926874, 20421368, 20421522, 20644648, 21040915, 21262584, 21380730, 21420089, 22194622, 22965192, 23095497, 23249640, 23417868, 23673478, 24012161, 24098801, 24225134, 24439028, 24448174, 24594319, 24733347, 24813629, 24905663, 25032953, 25077563, 25216946, 25265644, 25323324, 25702058, 26001207, 26218278, 26283334, 26459935, 26900933, 27102967, 27342458, 27497158, 27874938, 28045034, 28249772, 28258057, 28348463, 28352306, 28420489, 28552580, 28576445, 28632765, 28643478, 28722106, 28781615, 28798145, 28901421, 28931782, 28946319, 29029426, 29062018, 29088580, 29175266, 29250154, 29257205, 29401724, 29611586, 29793330, 29979389, 30041636, 30051926, 30056359, 30066228, 30165101, 30176568, 30205791, 30213220, 30235005, 30292879, 30354204, 30413028, 30426302, 30702995, 30844558, 30881312, 30943772, 31002155, 31017267, 31059840, 31104495, 31171476, 31208307, 31231231, 31237148, 31294625, 31475703, 31486930, 31629987, 31637885, 31638185, 31664319, 31713877, 31727560, 31760375, 31817413, 9187938, 9863542		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	10395698, 10640777, 10953913, 11096446, 11465953, 11830425, 11840694, 11920416, 11991745, 12198697, 12209527, 12234707, 12438440, 12483743, 12528081, 12809834, 14636987, 14730626, 14871456, 14962963, 14975191, 15104599, 15642137, 15743471, 15781582, 15803022, 16142749, 16207331, 16410254, 16670074, 16947419, 17195210, 1721867, 17235303, 17514770, 17516222, 17599732, 17619821, 17630192, 17641054, 17853003, 17934089, 18370848, 18663125, 18678578, 18797411, 18824582, 1914237, 19587341, 19660107, 19897967, 20008919, 20032102, 20226838, 2026869, 20506400, 20664576, 21305533, 21346237, 21360496, 21393509, 21452922, 21549221, 21633911, 2174906, 21787418, 22083543, 22101928, 22210441, 22249931, 22573549, 22593232, 22613074, 22884682, 23294975, 23354839, 23784913, 24040061, 24078675, 24289726, 24368568, 24420856, 24641111, 24657513, 24767864, 24896343, 25155522, 25229347, 25280866, 25470448, 25661739, 25867281, 26324948, 26370562, 27269414, 27603689, 27619991, 27747869, 28006753, 28089968, 28094754, 28118521, 28188029, 28213049, 28270399, 28288790, 28289800, 28409894, 28438834, 28442538, 28457885, 28711030, 28771778, 28824645, 28901397, 29080328, 29081378, 29145524, 29149648, 29150737, 29184553, 29193895, 29210147, 29218573, 29246953, 29258611, 29291937, 29303021, 29316707, 29375132, 29408684, 29434332, 29452240, 29475857, 29656315, 29681976, 29743640, 29753098, 29859232, 29868252, 29975009, 29975703, 30002096, 30017519, 30079020, 30086795, 30185135, 30261981, 30279685, 30282670, 30336303, 30343885, 30407878, 30488533, 30510188, 30691120, 30715482, 30745461, 30747393, 30770760, 30783427, 30804932, 30828078, 30831463, 30969024, 31060892, 31155798, 31162832, 31199978, 31267533, 31302596, 31351180, 31366877, 31545276, 31577714, 31659014, 31784598, 31818460, 31822434, 31850514, 7589090, 8734789, 8750012, 8886998, 9568723, 9933439		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	11212159, 11830425, 12209522, 12483736, 12823857, 16142749, 16846531, 17503796, 18346273, 1914237, 19587341, 21161742, 21305533, 21787418, 22076945, 22593232, 22687048, 27627069, 30770760, 31282065, 33060686, 33512089, 34735544, 35095831, 35126351, 35259429, 35792833, 36262248	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	12438440, 16410254, 17416344, 18392953		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	17393419, 31260948	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Gouty arthritis	Pubtator	27169898	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Gouty arthritis	Pubtator	36994890, 39259129	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	18945879, 7858264	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	39712015, 8544415	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	10616003, 12483736, 15728381, 16788246, 17324969, 20191493, 24470328, 24967817, 26934060, 27849614, 29306244, 31941549, 31958219, 36793127, 38460895	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	10857783, 11830425, 12368213, 12746914, 15482477, 16409917, 16831294, 17530646, 17828345, 19895991, 20102624, 21954344, 22127698, 22402441, 23527726, 23677169, 24594669, 2476168, 25219647, 25333715, 25512250, 27088930, 27338143, 27496874, 27543964, 27627098, 28005985, 29389950, 29849482, 29850558, 32415989, 33153894, 34305455, 34691360, 35055107, 36159832, 36912319, 40429765, 7693825, 8064230, 9049304, 9326391	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	11851889, 12639988, 16728461, 16741508, 1702929, 19661441, 23144698, 24676037, 37893484	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	37367825	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Reactive	Reactive arthritis	Pubtator	10524675	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Reactive	Reactive arthritis	Pubtator	16107515	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10088765, 10204847, 10446857, 10616000, 10616020, 10643698, 10759759, 10765919, 10817565, 10857796, 11056676, 11181651, 11212177, 11219391, 11229456, 11229458, 11229461, 11406520, 11406522, 11454644, 11465706, 11465707, 11822409, 12062421, 12115244, 12396377, 12480916, 12525377, 12528108, 12528110, 12571842, 12651614, 12687542, 12695561, 12847678, 12847679, 12847684, 12878725, 12965196, 14871291, 14962963, 15188374, 15248209, 15248214, 15256380, 15457442, 15457448, 15547078, 15593196, 15593228, 15692975, 15728381, 15743471, 15769913, 15880344, 15977405, 16052586, 16079149, 16200579, 16207322, 16385498, 16507118, 16519794, 16572445, 16802346, 16936264, 16947381, 16947382, 1698773, 17101049, 17185327, 17265480, 17328054, 17393415, 17408492, 17456524, 17599732, 17665439, 17848581, 17907168, 17963503, 17968879, 18025155, 18050183, 18055470, 18186919, 18240208, 18369459, 18438841, 18438844, 18454843, 18512781, 18615156, 18765427, 19242068, 19248119, 19299722, 19714631, 19790066, 19847310, 19895991, 20096109, 20309874, 20491788, 20593016, 20604932, 20609223, 20615213, 20633267, 20954258, 20959025, 21129157, 21208248, 21225692, 21337318, 21373785, 21385363, 21423713, 21511722, 21611196, 21647866, 21708014, 21742641, 21834067, 21862580, 21905018, 21926327, 21952740, 21953341, 22004920, 22040886, 22190977, 22235253, 22246057, 22264405, 22354754, 22417670, 22534470, 22594821, 22614743, 22661088, 22685579, 22730373, 22736089, 22838733, 22923002, 23000593, 23091555, 23233654, 23240033, 23280137, 23335080, 23494522, 23632129, 23684916, 23710436, 23826419, 23856853, 24040234, 24286242, 24349530, 24434549, 24552146, 24558177, 24690143, 24762050, 24788826, 24833787, 24967817, 24989895, 25333715, 25371395, 25436214, 25452308, 25484525, 25504080, 25652333, 25729037, 25738173, 25848939, 25860297, 25891413, 26036272, 26062018, 26095630, 26134265, 26149185, 26215036, 26296700, 26407995, 26408612, 26714738, 26776603, 26792343, 26819496, 27209093, 27255643, 27270893, 27413250, 27434862, 27534557, 27549343, 27692391, 27736946, 27824863, 27847407, 28114971, 28239238, 28316377, 28426141, 28619088, 28677621, 28708839, 28775366, 28800780, 28837666, 29191214, 29191820, 29217191, 29328500, 29352846, 29561430, 29744553, 29768427, 29784872, 29933531, 30071898, 30232372, 30242542, 30358109, 30369929, 30498756, 30526655, 30696478, 30713533, 30718650, 30796319, 30890897, 30945669, 31010320, 31097419, 31105703, 31210318, 31234900, 31239367, 31338093, 31484730, 31647025, 31687411, 31722123, 31812161, 31906244, 32123296, 32264938, 32265907, 32383062, 32414400, 32583991, 3264773, 32840241, 32843099, 32896251, 32908449, 32909363, 32910145, 33067400, 33148884, 33203678, 33325525, 33329580, 33374446, 33426091, 33482886, 33485455, 33512089, 33622154, 33691749, 33692019, 33833756, 33846499, 33855071, 33977746, 34175943, 34301319, 34385542, 34414237, 34458379, 34588517, 34664888, 34766472, 34911836, 35126351, 35216458, 35352610, 35377444, 35450396, 35506438, 35759235, 35776431, 35788746, 36012570, 36262248, 36301038, 36532040, 36835522, 36912319, 37108505, 37174663, 37445932, 37644537, 37653836, 37830590, 37934808, 37975481, 37996918, 38168669, 38372731, 38459704, 38636399, 39202369, 39980031, 40190499, 7657832, 7994916, 8040330, 8163935, 8675695, 9014820, 9030200, 9239408, 9305751, 9525978, 9653166, 9932110	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10749583, 11219394, 11966774, 14613268, 15022319, 15972956, 16684368, 16901957, 16951485, 17032244, 1914237, 22736176, 23024462, 23517397, 24351865, 25164131, 25598326, 25879761, 26339358, 26749303, 28045034, 28245522, 28866647, 29129636, 29348703, 30945669, 32131874, 32584515, 32878533, 33082707, 33087158, 33410302, 34281218, 34290266, 34301999, 35955467, 37202736	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11083259, 12296865, 15140777, 17599736, 18584044, 20444755, 26406605, 29536646, 30106091, 33098857, 38187379	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	11830425, 12011375, 12022360, 12234707, 12746914, 14657629, 15146434, 15251081, 16142749, 16284098, 16720636, 17244977, 17530646, 20015187, 20886249, 21549221, 21954344, 21996051, 22127698, 22467926, 22480748, 23116200, 23717605, 24135300, 24594669, 24676037, 25219647, 25339124, 25980667, 26108918, 26470763, 26476224, 26780035, 27457512, 27586804, 27696735, 27749227, 27937056, 28010883, 28108800, 28119289, 28245522, 28275260, 28386999, 28450199, 28490202, 28589323, 28597133, 28604144, 28771778, 28772007, 28823868, 28834259, 28837372, 28838285, 28965181, 28966209, 29035933, 29045207, 29195855, 29267456, 29283375, 29389950, 29411182, 29518978, 29538028, 29557701, 29564871, 29579081, 29623390, 29846825, 29855175, 29875003, 29948352, 29952704, 30037432, 30061880, 30172115, 30206447, 30247726, 30415451, 30430682, 30557124, 30584776, 30628100, 30647182, 30742092, 30808625, 30824641, 30858782, 30891646, 30893386, 30916734, 31112005, 31277747, 31311386, 31321485, 31335881, 31371650, 31371659, 31485004, 31521192, 31652079, 31672774, 31719235, 31729183, 31801610, 9326391, 9548075, 9712099		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis, Psoriatic	Psoriatic Arthritis	LHGDN	12011375, 15654990		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis, Psoriatic	Psoriatic Arthritis	CTD_human_DG	12746914, 19732956		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis, Suppurative	Suppurative arthritis	CTD_human_DG	19203382		★☆☆☆☆ Found in Text Mining only
Arthrogryposis and ectodermal dysplasia	Arthrogryposis with ectodermal dysplasia	Pubtator	38245732	Associate	★☆☆☆☆ Found in Text Mining only
ARTHROGRYPOSIS, DISTAL, TYPE 2B	Sheldon-Hall syndrome	BEFREE	28948356		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	10782809, 15642137, 20136591, 25512250, 26045761, 26521731, 28871338, 30008717, 31261789		★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	CTD_human_DG	20486865		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthenozoospermia	Asthenozoospermia	Pubtator	18287793, 30222022	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	23465534, 30222022		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10071528, 10077640, 10390412, 10456966, 10469028, 10923589, 11106199, 11153913, 11258696, 11264706, 11896460, 12091169, 12169181, 12530118, 12590981, 1374772, 14674935, 14681301, 14764429, 14987295, 15120189, 15137526, 15969671, 15976383, 16204594, 16456144, 16517578, 16522446, 16728705, 16865291, 1696867, 16988194, 17190999, 17196641, 17450233, 17536219, 17686102, 18053016, 18088017, 18341619, 18534084, 18691151, 18763028, 18811622, 18947013, 19004142, 19196817, 19236316, 19480843, 20049212, 20736038, 20856828, 20868478, 21082225, 21205293, 21271873, 21297077, 21307151, 21637953, 22376040, 22502799, 22694930, 22947346, 23343370, 23376082, 23377347, 23428345, 23466425, 23557460, 23573270, 23600543, 23823820, 23855553, 24039878, 24465030, 24500711, 24588865, 24654313, 24936650, 25668892, 25721048, 25722071, 25759826, 25923882, 25931357, 26546680, 26546897, 26546898, 26722602, 27001655, 27089844, 27501772, 27501780, 27528425, 27808402, 27992959, 28093718, 28340863, 28399677, 28429138, 28609485, 28758900, 28822267, 28831046, 28836545, 28982738, 29875003, 29908291, 30059697, 30131242, 30176222, 30193887, 30290688, 30400588, 30537802, 30590802, 30675924, 30738043, 30763933, 30828084, 30978295, 31109984, 31161819, 31258683, 31298396, 31299143, 31676759, 31780948, 31813561, 9097957, 9645594		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	10227402, 10456966, 11704539, 15976383, 16166100, 16204594, 16456144, 16481637, 16788246, 17322278, 17450233, 17631613, 18088017, 18635892, 18947013, 19196817, 20006706, 20049212, 21103062, 21179211, 21917909, 22773729, 22947346, 23343370, 23527710, 23573270, 24039878, 24465030, 24654313, 25721048, 25725987, 25759826, 26546680, 26722602, 27001655, 28493984, 29520864, 30738043, 32842623, 33146568, 35000533, 35069542, 35578269, 35620861, 36105239, 36572355, 37958799, 39380119, 40696647, 7691450	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	11896460, 12091169, 12530117, 12530118, 16728705, 16865291, 16988194, 17014432, 17450233, 17686102, 18088017, 18341619, 18385169, 18534084		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	12356572, 14681301, 16456144, 17450233, 20049212		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	17947510, 18774390, 19465513, 24500711, 24641294, 25624129, 26546898, 34112152, 35572500, 7512004, 7545095	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	18780949, 19842845, 31676759, 34331994	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Occupational	Asthma	BEFREE	23706710, 9723671		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Occupational	Asthma	CTD_human_DG	25721048		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	10349852, 10501211, 10769704, 11211053, 11381677, 11784850, 11949822, 12868067, 1732280, 1868490, 19850087, 21732076, 24479486, 24625976, 8384635, 8627304, 8903854, 9110068		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	10501211, 12767055, 17121800, 19850087, 22818222, 40565357	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	9371571	Stimulate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	25748550, 40607400	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	30279689, 30581847		★☆☆☆☆ Found in Text Mining only
Ataxia with vitamin E deficiency	Friedreich Ataxia	BEFREE	29233142		★☆☆☆☆ Found in Text Mining only
Atelosteogenesis type 2	Atelosteogenesis	Pubtator	18094730	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10551885, 11353829, 11728452, 12869027, 12876306, 15358608, 15914954, 16973825, 17066518, 17347550, 17994109, 18270431, 19189937, 19645041, 19652376, 21455632, 23484124, 24012161, 24205197, 24381514, 24439028, 24587984, 25238321, 25720609, 26071079, 26283334, 26459935, 26861272, 26899994, 28576445, 28931782, 29062018, 31237194, 31901246, 32245324, 32805626, 34779349, 35137664, 35860283, 35916819, 3598461, 37834170, 39201392, 40145153, 40617584, 7919375	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	11031205, 11257271, 11728452, 12753658, 12818408, 14593215, 15292354, 15531779, 15808757, 16224057, 16487030, 17046548, 17276892, 17346438, 17347550, 17460178, 17485328, 17892998, 18061141, 18078928, 18285570, 18349535, 18602074, 19473660, 19754391, 19803813, 19858416, 19926874, 20421368, 20421522, 20644648, 21040915, 21262584, 21380730, 21420089, 22194622, 22965192, 23095497, 23249640, 23417868, 23673478, 24012161, 24098801, 24225134, 24439028, 24448174, 24594319, 24733347, 24813629, 24905663, 25032953, 25077563, 25216946, 25265644, 25323324, 25702058, 26001207, 26218278, 26283334, 26459935, 26900933, 27102967, 27342458, 27497158, 27874938, 28045034, 28249772, 28258057, 28348463, 28352306, 28420489, 28552580, 28576445, 28632765, 28643478, 28722106, 28781615, 28798145, 28901421, 28931782, 28946319, 29029426, 29062018, 29088580, 29175266, 29250154, 29257205, 29401724, 29611586, 29793330, 29979389, 30041636, 30051926, 30056359, 30066228, 30165101, 30176568, 30205791, 30213220, 30235005, 30292879, 30354204, 30413028, 30426302, 30545708, 30702995, 30844558, 30881312, 30943772, 31002155, 31017267, 31059840, 31104495, 31171476, 31208307, 31231231, 31237148, 31294625, 31475703, 31486930, 31629987, 31637885, 31638185, 31664319, 31713877, 31727560, 31760375, 31817413, 9187938, 9863542		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	12753658, 14630568, 16224057, 17531241		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	20720404		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	24098801, 27764724, 28045034, 28672844, 30462552, 32440094	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	19018026, 22001292, 22088456, 28379329, 29269354, 29595637, 30360993, 30796945, 30916734, 31221002, 31553329, 31704291		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	19169931, 19569080, 22001292, 29595637	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	28871102, 36078037	Associate	★☆☆☆☆ Found in Text Mining only
ATRIAL SEPTAL DEFECT 1	Atrial Septal Defect	BEFREE	11752512		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	11752512		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	19351384	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	37013268, 38004107	Stimulate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	35197458	Inhibit	★☆☆☆☆ Found in Text Mining only
Atypical Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	26673143	Associate	★☆☆☆☆ Found in Text Mining only
Atypical Hemolytic Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	29555686		★☆☆☆☆ Found in Text Mining only
Aural Atresia Congenital	Congenital aural atresia	Pubtator	37688511	Associate	★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	23313575		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	21935439, 22226452, 22306264, 29178897, 31591201, 31616420, 32677958, 37108638, 37545517, 38288647	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	26418275, 39741321	Stimulate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	11752512, 21084121, 22175527, 22306264, 28007470, 28025035, 28099628, 29137272, 29178897, 29522267, 30456538, 30524316, 30971960, 31591201		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	23437274, 27019035, 28007470, 28070266, 28099628, 31835709		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	23437274	Stimulate	★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	10464141, 10498633, 11495038, 15763345, 24629822, 29845365, 30581618, 30735937, 30947662, 31570816, 31685647		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10600011, 10940893, 10972086, 11502070, 11571703, 11823861, 11968047, 11983212, 12021142, 12220545, 12366785, 12370363, 12403370, 12439617, 12528081, 12568117, 12763679, 12823767, 12864989, 12941546, 14617046, 14631203, 1503608, 15057268, 15319381, 15474092, 15557123, 16272360, 1627786, 16446172, 16483921, 16574768, 16691430, 16782553, 16863659, 17054552, 17079017, 17346422, 17426140, 17483581, 17510437, 17530706, 17640886, 17641054, 17928893, 18080912, 18295728, 18348311, 18639610, 18820032, 19026118, 19499314, 19565910, 20003451, 20096109, 20491592, 20811902, 20813201, 21288738, 21357402, 21380730, 21471444, 21689905, 21743332, 21802166, 22105853, 22324470, 22515582, 22723547, 22801493, 22913362, 23139385, 23284977, 23337970, 23703343, 23884763, 24051380, 24056367, 24509339, 24998784, 25200589, 25378394, 25500258, 25640675, 25684197, 2573169, 26071216, 26699338, 26706021, 26819253, 26821284, 26906225, 26936954, 27007229, 27079270, 27175635, 27192566, 27332039, 27531077, 27623349, 27731365, 27747869, 27929668, 28000874, 28122293, 28124979, 28158970, 28278297, 28422491, 28426652, 28578473, 28587079, 28631177, 28651126, 28683581, 28687059, 28820959, 28982122, 29023827, 29565566, 29572471, 29593717, 29702293, 29743640, 29748156, 29792084, 29880309, 29885993, 29936438, 30090063, 30108591, 30206422, 30314507, 30337056, 30358982, 30414969, 30452927, 30463908, 30468855, 30555460, 30631042, 30635946, 30645753, 30745461, 30880912, 30916218, 30921706, 30952099, 30967865, 31034880, 31049403, 31094932, 31130368, 31173698, 31181267, 3121358, 31267570, 31345729, 31376325, 31425625, 31443998, 31699819, 31700711, 7515187, 7538333, 7583349, 7589090, 7682590, 7731752, 7751164, 7883593, 8330041, 8421109, 8734789, 8770867, 8887999, 8917114, 8964905, 9293772, 9568723, 9583800, 9645594, 9817446, 9932110		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	11423177, 12220546, 12880679		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	11968047, 12568117, 12823857, 15474092, 15728381, 16199883, 1670638, 17234183, 17928893, 18369459, 20096109, 20942939, 21076398, 23703343, 23884763, 25640675, 25784146, 26821284, 28820959, 28982122, 29885993, 30108591, 30463908, 31699819, 32231389, 32328064, 32805626, 33067400, 33370782, 33776573, 33924332, 34301319, 34650558, 35244686, 35963536, 36012570, 37108786, 38460895, 9792335, 9932110	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	20596538	Stimulate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	33287909	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	BEFREE	22280320		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	BEFREE	21447005		★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	29434699, 30399324		★☆☆☆☆ Found in Text Mining only
Autoinflammatory disorder	Autoinflammatory Disease	BEFREE	15312137, 16420550, 20473499, 20497634, 21480187, 22884554, 23322460, 24657513, 24668260, 28942479, 29467762, 30457980		★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	18384449, 24283919		★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	21777350		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	15545599, 16393214, 20418899, 20952689, 22649007, 23640160, 24832086, 24857911, 24938766, 25310109, 26448050, 27524795, 27771871, 27840921, 28214146, 28475120, 28499237, 28550734, 28627691, 28665182, 28728856, 28837114, 29257202, 29257247, 29296923, 29399101, 29408764, 29484409, 29545882, 29569854, 29695684, 30029514, 30031796, 30467847, 30733666, 30735101, 30772517, 31113339, 31184101, 31210286, 31301310, 31660030, 31713921, 31722249, 31778769, 9443579		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	16393214		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	12411322, 16426238, 2114936, 7994039, 8726409, 9858820		★☆☆☆☆ Found in Text Mining only
Balkan Nephropathy	Balkan Nephropathy	BEFREE	10066063, 11427627, 12198621, 16987073, 17907045		★☆☆☆☆ Found in Text Mining only
Baller-Gerold syndrome	Baller-Gerold Syndrome	BEFREE	21329777		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	12203119, 16255056, 19758198, 22243485, 23380467, 29086334, 29449669		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	1351861	Associate	★☆☆☆☆ Found in Text Mining only
Basal Cell Cancer	Basal Cell Neoplasm	BEFREE	31823140		★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	LHGDN	14714556		★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	31415412	Associate	★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	37219933	Inhibit	★☆☆☆☆ Found in Text Mining only
Becker Muscular Dystrophy	Becker Muscular Dystrophy	BEFREE	26321630		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	10519363, 12632436, 12770792, 1356945, 14727453, 15654837, 15692984, 15875188, 16882174, 16891799, 17349875, 17657677, 18355201, 18998137, 19026125, 19774383, 20191386, 20470944, 21059493, 21059670, 21334264, 21816027, 22711844, 24049437, 24267724, 24305945, 26222305, 27662569, 27679471, 27791958, 27872495, 27914129, 27939191, 28289419, 28392644, 28503960, 28693405, 28700280, 28712320, 28753995, 29285231, 29390339, 29623390, 29631062, 29665281, 29671190, 29806793, 30125675, 30252881, 30366049, 30872086, 30984205, 31228955, 31609785, 31804623, 31814470, 7591872, 9509902		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	10594567, 12632436, 15196263, 15654837, 15692984, 18685727, 20525258, 21059493, 23336215, 24105615, 25759827, 26222305, 26812624, 27914129, 29854829, 30252881, 39838177, 8712863, 9158087	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	LHGDN	16891799, 16897113		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	16891799, 24135410, 24749687, 33957967, 36333776, 39317938	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29441606		★☆☆☆☆ Found in Text Mining only
Berylliosis	Berylliosis	Pubtator	12449171	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Berylliosis	Berylliosis	Pubtator	16980557, 34399367	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
beta Thalassemia	Beta thalassemia	Pubtator	19103526, 26376749	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
beta Thalassemia	beta Thalassemia	BEFREE	31704504		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
beta^0^ Thalassemia	beta Thalassemia	BEFREE	10634824		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	15128911, 40607400	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	16061600		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	LHGDN	14967554		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	17239488, 18515978, 23064081, 25172408, 25855618		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	18515978, 25172408, 25855618, 26795430, 27660275, 27718369, 27841086, 28049760, 28416092, 28445689, 28783937, 28867391, 31214924, 31837338		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	22832610, 26257203, 31455761	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	24143878	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	25172408, 28049760, 34341362, 36303132, 36462601, 37058046	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	14967554, 30447566, 30560764		★☆☆☆☆ Found in Text Mining only
Bladder Exstrophy and Epispadias Complex	Bladder Exstrophy And Epispadias Complex	BEFREE	31821816		★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	29920227		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10996723, 12966432, 1450063, 14963492, 15533517, 15667866, 16094077, 16110031, 16882065, 18558283, 19338536, 22986753, 23442927, 23727622, 25955868, 26264279, 27034531, 27092883, 30066919		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	12966432		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	1674182		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	11549518, 8417962		★☆☆☆☆ Found in Text Mining only
Blau syndrome	Blau syndrome	Pubtator	40350497	Associate	★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	15248227	Associate	★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	18025480, 24462502	Stimulate	★☆☆☆☆ Found in Text Mining only
Bloch Sulzberger syndrome	Incontinentia pigmenti syndrome	BEFREE	17401626, 31009843		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	10393703, 11532095, 17346438, 22493072, 31077224, 31416821, 35180460, 37555786	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	29554045, 29608550, 31416821		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	15914954, 15956282, 17161243	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	35180460	Stimulate	★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	12619938	Associate	★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	28526615, 28850077		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	10050719, 12237295, 12396374, 12639988, 18612013, 18978943, 22330139, 24676726, 28137910, 32855274	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	15287939	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	15777737, 22440007, 22995314, 25329381, 25460501, 28063227, 29299476, 30405638, 31063409, 31433756		★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	12619938, 36077598	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	10572111, 12100146	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	11163081, 28131210, 8912208		★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	12750172, 21659535, 7579440	Associate	★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	11005785, 9807705	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	12639988, 15885469, 25278075, 3264773	Associate	★☆☆☆☆ Found in Text Mining only
Brachydactyly Type D	Brachydactyly	Pubtator	28504607	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Abscess	Brain Abscess	BEFREE	26187330		★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	11410733, 30860544		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	26661157, 29567026	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	9143252	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	17335802	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Infarction	Brain Infarction	BEFREE	20798494, 29196212		★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain infarction	Pubtator	32503645	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	17881124, 19850087, 9013604	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Injuries	Brain injuries	Pubtator	26559268	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Injuries Diffuse	Brain injuries	Pubtator	22117975	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	21676422, 21891866, 23768161, 40710309	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	23894384, 31173307	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	15756928		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	BEFREE	25032854		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Brain ischemia	Pubtator	30539420	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Brain ischemia	Pubtator	34199767	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	11146046, 11920585, 17541421, 1868490, 21908444, 27852701, 29453678, 29603739, 30867760, 7616275, 8297651		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	26017671, 31729458	Associate	★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	19799649, 21490427, 7905787, 9419972		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10400831, 10677530, 10880401, 11004679, 11241233, 11841482, 12206515, 14572152, 14633738, 14744790, 15217507, 15265021, 15265702, 15286701, 15354201, 15863392, 15999154, 16243830, 16280327, 16799635, 17047073, 17216494, 17283156, 17428620, 1764697, 17965799, 18234964, 18409070, 19087274, 19190336, 19509267, 19553068, 19632771, 19760502, 19766100, 1977519, 19890662, 20035378, 20446019, 20509143, 20872355, 20878356, 20882404, 20924115, 21323572, 21444724, 21476000, 21480222, 21490427, 21523452, 22320863, 22362301, 22386367, 22447108, 22750628, 22767506, 22844580, 22941467, 23033967, 23053664, 23128672, 23143946, 23174100, 23263670, 23292149, 23338610, 23451065, 23991131, 24036252, 24299316, 24301937, 24509793, 24598028, 24724627, 24745479, 25010932, 25149156, 25150312, 25175386, 25292037, 25328122, 25332681, 25401416, 25409762, 25419573, 25536365, 25559835, 25591657, 25659578, 25677845, 25704480, 25813148, 25928089, 26011589, 26112140, 26165253, 26331901, 26383972, 26403072, 26464679, 26553968, 26820653, 26927216, 26935527, 27091479, 27292433, 27351141, 27666521, 27832973, 27893337, 28081733, 28127258, 28173834, 28282786, 28369883, 28378740, 28441391, 28452243, 28460534, 28627683, 28651126, 28714000, 28723753, 28733879, 28764974, 28774312, 28791816, 28938560, 28945218, 28983080, 29088874, 29112895, 29175445, 29202842, 29256014, 29311633, 29620289, 29698439, 29751615, 29964331, 30082828, 30131941, 30132536, 30166590, 30177620, 30442350, 30657766, 30728901, 30850950, 30990165, 31032639, 31197211, 31239840, 31382678, 31454519, 31524251, 31571327, 31645610, 31659097, 31666931, 31730606, 31796638, 7592751, 8661822, 9038615, 9157996, 9419972, 9816237		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16298037, 17516992, 19446661		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	1320636, 36430763	Associate	★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast Diseases	BEFREE	27881867		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	27881867	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10400831, 10880401, 11751902, 15217507, 15625605, 15999154, 16518599, 16569699, 16785234, 16984377, 1711294, 17234183, 17881900, 18483465, 19052522, 19087274, 19126655, 1922031, 19423537, 19446661, 19533666, 19553068, 19799649, 19890662, 19920189, 19967414, 20418110, 20509143, 20650898, 20872355, 21486440, 21523452, 21754991, 21779361, 22884417, 22941467, 23263670, 23437193, 23451065, 23530106, 23650543, 23729230, 23991131, 24036252, 24377611, 24566270, 24864130, 25010932, 25213863, 2521857, 25304131, 25344915, 25401416, 25419573, 25559835, 2566907, 25752574, 25900663, 25928089, 26011589, 26112140, 26383972, 26464679, 26553968, 26697139, 26805406, 26918940, 27042827, 27050961, 27557669, 27701469, 27869167, 28369883, 28764974, 28791816, 28820959, 29256014, 29698439, 29751615, 30177620, 30279141, 30604733, 30802640, 30814616, 31341911, 3135043, 31382678, 31645610, 31659097, 31838945, 31978276, 32019974, 32067942, 32102503, 32455624, 32455774, 32805626, 32883235, 32933189, 32986377, 33342810, 33667790, 33767579, 34012256, 34572567, 3476961, 34853340, 34856073, 35296801, 35373393, 35508987, 35579936, 37063424, 37804426, 37988189, 38051374, 39351229, 40169858, 7479798, 8180021, 8390290, 9054379, 9370349, 9649140, 9667651, 9810003	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	14978035, 20177075, 25559835, 8381656, 9109412	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	23372803, 29186783, 31552680, 35993650, 37040163	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bright Disease	Bright Disease	CTD_human_DG	10910440, 9403216		★☆☆☆☆ Found in Text Mining only
Brittle diabetes	Brittle diabetes mellitus	CTD_human_DG	23640034		★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	10469028, 17196641, 18341619		★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial hyperreactivity	Pubtator	30978295	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	10515411	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiectasis	Bronchiectasis	BEFREE	10807822, 17509552		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiectasis	Bronchiectasis	Pubtator	11601743	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiectasis	Bronchiectasis	CTD_human_DG	17931847		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiolitis	Bronchiolitis	BEFREE	14722888, 18811622, 30290688		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	31901157, 35620861	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	36561744	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	10933164		★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	28887719		★☆☆☆☆ Found in Text Mining only
Bronchitis Chronic	Bronchitis	Pubtator	10706492, 18620570, 26620975	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis Chronic	Bronchitis	Pubtator	9543269	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	LHGDN	18620570		★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	31462114, 9372657		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	15286263, 17123322, 18645461, 19066187, 23359489, 25409741, 29136357, 29941022		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	37090732	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brucellosis	Brucellosis	Pubtator	10971514	Associate	★☆☆☆☆ Found in Text Mining only
Brucellosis	Brucellosis	Pubtator	20404074	Stimulate	★☆☆☆☆ Found in Text Mining only
Bruton type agammaglobulinemia	Bruton type agammaglobulinemia	Pubtator	17090647	Inhibit	★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	10902757, 10931145, 12209524, 1700705, 18050249, 28915665, 8387893, 8996256		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	16403098		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	11313273, 18550789	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	1281550	Stimulate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	16293872, 2848629, 9443579		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	LHGDN	16464740		★☆☆☆☆ Found in Text Mining only
Buruli Ulcer	Buruli Ulcer	BEFREE	28241036		★☆☆☆☆ Found in Text Mining only
Buruli Ulcer	Buruli ulcer	Pubtator	28241036	Associate	★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	10691916, 24119107	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cachexia	Cachexia	Pubtator	1707692, 2302463, 2695592, 27897403, 27900559, 29802455, 33047901, 34502316, 34787869, 7509363, 7678547, 8632999, 9239408	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Calcinosis	Calcinosis	Pubtator	11037898, 19035492, 35808901	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Calcinosis	Calcinosis	Pubtator	25711438, 29330517, 29653899, 34826571, 39313278	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Calcinosis	Calcinosis	Pubtator	36780769	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cancer of Digestive System	Gastric Cancer	BEFREE	24409077, 26047868		★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	23183825		★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	33000216, 33037017, 35016421	Associate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	26799286	Associate	★☆☆☆☆ Found in Text Mining only
Capillary Leak Syndrome	Capillary leak syndrome	Pubtator	12149215	Associate	★☆☆☆☆ Found in Text Mining only
Capillary Leak Syndrome	Capillary leak syndrome	Pubtator	17195014	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11171960, 15722350, 18025480, 18273051, 19124482, 19615068, 22228181, 22355351, 23010174, 23359190, 23866118, 24550071, 24692067, 25826493, 2662193, 28900035, 30857150, 30893332, 31972611, 32667519, 32686984, 33924332, 37530244	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19823053	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31911577	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10747083, 12906871, 16891465, 18087216, 18206417, 19350268, 23604035, 31709774, 8826937, 9872942		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	16412062	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	17268792	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	31031757	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15040026, 15567892, 16419152, 16425355, 16595893, 18030367, 19910749, 20356387, 21545687, 21928250, 22200181, 22354988, 22695741, 22700631, 22911714, 23305119, 23751896, 23811755, 24066693, 24223834, 24565101, 25420786, 25908103, 26045814, 26323317, 26464679, 26655845, 26672513, 27046040, 27509979, 27832318, 27858866, 28367089, 28865603, 29940792, 30810331, 31448426, 31870124, 32319631, 32363617, 32474905, 32641749, 33294448, 33712023, 33773554, 34603293, 34777920, 35007301, 35429130, 36308574, 36578460, 36674931, 36798119, 37047287, 38172174, 38401464, 39256453, 40139029	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15265907	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29556041, 33173438, 35125824, 39776121	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	16984377	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	21486440	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	7992839	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10996723, 12966432, 14963492, 15533517, 15667866, 16094077, 16110031, 16213477, 16882065, 18558283, 19338536, 22986753, 23442927, 23727622, 25955868, 26264279, 27034531, 27092883, 30066919		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	22240197, 23593411, 28667515, 7509279, 9583800		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10423407, 10945495, 11212267, 11731445, 11773980, 15014984, 15084385, 15746434, 15854959, 15864435, 16476505, 1680858, 17145853, 17316570, 18794145, 19469656, 19564826, 20068366, 20360945, 20450916, 21437888, 21699929, 22160576, 22675434, 23174563, 23339680, 24113849, 24139238, 24969564, 25118107, 25548907, 25562426, 25889486, 25891208, 25897826, 25977341, 26464679, 26823692, 27344406, 27556690, 27706681, 27738385, 27998891, 28099148, 28199969, 28446126, 28470556, 28575806, 28599466, 28672902, 28676715, 28798777, 29080421, 29345337, 29379440, 29408308, 29613856, 29720822, 29735548, 29890027, 29975933, 30078713, 30214604, 30352911, 30405827, 30508513, 30573629, 31018714, 31362929, 31428903, 31602275, 8086165, 8695164, 8978294, 9685865		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19484142, 20430728, 32851734, 34071938, 34328090, 8387543	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28513532	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24567526, 30426611, 31381571, 31672677, 33730072, 38018872, 40269781	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10408703, 10431690, 10944605, 11171960, 12944410, 1596939, 17881124, 19679182, 21068256, 24034344, 24777966, 24885059, 26500094, 26918621, 27297979, 29515108, 30082482, 31428993, 32469992, 33177244, 38537932, 7656270, 8004818, 8231032, 8776617, 8886918	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18294286, 24768357, 39768130	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	9486416	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	16412062	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10428482, 1503897, 1739610, 19387481, 22450746, 23870134, 24122460, 24550071, 25826493, 28112190, 30414907, 37369480, 37857527	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	20084448	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22808251	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	10735947, 11337940, 12490310, 14714556, 16826314, 18264131, 20489570, 22808251, 28881857, 31823140		★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	1733439, 19028472		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	26191186		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	1733439, 19028472		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	29399120, 8506954		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10053112, 11406568, 12538625, 12576447, 15047209, 15972852, 16044148, 16288025, 16364318, 16505113, 17234767, 1868469, 19484142, 20661217, 21081903, 22095071, 23634944, 24511008, 24676340, 25677845, 26122654, 26617713, 27068525, 27206315, 28044937, 28410380, 28848618, 29069020, 29286125, 29802567, 30642295, 30697874, 8166195, 8175024, 8385577, 8387543		★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	30515264		★☆☆☆☆ Found in Text Mining only
Cardiac Tamponade	Cardiac Tamponade	BEFREE	30100567		★☆☆☆☆ Found in Text Mining only
Cardioembolic stroke	Cardioembolic Stroke	BEFREE	31208196		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	10716473		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	10716473, 15218506	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	BEFREE	10953034, 15218506, 15630744, 16427798, 17038643, 17141882, 17336407, 20007453, 27622432, 28274156, 28553282, 29175266, 29862462, 29922960, 30740674, 9577949		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	34576032	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	10716473		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies, Primary	Cardiomyopathy	BEFREE	14522416		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	10850534, 16087131, 16730227, 18654018, 18997986, 25559996, 25827698, 9091515	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	15958363, 34669781	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	29566367	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	24716596	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	31180540, 35328083	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic Familial	Cardiomyopathy	Pubtator	35609334	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	10385500, 20491592, 23425028, 25559996, 30557992, 31019168, 8640999		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	LHGDN	12163370, 12644006, 16427798, 16730227, 18997986		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	10385500, 10930309, 15958363, 18997986, 20491592, 23425028, 25274950, 25559996, 29734265, 30046376, 30557992, 31019168, 31616309, 8624580, 8640999		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	11693755, 27992360	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	11744409, 12006640, 12058258, 15084512, 15530917, 15808915, 15854959, 16243340, 16456090, 16472051, 16840748, 17356550, 17705580, 18814905, 20061995, 20571888, 21169125, 21420089, 21559831, 22088456, 22650374, 22813949, 23024462, 23295110, 23624317, 25175566, 25255422, 25274950, 26455386, 26757793, 27128104, 27186644, 27441657, 27477483, 27796618, 27798514, 28256549, 28342151, 28352306, 28489742, 28603178, 28625037, 28867452, 28880739, 29069811, 29088580, 29112590, 29175266, 29318966, 29407876, 29484436, 29547707, 29617535, 29740313, 29764964, 29948222, 29959484, 30010698, 30081225, 30279269, 30315571, 30421104, 30584543, 30783447, 30813472, 30925081, 31037597, 31077224, 31208307, 31220998, 31279001, 31296155, 31485173, 31553329, 31813103, 31827125		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	12006640, 16879221, 20662694, 21795740, 23024462, 25827698, 26751459, 26884864, 27079270, 29316941, 31077224, 32805626, 34667241, 35977003, 36035865, 37782172, 37857527	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	15531184, 15780075, 16260427, 17705580, 18666029		★☆☆☆☆ Found in Text Mining only
Carditis	Carditis	CTD_human_DG	18627770, 25396421		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	BEFREE	21700929		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	33376728, 36316672	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	17347550, 21075101, 21393601, 26195278, 27001002, 27017522	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	29567026, 29740051		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	8506944	Stimulate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	11352237, 15641080, 21352802, 23846219, 24034344, 26045200, 3264773, 36799502	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	23257246, 28692119, 33855071, 9536291	Stimulate	★☆☆☆☆ Found in Text Mining only
Cat eye syndrome	Cat Eye Syndrome	BEFREE	28694207		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	29930475	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	30591791		★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	12554901, 19900796, 30132358, 31617573		★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	BEFREE	23969038		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	10773355, 12439617, 12738467, 12941768, 12959221, 15644122, 16287542, 16567828, 17550423, 17767555, 18346907, 25915602, 26662429, 26782543, 27597177, 28028951, 28319607, 29458413, 29960810, 30304371, 31591516, 8655356, 8814255, 9548076, 9672155		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	LHGDN	12959221, 17550423, 18346907		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	15608660, 16540751, 18369459, 25915602, 28049849, 29458413, 31591516, 34449925, 35208504, 35371081, 37047806, 38040898	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	35354862	Stimulate	★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	23848254, 28410344, 29779082		★☆☆☆☆ Found in Text Mining only
Central hypothyroidism	Central hypothyroidism	BEFREE	23716650		★☆☆☆☆ Found in Text Mining only
Central nervous system demyelination	Central Nervous System Demyelination	BEFREE	28337644, 31398658, 31845616		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	15327898, 16385659, 30770760, 31395092, 39364412	Associate	★☆☆☆☆ Found in Text Mining only
Centriacinar Emphysema	Pulmonary Emphysema	BEFREE	23734748		★☆☆☆☆ Found in Text Mining only
Centriacinar Emphysema	Pulmonary Emphysema	CTD_human_DG	25106431		★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome 1	Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome	BEFREE	30923465		★☆☆☆☆ Found in Text Mining only
Cerebral Aneurysm	Cerebral Aneurysm	BEFREE	16145536, 17415203, 25922506		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	11410733, 30860544		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	20534169, 31646585, 32129250, 36439158	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	38167007	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	14593215, 14992821, 16173529, 21562930, 24046817, 26665003, 27478098, 27585466, 28672984, 29401724, 29777731, 29867706, 30872008, 31032149, 31121365, 31192907, 31410157, 31440125		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Cerebral Infarction	LHGDN	14593215, 16173529		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Ischemic stroke	Pubtator	23286717	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Ischemic stroke	Pubtator	24817293, 26592822, 31183363, 31192907, 35074627, 36254030	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Ischemic stroke	Pubtator	32805626, 36066144, 38245621	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Palsy	Cerebral palsy	BEFREE	15718364, 16522396, 18715729, 22266275, 26646537, 30127816, 31269113, 31752816, 31779506		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	LHGDN	18391842		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	22884417, 39729404	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	31364129		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	10552245, 11273064, 12565819, 14615367, 15733973, 16473522, 16879054, 17109621, 17600229, 17981284, 19168815, 19891854, 21160173, 21219546, 21298033, 21407237, 22695677, 23050663, 24500802, 25175566, 27682880, 27809686, 27816188, 27955950, 28611085, 28630232, 28751018, 28844626, 29161722, 29275013, 29807527, 30120034, 30290827, 30588195, 30909835, 30972077, 30972972, 31356182, 31440125, 31822249		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	CTD_human_DG	10950380		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	LHGDN	14681891, 15036607, 16879054, 17452160, 17600229		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	19833626		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	19833626, 24165468	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	31744135	Stimulate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	11600224, 12142377, 12657115, 15717274, 16438713, 17452777, 18650831, 19823053, 20117760, 21670964, 22019249, 22146770, 22592655, 23028877, 23317256, 23494178, 23824834, 23850705, 25069725, 25113639, 25572145, 25614219, 26191295, 26214423, 27039819, 27599897, 28009429, 28669929, 28901517, 29291370, 29725439, 29940817, 30387170, 30453149, 31825934		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	11045789, 19614955, 23363891, 24403490, 28009429, 29608425		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11600224, 12142377, 12657115, 15717274, 16438713, 17452777, 18650831, 19823053, 20117760, 21670964, 22019249, 22146770, 22193459, 22592655, 23028877, 23317256, 23494178, 23824834, 23850705, 25069725, 25113639, 25572145, 25614219, 26191295, 26214423, 27039819, 27145290, 27599897, 28009429, 28669929, 28901517, 29291370, 29608425, 29725439, 29940817, 30355924, 30387170, 30453149, 31825934		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	16427798, 34867992	Associate	★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	23319192, 25245565		★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth disease, Type 1C	Charcot-Marie-Tooth Disease	BEFREE	25245565, 28164329		★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth disease, X-linked, 1	Charcot-Marie-Tooth disease	BEFREE	17714866		★☆☆☆☆ Found in Text Mining only
Cherubism	Cherubism	BEFREE	20002873, 23069372, 24916406, 24978678, 30236129		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	11549518, 15289017, 21875833, 21933669, 24798719, 25545232, 28061377		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	11153913, 16456144, 17450233, 20210814, 21271873, 21307151, 23376082, 23573270, 24465030, 30400588, 9645594		★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	16255056, 19758198, 23380467		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	27121136, 28115787, 31781194		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	17550129, 21327638		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	12175864		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	10209503, 10761710, 12125919, 16565491, 18069763, 19218340, 19721413, 28946560, 31914150, 33737613	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	10646872, 1355757, 15150106, 15887117, 16166346, 16818654, 18306229, 19218340, 19226333, 19721413, 21103345, 22038837, 25818002, 25987048, 29232409, 29410961		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	25987048	Stimulate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	27381730	Inhibit	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	11413121, 11454808, 31626701, 35281002	Associate	★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	15313687, 18260730, 24078093, 8844475		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	15313687, 18260730, 24078093		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	20626112		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis	Cholestasis	BEFREE	22105759, 30879149, 31026445, 31637886		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis	Cholelithiasis	Pubtator	22105759, 35196362	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis	Cholelithiasis	Pubtator	34971708	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis Extrahepatic	Cholelithiasis	Pubtator	32985571	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	CTD_human_DG	23627780		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	24489901, 28697498, 30039470		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	28789951		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholesteatoma	Cholesteatoma	BEFREE	23440434, 25416861, 31254133		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	33627146	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma Middle Ear	Middle ear cholesteatoma	Pubtator	31947538	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	11352241, 12587980	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	12763223, 15316669, 20857483, 28926925, 30054040, 30553437		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	LHGDN	15316669		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	31175552		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	32011476, 39393273	Associate	★☆☆☆☆ Found in Text Mining only
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Choreoathetosis	Pubtator	26472821	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	17642524, 25752285, 30591201, 8390539		★☆☆☆☆ Found in Text Mining only
Chorioretinitis	Chorioretinitis	BEFREE	18577652, 27081842		★☆☆☆☆ Found in Text Mining only
Choroideremia	Choroideremia	Pubtator	20027300	Inhibit	★☆☆☆☆ Found in Text Mining only
Christ-Siemens-Touraine syndrome	Hypohidrotic Ectodermal Dysplasia, X-Linked	BEFREE	11279189, 11343303, 11374782, 16379012, 17354266, 22296312, 26294279		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	28651907	Stimulate	★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	28384257, 29944680		★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	24570488, 29358084		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	14519761, 14613268, 1824252, 2056280, 27079270, 28045034, 28505128, 30313113, 30546074, 7790026	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	25630602	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	15234534, 27785664		★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	12062373, 16337191, 17556594, 27317841, 28889349		★☆☆☆☆ Found in Text Mining only
Chronic Infantile Neurological, Cutaneous, and Articular Syndrome	Neurological, Cutaneous And Articular Syndrome	BEFREE	22714396		★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	29465304		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	11979341, 15068388, 15600254, 15717635, 16076356, 16545788, 17173255, 17705580, 19497039, 19539174, 22069557, 23777202, 25589331, 26421528, 28036114, 28256549, 28834898, 31011203, 31101015, 31153055		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	15068388, 15600254, 15717635, 18433704, 19282863, 19424605, 21906921, 22813949, 23634661, 24012111, 24235082, 25585822, 28489742, 28732559, 28927419, 29048463, 29271576, 29301137, 29360163, 29369823, 29374468, 29451472, 29659957, 30009900, 30165303, 30241461, 30280599, 30367019, 30374604, 31198543, 31207307, 31301888, 31311999, 31514183, 31673705		★☆☆☆☆ Found in Text Mining only
Chronic leukemia (category)	Leukemia	BEFREE	2584719		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	12944979, 16425355		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10050718, 12411322, 12649137, 15545599, 15860672, 15927678, 15940637, 16270354, 16426238, 17071494, 19021060, 20071661, 20546021, 20613784, 20952689, 2114936, 2169926, 22144129, 22157808, 2258703, 22945689, 23225254, 23380816, 23990022, 24100449, 26522085, 26837762, 27544753, 28113108, 29156691, 29326123, 29431638, 30174282, 30291337, 31494171, 7994039, 8417962, 8457468, 8726409, 9858820		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	12187026, 17071494		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	21860020, 24463275, 25912019, 26852656, 30647074		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	10706492, 11001075, 11179116, 12537602, 12661999, 12765422, 15817713, 15820084, 16585076, 16867312, 16971410, 18256059, 19469656, 19608716, 19737233, 19933216, 20075389, 20224070, 20299531, 20352242, 20364405, 20522791, 20801891, 21197447, 21985478, 22542718, 22798194, 23144326, 23590298, 24111605, 24153451, 24215713, 24301759, 24528166, 24592811, 24818527, 24841653, 26044852, 26125715, 26170653, 26345700, 26555706, 26864305, 27516147, 27793775, 27883019, 27911957, 28142050, 28464990, 28511344, 28642115, 28668545, 28860735, 28951138, 29067126, 29078843, 29329680, 29456664, 29620199, 29872287, 30278779, 30280794, 30392917, 30498444, 30629626, 30676127, 30741829, 30908476, 31032652, 31078066, 31237014, 31257455, 31260854, 31319374, 31349003, 31390957, 31630084, 31669886		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	CTD_human_DG	15337792, 29497291		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	15766560, 16029496, 18256059, 18312445, 18510721		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic osteomyelitis	Osteomyelitis	BEFREE	28770614, 30259788		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	10589805, 12795791, 12828656, 15142217, 15842262, 16677285, 17823082, 19076989, 19555357, 19659894, 20059422, 22010076, 23368949, 23973890, 25647273, 26247485, 26812355, 27063995, 27992569, 27998014, 28177133, 28492359, 29174174, 29442464, 29449347, 29737428, 30186882, 30362297, 30427403, 30922293, 9609372		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	LHGDN	17209781		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	17823082, 22230463, 23368949, 24363500, 24670840, 25098998, 25530681, 25587209, 26812355, 28341818, 29449347, 30922293	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	26063981, 28341818	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	26211001	Inhibit	★☆☆☆☆ Found in Text Mining only
Chronic Q Fever	Q Fever	BEFREE	24931640		★☆☆☆☆ Found in Text Mining only
Chronic recurrent multifocal osteomyelitis	Recurrent multifocal osteomyelitis	Pubtator	29565497	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	24504744, 27885166, 28035475		★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	BEFREE	14643088, 29867314		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	11037831, 23446846, 26433033, 27508393, 28859701, 31794110		★☆☆☆☆ Found in Text Mining only
Ciliary Motility Disorders	Ciliary dyskinesia	Pubtator	29116124	Stimulate	★☆☆☆☆ Found in Text Mining only
Ciliary Motility Disorders	Ciliary dyskinesia	Pubtator	38245732	Associate	★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	BEFREE	26487268		★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathy	Pubtator	38245732	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	11196686, 11389006, 12717381, 18336639, 21229279, 22200181, 22330637, 22682513, 24751829, 24953022, 25556449, 28614777, 30070728, 30204505, 31486016, 31572482		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	18034274		★☆☆☆☆ Found in Text Mining only
Citrullinemia	Citrullinemia	Pubtator	39512337	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	1361101, 25360592, 2570526, 8644715	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	1346481, 1361101, 22174866, 24007308, 7485164, 8554055	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	10092095, 11847479, 31344597		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	9492179	Associate	★☆☆☆☆ Found in Text Mining only
Coffin-Siris syndrome	Coffin-Siris Syndrome	BEFREE	20729468		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	22632257, 27991935, 29633506, 30586550, 30855153, 31381975		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	22884417, 25542735, 27701469, 27991935, 30256904, 36977552	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	36195448, 36455873	Stimulate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	24332014	Stimulate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	30115946, 31353852, 36159817	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	10632972, 11196710, 14711688, 15667501, 16322943, 16881868, 17207256, 18492028, 18787102, 19238529, 19765578, 20848487, 21296062, 21383503, 21599020, 21853095, 21993693, 22044934, 22109555, 22326557, 22675442, 22939817, 23634661, 23795660, 24244444, 24339869, 24391216, 24718601, 24876225, 24938744, 25588868, 25775453, 26012567, 26034353, 26044960, 26348574, 27105524, 27229483, 27562600, 27639096, 27639807, 27806407, 27832933, 27866814, 27983971, 28039805, 28088460, 28159898, 28188801, 28193514, 28202618, 28293641, 28390705, 28411687, 28421634, 28493993, 28509629, 28556814, 28605639, 28756234, 28796256, 28967957, 29175304, 29286110, 29330471, 29350564, 29494494, 29555502, 29579933, 29633636, 29724065, 29796912, 29862296, 29871733, 30007036, 30011858, 30127744, 30315858, 30395870, 30415241, 30462121, 30615542, 30623320, 30779979, 30784573, 30800169, 30870270, 31043740, 31238939, 31351432, 31366877, 31439050, 31481750, 31497551, 31546840, 31621446, 31632588, 31635441, 31710624		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	LHGDN	18383524		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	Pubtator	19794144, 21058909, 21292998, 22187701, 22301110, 23634661, 29922282, 31730855, 35383266, 39991918	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	CTD_human_DG	23810507, 24548422		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis Ulcerative	Ulcerative colitis	Pubtator	12974765, 22187701	Inhibit	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	15223609, 17170025, 17300864, 17990358, 18698679, 18942751, 19757042, 20806430, 24705148, 24971461, 25076849, 25346048, 27152519, 27748438, 27895398, 28453768, 29333082, 29718226, 30190207, 30935734, 31584460, 31790426, 31798282, 31972611, 32612071, 32871953, 33008302, 33144895, 33160965, 33409535, 33608417, 34021361, 34418586, 35830366, 35876170, 35966251, 36130829, 36384477, 37078344, 37161415, 38269750, 8608636	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	17660846, 18160345, 19309553, 20547854, 21877213, 24197332, 24971461, 26752469, 30369485, 30429108	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis, Collagenous	Colitis	BEFREE	23566938, 28597107		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10784420, 10866999, 12215894, 14630701, 16928387, 17237282, 17283136, 19789336, 20082449, 21183948, 21631297, 21994466, 22417974, 22677195, 23255489, 23604035, 23869759, 24120915, 24176760, 24501326, 2451518, 24662837, 24676340, 25102301, 25156145, 25677845, 25704023, 26853468, 27889570, 27991929, 28098359, 28190020, 28223102, 28293641, 28797636, 29467899, 29725419, 30217305, 30651763, 30824815, 31353569, 31632588, 31838134, 7926038, 8239536, 8453631, 8605730, 8826937, 8827016, 9231070		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	10606965, 22434667	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11355696, 15611081, 1698444, 17142966, 17394066, 17916596, 19789336, 20307265, 26788912, 27268643, 27273097, 33242241, 37845228, 38287836, 7923248	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	12842827, 19028472		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17513605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	19170965, 36839242	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	BEFREE	25102301, 31429015		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	9472684	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Polyps	Colonic polyps	Pubtator	38297356	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12397645, 12478469, 12717839, 12839942, 16937502, 17186550, 18289203, 19383344, 20978325, 21248737, 21573932, 21633598, 21801808, 21980136, 23139614, 23431386, 24379584, 24404201, 24480808, 24885636, 25174402, 25225903, 25380824, 25561807, 26518902, 26572151, 2662193, 26996193, 27356745, 27421001, 27504605, 27517746, 28004114, 28087739, 28088229, 28115787, 28243990, 28575042, 28687755, 28719352, 28881611, 28974887, 29115450, 29238068, 29277790, 29494963, 29552185, 29695684, 29740162, 29755407, 29796912, 29801973, 29883699, 30011858, 30249397, 30409427, 30509964, 30509966, 30591653, 30610785, 30816524, 30999696, 31138083, 31707381, 31747664, 31762808, 8548754, 9243755, 9638659, 9891459		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	23431386		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10784420, 11282551, 12657625, 12842827, 14742435, 15188028, 1558785, 16158955, 16937502, 17160410, 17260007, 17300864, 1732118, 18064605, 18433468, 19124482, 19270743, 19383344, 20333377, 20978325, 21559086, 21596996, 21633598, 21994466, 22808230, 23359190, 23377828, 23431386, 23866118, 23869759, 24133572, 24166893, 24338023, 24379584, 24676340, 24885636, 25306394, 25561807, 25562322, 25875151, 26017781, 26072521, 26302825, 26515162, 26572151, 2662193, 26957265, 27421001, 27742576, 28408791, 28575042, 28676732, 28687755, 29096354, 29116428, 30351862, 30973070, 30999696, 31244280, 31608899, 32670264, 32805626, 33029691, 33859619, 33957885, 33961948, 34541005, 36235161, 37430251, 37596598, 38041015, 38195677, 38459704, 7926038, 9042431, 9990295	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12839942, 18289203, 18433468		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	16618754, 21945666, 24307732, 24397824, 25187386, 28483840		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18433468, 31244280, 37086961	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	2141333, 25225903	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	23431386		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	29710228	Associate	★☆☆☆☆ Found in Text Mining only
Combined Saposin Deficiency	Combined saposin deficiency	Pubtator	24373350	Associate	★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	BEFREE	12047333, 17063315, 19253056, 19559392, 20113413, 22001640, 24959879, 25434717		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Migraine	Common Migraine	LHGDN	14718719, 17063315		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Migraine	Common Migraine	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	10361243, 11472434, 16630927, 16630947, 17697196, 18204790, 19076825, 24051380, 27288995, 30698158, 31827477, 9508785, 9550427		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	10361243, 11009084, 19076825, 20629103, 31827477, 9508785	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	21548449, 34146579	Stimulate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	29083052	Inhibit	★☆☆☆☆ Found in Text Mining only
Compartment syndromes	Anterior Compartment Syndrome	LHGDN	16859780		★☆☆☆☆ Found in Text Mining only
Compensatory Hyperinsulinemia	Compensatory Hyperinsulinemia	CTD_human_DG	29035695		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	11455194, 15996036, 18190648, 20300807, 20499382, 22710188, 24397461, 25045829, 29054398		★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	18455351		★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	CTD_human_DG	15135227		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	25847150, 30924722, 31358003		★☆☆☆☆ Found in Text Mining only
Confusion	Confusion	Pubtator	40710309	Associate	★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	Pubtator	32765497	Associate	★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	10477731, 16322490, 17986934, 19064791, 29932521		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	LHGDN	16322490		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	16061600		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	15326480		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	22038837, 25987048, 28719954, 28946560, 30828998, 31533404		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital contractural arachnodactyly	Pubtator	25422198	Associate	★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	25308608, 9880689		★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1A	Congenital disorder of glycosylation	Pubtator	31545495, 33511216	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	10235436		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	27878778, 27957762, 31324728		★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	15837949	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	9880689		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of thymus	Congenital Hypoplasia Of Thymus	BEFREE	8734789		★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital Hypothyroidism	BEFREE	12799216		★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital Hypothyroidism	LHGDN	12799216		★☆☆☆☆ Found in Text Mining only
Congenital ichthyosis	Congenital Ichthyosis	BEFREE	27554821		★☆☆☆☆ Found in Text Mining only
Congenital neurologic anomalies	Drachtman Weinblatt Sitarz syndrome	BEFREE	28607066		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	10329082, 10358791, 10430608, 10953034, 11082413, 11309526, 11568062, 11789791, 11796554, 12062373, 12411982, 15135700, 15189946, 15867183, 15958363, 16337191, 17116693, 17556594, 18450464, 20224758, 20571888, 21153921, 21503626, 22921902, 27317841, 27409295, 28105731, 28367848, 28417241, 28515118, 28674538, 28695463, 28710070, 28722106, 28763371, 28793058, 28810263, 28881679, 28889349, 28925471, 29104628, 29175266, 29613828, 29895751, 30259192, 30476367, 30556887, 30586716, 30709867, 30744018, 30856027, 30860934, 30958967, 30968846, 31087601, 31154904, 31275453, 31494339, 31501486, 8640999, 9577949, 9657468, 9799654		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	15135663, 15231041, 17337591, 18034274, 29959987		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conjunctival Diseases	Conjunctival disease	Pubtator	19700933	Associate	★☆☆☆☆ Found in Text Mining only
Conjunctivitis	Conjunctivitis	BEFREE	11443543		★☆☆☆☆ Found in Text Mining only
Conn Adenoma	Conn Adenoma	BEFREE	29059354		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	17586554, 7731752		★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	LHGDN	18416756		★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	BEFREE	24673179, 30370844, 31425625, 31468302		★☆☆☆☆ Found in Text Mining only
Conus Medullaris Syndrome	Conus Medullaris Syndrome	CTD_human_DG	15135227		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11176446, 1389482, 15572731, 15814620, 16635513, 20566746, 22707636, 24530290, 24788726, 25691774, 26410531, 27362805, 27603297, 28362712, 28599476, 28915665, 29357946, 30082482, 30466107, 31001636, 8189599, 8483246, 8894681		★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal disease	Pubtator	1951636	Stimulate	★☆☆☆☆ Found in Text Mining only
Corneal Injuries	Corneal injury	Pubtator	12714388	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal Ulcer	BEFREE	12714388		★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal ulcer	Pubtator	12714388	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	22100609		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	32721809	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	11199329, 11257271, 11689215, 11737221, 11888514, 12818408, 15201277, 15223716, 15513316, 17346438, 17516296, 17581788, 18063147, 18600307, 18814905, 19803813, 20116810, 20571888, 21296384, 21477635, 22081334, 22691114, 23249640, 23357300, 23507260, 25108126, 25551602, 25811595, 26457306, 26751459, 27927628, 27955950, 28142118, 28233393, 28262198, 28739396, 28916975, 28931782, 29188498, 29324260, 29330256, 29399085, 29422093, 29617535, 29686027, 29729688, 29734056, 29940243, 30053815, 30506894, 30633155, 30943772, 31140911, 31157268, 31494339		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	11257271, 11357933, 11689215, 11737221, 11888514, 12818408, 12943869, 12972116, 15201277, 15223716, 15339882, 15485576, 15513316, 17346438, 17516296, 17581788, 17892998, 18063147, 18571179, 18600307, 18814905, 19644041, 19766904, 19803813, 20383745, 20493832, 21296384, 21477635, 21626471, 22081334, 22088456, 22691114, 23357300, 23507260, 25108126, 25124382, 25551602, 25811595, 26751459, 26884864, 27694344, 27955950, 28233393, 28262198, 28414590, 28739396, 28916975, 29324260, 29330256, 29399085, 29422093, 29453342, 29617535, 29686027, 29729688, 29734056, 30053815, 30212581, 30316971, 30338819, 30402858, 30506894, 30943772, 30961613, 31140911, 31157268, 31287004, 31494339, 31783142		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	15223716, 15513316, 17346438, 21498926, 22780915, 24736319, 25124382, 25551602, 26751459, 28233393, 28931782, 29131009, 30212581, 30961613, 31287004, 31411246, 34199767, 34320932, 35074627, 36538237, 36688193, 37201714, 37782172, 37820655, 37824465, 38459704, 39684689, 39684812	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	15269840, 17346438, 17499233, 17581788, 17763921		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	19551157, 21981776, 26749303, 26884864, 30392493, 32805626, 33029103, 38075042	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	19814730, 24381514, 32957369, 33204729, 33660877, 34850451, 34861059, 35282820, 35866783, 39344313	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	24167372, 27955950, 28390432	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	11257271, 11689215, 11737221, 11888514, 12818408, 15201277, 15223716, 15513316, 17346438, 17516296, 17581788, 18063147, 18600307, 18814905, 19803813, 20096599, 21296384, 21477635, 22081334, 22691114, 23159874, 23357300, 23507260, 25108126, 25551602, 25811595, 26751459, 27955950, 27957762, 28262198, 28739396, 28916975, 29324260, 29330256, 29399085, 29422093, 29617535, 29686027, 29731838, 29734056, 29896248, 30053815, 30093913, 30506894, 30680007, 30943772, 31140911, 31157268, 31324728, 31494339, 31746393, 9502188		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	LHGDN	15825968		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Restenosis	Coronary Restenosis	LHGDN	16319143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Restenosis	Coronary Restenosis	CTD_human_DG	16319143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Restenosis	Coronary restenosis	Pubtator	17994109, 21089112	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Restenosis	Coronary restenosis	Pubtator	31729103	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Stenosis	Coronary Stenosis	BEFREE	31780868		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	31780868	Stimulate	★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	39465738	Associate	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	15375575		★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	36312898	Stimulate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	17578498, 21442077, 21882204, 23446846, 24119601, 26358335, 26433033, 28859701, 31611936, 31794110		★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	BEFREE	17498268		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	21670923	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	10075959, 10210767, 10344681, 10535868, 10606965, 11196680, 11313304, 11502070, 11904678, 12019209, 12047261, 12049175, 12105838, 12190096, 12421092, 12428072, 12486099, 12789169, 12809834, 12811429, 12851870, 15212584, 15223609, 15620462, 15667501, 15685549, 15803022, 15842589, 15853915, 15937090, 15958080, 16534418, 16611251, 16641217, 16707469, 16707968, 16793911, 16881868, 16931032, 17001292, 17049565, 17255827, 17565648, 17565649, 18248655, 18355814, 18422560, 18452219, 18489434, 18493210, 18512248, 18942754, 19079204, 19550417, 19572373, 19673019, 19895991, 20456305, 20664576, 21248737, 21296062, 21402942, 21633892, 21887729, 21915486, 22021194, 22403795, 22434667, 22684480, 22848538, 22860894, 22960943, 23044675, 23607532, 23774171, 23942620, 23977323, 24018244, 24189042, 24203631, 24283919, 24412990, 24678851, 24707144, 24776844, 24971461, 25126549, 25311864, 25469874, 25500977, 25501099, 25637591, 25702170, 25809337, 26071216, 26208333, 26244882, 26288000, 26316104, 26634549, 26752469, 26891255, 26928573, 27096233, 27115882, 27190304, 27402301, 27466172, 27578800, 27596696, 27633266, 27665176, 27731365, 27781286, 27816496, 27866429, 27887202, 27890854, 27895399, 27930408, 27933472, 28039805, 28045034, 28067059, 28095262, 28104989, 28139755, 28183530, 28221250, 28225051, 28239885, 28275925, 28365485, 28390867, 28417241, 28421634, 28426458, 28454853, 28477389, 28481651, 28502609, 28505128, 28528528, 28674134, 28735823, 28747060, 28747340, 28752637, 28785150, 28826571, 28837372, 28837524, 28838418, 28879509, 28891095, 28945638, 29079905, 29182760, 29191059, 29209130, 29286110, 29287006, 29293965, 29333082, 29336432, 29361101, 29364909, 29372477, 29408806, 29462391, 29462395, 29486253, 29505910, 29521042, 29529008, 29535444, 29575262, 29588183, 29600354, 29667146, 29669006, 29673053, 29779158, 29788272, 29788318, 29857145, 29860529, 29872272, 29875003, 29875204, 29920733, 29930467, 29973427, 29975242, 29991880, 30002096, 30009157, 30052566, 30054143, 30056180, 30109889, 30134234, 30169620, 30194687, 30205699, 30225952, 30234366, 30286108, 30320603, 30345577, 30426297, 30429108, 30430682, 30479468, 30558178, 30560332, 30565265, 30607690, 30625408, 30663072, 30665494, 30685385, 30715262, 30753560, 30765731, 30773391, 30815825, 30854548, 30893421, 30897368, 31002701, 31006801, 31011260, 31039159, 31071076, 31077582, 31089365, 31098835, 31141991, 31169706, 31220875, 31252191, 31267570, 31279871, 31302421, 31327402, 31336198, 31415355, 31442600, 31488067, 31567638, 31574236, 31605784, 31610585, 31626694, 31634402, 31642006, 31645276, 31655907, 31663908, 31669077, 31703025, 31710624, 31742665, 31749597, 31807751, 31814801, 31822667, 31842582, 31844038, 8608636, 8612993, 8913936, 9246063, 9928378		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	10075959, 10389698, 10606965, 12105838, 12231473, 12377803, 14656710, 15306588, 15937090, 15958080, 17300864, 17444956, 18025155, 18635600, 18698679, 18942751, 19079204, 19094116, 19095953, 19299578, 19673019, 19888320, 19895991, 21155006, 21752952, 21797848, 21915486, 21930071, 22434667, 23349929, 24124330, 24363518, 24816497, 25206286, 25267953, 25493025, 26137941, 26339133, 26937622, 27100432, 27451881, 27636201, 27895399, 28045034, 28352666, 28590340, 28785150, 29104875, 29333082, 29372477, 29408806, 29521042, 29535202, 29556615, 29848778, 30286108, 30335469, 30445421, 30776076, 31169706, 31272196, 31415355, 31694333, 31822667, 31844038, 32252817, 32612148, 32699266, 33436852, 33537747, 33608417, 33750834, 33767696, 33936061, 34042156, 34629811, 34700029, 35529850, 36833372, 36916302, 37240037, 37586415, 37657036, 37802268, 37834250, 9239408	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	CTD_human_DG	10700533, 21829567		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	10719056, 17660846, 18160345, 19309553, 21658307, 22167015, 24918323, 26140540, 26752469, 29182760, 30765731, 31842582, 35665507, 9099934	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	LHGDN	11904678, 14732344, 15800781, 15803022, 16931032, 17507924, 17565648, 17631138		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	25956706, 31968593, 38517030	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	10700533, 21829567		★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	10700533, 21829567		★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	BEFREE	11434619, 17353164, 18775023		★☆☆☆☆ Found in Text Mining only
Cryopyrin-Associated Periodic Syndromes	Cryopyrin-Associated Periodic Syndromes	BEFREE	15059033, 18606080, 19877056, 23684246, 29130929, 29130931, 30385706, 30394352		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	36316863	Associate	★☆☆☆☆ Found in Text Mining only
Cushing's symphalangism	Proximal symphalangism	Pubtator	14615367	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	29434773		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	19626699, 25026000		★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic Neutropenia	BEFREE	28457902		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	31846412		★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	15790988, 19144271, 24853301	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	10195071, 10837369, 10970832, 11337375, 11403205, 11591888, 15790988, 16361706, 16622779, 17158822, 21496221, 21659660, 21908587, 22592805, 22660986, 23343370, 24062613, 24141140, 24603877, 24853301, 26209880, 27281024, 27397611, 29233471, 29942313, 30076968, 30472484, 30979683, 31262295, 31428093, 31742967, 8217192, 9698592		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic fibrosis	Pubtator	10515411, 22035905, 24098711, 24885494	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic fibrosis	Pubtator	11337375, 12221127, 12506110, 14525626, 14681029, 15790988, 15963954, 16928707, 17158822, 17210769, 18815075, 19144271, 19201925, 20507572, 20936184, 21496221, 21908587, 23343370, 24062613, 24603877, 26331676, 26485688, 29230506, 31428093, 33924887, 34166230, 36480571	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic Fibrosis	LHGDN	16622779		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic kidney	Cystic Kidney Disease	BEFREE	28476889		★☆☆☆☆ Found in Text Mining only
Cystic Kidney Diseases	Cystic Kidney Disease	BEFREE	28476889		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	29136560, 29465304, 31091120, 31429405		★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	24146927, 30973927, 36045687	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	22473048, 30651780		★☆☆☆☆ Found in Text Mining only
deficiency of adenosine deaminase 2	Adenosine deaminase 2 deficiency	Pubtator	31015188, 33021335, 36941081, 38115782	Associate	★☆☆☆☆ Found in Text Mining only
Deficiency of glucose-6-phosphate dehydrogenase	Deficiency Of Glucose-6-Phosphate Dehydrogenase	BEFREE	11196674, 15718915, 20655368		★☆☆☆☆ Found in Text Mining only
Deficiency of mevalonate kinase	Deficiency Of Mevalonate Kinase	BEFREE	13130485, 22714396, 29032440, 30394352, 31013450		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10090156, 10211885, 10229398, 10643716, 10782809, 11285370, 11352237, 11508576, 11728217, 11920402, 11966774, 12048293, 12684836, 12913922, 12925611, 14558084, 14687710, 15316669, 15498798, 15517632, 16507142, 16571608, 16806998, 16934183, 17122966, 17216674, 17604656, 17853003, 17963503, 17968879, 18438844, 20059371, 20407468, 20491788, 21352802, 21858617, 22264405, 22380539, 22682473, 22711527, 22736176, 22939867, 23335080, 23595570, 23748461, 23880957, 24126638, 24223987, 24269637, 24635637, 24657155, 24720504, 2505790, 25172660, 25193704, 25252624, 25291965, 25398219, 25461395, 25817699, 25824140, 26045761, 26233477, 26238767, 26409848, 26521731, 26696755, 26718307, 26821827, 27555113, 27635406, 27726040, 27726041, 27739057, 28063227, 28223125, 28238786, 28245522, 28316377, 28358372, 28442110, 28463061, 28470428, 28507472, 28668088, 28677145, 28692119, 28695434, 28849229, 28869834, 28934732, 29072705, 29138829, 29163027, 29168867, 29245931, 29247146, 29316707, 29441864, 29484338, 29549492, 29564448, 29581742, 29663159, 29663644, 29682561, 29693122, 29783732, 29846433, 29857819, 29891807, 29928231, 29941879, 30087236, 30096598, 30174601, 30186498, 30195882, 30280200, 30317616, 30340603, 30340925, 30390341, 30521963, 30538044, 30542428, 30557884, 30691048, 30704030, 30707846, 30784197, 30826358, 30844228, 30939166, 31055848, 31063409, 31068673, 31075239, 31078342, 31121225, 31177887, 31210280, 31228817, 31238971, 31261789, 31262076, 31282065, 31298308, 31322228, 31396341, 31410125, 31434236, 31484360, 31484919, 31497200, 31497826, 31539804, 31545916, 31673109, 31696218, 31711940, 31735552, 31791585, 31829201, 31836142, 31837247, 31837574, 7622181, 9032818, 9461124, 9616438		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	15641080, 16820934, 17434489		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	11011080, 23607276, 25589894, 29091813, 29115460, 29350052, 30353672, 31366877, 31805674, 31849652		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	20471115, 23385102, 27816188, 29549829, 30348620		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	10229115, 19531281, 21509504	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	11506397, 12782345, 14615042, 15271127, 15832029, 19618378, 19836613, 21509504, 30150062, 31145377, 31414991, 31497846, 8498837, 8943206, 9119960		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	14615042		★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	36451386	Associate	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	11273064, 12782345, 15832029, 25835425, 26577108		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Demyelinating Diseases	Demyelinating Diseases	BEFREE	10092095, 12824709, 24024893, 25692775, 27931132, 28131210, 29529105, 31398658		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	16385659, 16645971, 23319192, 31810488	Associate	★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	21261944, 36507746	Associate	★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	19018026, 20615908, 29127274		★☆☆☆☆ Found in Text Mining only
Denys-Drash Syndrome	Denys-Drash Syndrome	BEFREE	28114570		★☆☆☆☆ Found in Text Mining only
Depression in children	Mental Depression	BEFREE	30469423		★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	BEFREE	31693974		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	12084660, 19836613, 19891854, 20661026, 20955778, 21194425, 22580182, 22921153, 22990943, 23415700, 25596176, 26083579, 26378439, 26812919, 27049572, 27187381, 27592314, 27840055, 27876634, 27991935, 28041597, 28093238, 28511072, 28536068, 28580183, 28670290, 28778811, 28809993, 28914726, 28918107, 28954415, 28958613, 29049348, 29059681, 29118582, 29408464, 29424322, 29427595, 29460011, 29500107, 29518097, 29543650, 29574669, 29765402, 29799484, 29849779, 29969604, 30035700, 30052465, 30098513, 30104698, 30136679, 30218782, 30334417, 30470307, 30572037, 30616482, 30711869, 30792669, 30939048, 30957546, 30967802, 30978658, 31017303, 31022424, 31049023, 31052597, 31064292, 31073553, 31125623, 31214095, 31296155, 31375659, 31513828, 31615595, 31616368, 31622870, 31736187, 31820774, 31837338		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	1309855, 23064081, 24182629, 24598699, 24726621, 29361849, 30310056, 30957546, 32998701, 34787869, 35113419, 36911716, 39760673, 40403713	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	14973143, 18063307, 22171008, 27991935, 29856741, 37058046	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	22580182, 24094876, 25151093, 25315113, 25903726		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	17610667, 27138824, 29361849, 29856741, 32919410	Stimulate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	24620999, 30310056, 30870525, 34171401, 37058046	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	20112373, 22303003, 23643662, 24211183, 24673179, 27476970, 27586798, 27747869, 27964879, 28222357, 29105195, 29171393, 29596938, 29698775, 29728512, 29767264, 30259241, 30321197, 30857352, 31515807, 31775224		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis	Dermatitis	Pubtator	29143979, 29526761, 7492240	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	1712219, 27383320	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	17960185, 22533231, 23328497, 23436698, 24518171, 25315214, 27077833, 29996938, 34070943, 34208434, 36587063, 38302650, 40713851	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	26682905	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	15304089, 37187734	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	16575390	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	7738367	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Allergic Contact	Dermatitis	LHGDN	12694213		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	15849067		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Allergic Contact	Dermatitis	BEFREE	19706048, 27383320, 28300283		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	11133838, 12828754, 13679820, 15149503, 21453958, 21765951, 22407167, 22427475, 23328497, 23454147, 26419317, 27240833, 27289147, 27554821, 28530223, 28833499, 28990098, 29212072, 29339444, 29353040, 29660465, 29845271, 29977237, 29996938, 30025384, 30066901, 30183461, 30286163, 30400334, 31007602, 31059034, 31172723, 31308264, 31338033, 31437788, 31641232		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	LHGDN	15560757		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Irritant	Dermatitis	BEFREE	10752629		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	12485445, 17244977, 19568223, 20112373, 21454693, 22935442, 24324571, 29279286, 29339444, 29596938, 30370844, 31413544, 31535738, 31615316		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	BEFREE	10399751, 10805105, 12147628, 12230503, 15338498, 15577608, 16895750, 16970978, 17586554, 19953283, 25101759, 30367666, 30645753		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	Pubtator	11037898, 12230503, 12485445, 19035492, 20605164, 24127327, 28941496, 35281002	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	LHGDN	12230503, 16895750, 17408448, 19035492		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	CTD_human_DG	19035492		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	Pubtator	19953283	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	11037898, 11465953, 18240225, 19035492, 20605164, 22740338, 26628598, 30068766, 31302187		★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	CTD_human_DG	19035492		★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	11673208, 14975942, 17208287, 29080069		★☆☆☆☆ Found in Text Mining only
Developmental absence of tooth	Anodontia	BEFREE	26411740		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	19211157	Inhibit	★☆☆☆☆ Found in Text Mining only
Developmental Dysplasia of the Hip	Developmental dysplasia of the hip	Pubtator	25578529	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10457150, 10637268, 10946317, 11287357, 12058258, 12378118, 14988254, 15541048, 16112048, 16306329, 16437243, 16464741, 17346438, 17883332, 17944678, 17966038, 18348311, 18688044, 19118408, 20059422, 20185810, 21149504, 22068019, 22382194, 22650374, 23159874, 23298660, 23471081, 23602201, 24192345, 24286720, 24424289, 24497209, 24934088, 25003704, 25684197, 25732517, 26103543, 26122662, 26419589, 26704714, 26821796, 27937047, 27955950, 28142150, 28285015, 28460049, 28463061, 28475641, 28772214, 28809783, 28855812, 29240821, 29286405, 29322226, 29348480, 29414152, 29456813, 29490938, 29501767, 29720826, 29780390, 29890544, 30035378, 30043856, 30054234, 30054947, 30083983, 30127248, 30279162, 30552892, 30610442, 30660761, 30673733, 30855435, 30989829, 31001066, 31059127, 31060892, 31070007, 31177887, 31436116, 31461798, 31502701, 31534976, 31685773, 31781724, 31834153, 7682590, 8608724		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	10540181, 18575614	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	20536548, 26752743, 28112754, 28846666, 31099333, 31940889, 33019392, 36709877, 36849131	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	24262292, 26053136, 30020508, 31880859, 32280713, 35390031	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	29385062	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10457150, 10637268, 10672452, 10773354, 10946317, 11287357, 12058258, 12378118, 14988254, 15541048, 16112048, 16306329, 16437243, 16464741, 16622779, 16829307, 17346438, 17883332, 17944678, 17966038, 18348311, 18688044, 19118408, 20059422, 20185810, 21149504, 22068019, 22382194, 22650374, 23159874, 23298660, 23471081, 23602201, 24192345, 24286720, 24424289, 24497209, 24934088, 25003704, 25684197, 25732517, 26103543, 26122662, 26419589, 26686228, 26704714, 26821796, 27937047, 27955950, 28000874, 28142150, 28285015, 28460049, 28463061, 28475641, 28503994, 28658037, 28741143, 28772214, 28809783, 28824543, 28848152, 28855812, 28857196, 29091912, 29240821, 29286405, 29322226, 29348480, 29360163, 29367417, 29414152, 29456813, 29473098, 29490938, 29501767, 29568898, 29720826, 29780390, 29890544, 29904423, 29925283, 30035378, 30043856, 30054234, 30054947, 30083983, 30118750, 30127248, 30179212, 30279162, 30550811, 30552892, 30610442, 30651825, 30660761, 30673733, 30855435, 30989829, 31001066, 31059127, 31060892, 31070007, 31167971, 31177887, 31402276, 31436116, 31461798, 31502701, 31515869, 31534976, 31666475, 31685773, 31747350, 31773714, 31781724, 31834153, 7682590, 8608724		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	10829018, 15627647, 16464741, 16864906, 17047287, 17346438, 19769745, 20686866, 20943792, 20967696, 21149504, 21784542, 22012292, 22385239, 25053869, 25674226, 29696068, 29940585, 31626638, 33060583, 33820928, 34311758, 35468098, 35956419, 36769056, 37986309, 38583950	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	12898475, 17716775		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	17911088, 18285554, 18349110, 20377994, 21694775, 24172699, 24521217, 26604209, 27001002, 27123454, 28454543, 30367115, 31244210, 32215181, 34283808, 34951048, 39456722	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	10540181, 15627647, 16464741, 17174749, 17989340, 18369459, 18575614, 19127455, 19167443, 20686866, 21097392, 23409157, 23494449, 24523574, 25053869, 26782543, 26821796, 27575603, 32787907, 34650558, 35299968, 37062177, 8847231	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	12410803, 16864906, 17100770, 19127455, 39273664	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	15584977	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	11469400, 15217754, 15774022, 16784178, 17347550, 17428349, 20007938, 20377994, 20459604, 20967696, 21465273, 21508505, 21709297, 21756351, 22327199, 23110196, 24182629, 25061733, 25098998, 26782547, 27649540, 28626770, 28934129, 29752628, 29947343, 30139387, 32049633, 32229084, 32806763, 32962477, 33678630, 33902539, 35052401, 35712257, 35960063, 36462601, 37047308, 37082729, 37140276, 37215099, 37626843, 37782172, 38583950, 39738562	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17714581, 19633828, 20019678, 23423575, 24429578, 27218216, 27771154, 27904654, 29025405, 29233142, 30212581, 31269743, 34763485, 34917685, 35605453, 36232497, 36463286, 37838749, 37986309	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25959254, 28122717, 33446687	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10527399, 10566598, 10703602, 10803866, 10819246, 10999832, 11024034, 12021142, 12270547, 12366785, 12485196, 12622777, 12770796, 12788886, 12941768, 1503608, 15149631, 15627647, 15757867, 15855327, 16464741, 16567828, 1676685, 1682200, 1698309, 17130569, 17174749, 17498265, 17550423, 17678725, 17928399, 17989340, 18247339, 18949133, 19120272, 19127455, 19136037, 19167443, 19477545, 19530270, 1996407, 20185810, 20686866, 20849900, 21097392, 22069270, 22366579, 22569251, 23438440, 23644451, 24515539, 24677718, 2572498, 25965561, 26114833, 26782543, 26847698, 26904692, 27677500, 27890035, 28241993, 28280903, 28377612, 28419209, 28426801, 28640379, 28824543, 29206239, 29240821, 29249872, 29257900, 29284457, 29312639, 29445851, 29652777, 29941029, 29992506, 30058243, 30497321, 30945295, 31054364, 31054482, 31185481, 31210557, 31813103, 7682590, 7731752, 7926295, 8056188, 8093442, 8223882, 8307785, 8847231, 8872171, 8875117, 8882412, 8971540, 9174153		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	12021142, 16260427, 16864906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	23640034		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Ketosis-Prone	Diabetes Mellitus	CTD_human_DG	23640034		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10405788, 10436179, 10457150, 10528229, 10878750, 10885566, 11315843, 11399938, 11891022, 11916923, 12058258, 12218380, 12690081, 12753658, 12788886, 12818408, 12829659, 12898475, 14988254, 15168015, 15217754, 15223990, 15541048, 15787661, 16050950, 16132956, 16370555, 16472051, 16677285, 16731844, 16979413, 17244513, 17347550, 17445540, 17592954, 18219773, 18249219, 18267303, 18328809, 18433704, 18438653, 18835531, 19367363, 19955001, 20007938, 20019678, 20059422, 20177654, 20459604, 21249428, 21262584, 21289263, 21494616, 21508505, 21756351, 21849023, 22015686, 22081334, 22327199, 22382194, 22580620, 22869322, 23080424, 23249316, 23298660, 23527193, 23643522, 23900510, 24012111, 24018334, 24057184, 24139907, 24197696, 24497209, 24655058, 24827430, 24952604, 25061733, 25634985, 25656761, 25704106, 26095630, 26239742, 26742527, 26782547, 26797519, 26821796, 26830076, 26883847, 26945994, 27317602, 27323139, 27349479, 27421726, 27573980, 27649540, 27684566, 27822481, 27832672, 27904654, 28067023, 28105731, 28367848, 28393627, 28414180, 28569437, 28620993, 28626770, 28647512, 28651236, 28716139, 28789654, 28794498, 28824430, 28855812, 28928602, 29025405, 29032727, 29095915, 29096724, 29104510, 29142506, 29161407, 29168915, 29190710, 29229313, 29233142, 29256014, 29398906, 29420997, 29491712, 29526533, 29551922, 29558631, 29605608, 29687969, 29896248, 29928231, 29945132, 29955954, 29980311, 30015512, 30021757, 30142362, 30212581, 30333553, 30447052, 30638160, 30762811, 30871547, 30894049, 30917933, 31004310, 31222667, 31269743, 31296192, 31355282, 31363374, 31424965, 31450982, 31479874, 31485456, 31496653, 31513665, 31545080, 31561205, 31593637, 31600210, 31733313, 31803921, 31813103, 31827375, 7783649, 8899294, 9157089, 9562347		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	11891022, 12788886, 17445540, 17499233		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	24513509		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Sudden-Onset	Diabetes Mellitus	CTD_human_DG	23640034		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	CTD_human_DG	23640034		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	20098449		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	CTD_human_DG	17909696		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	34926700	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Foot	Diabetic foot	Pubtator	33096729, 34293021	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	35394091	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic ketoacidosis	Pubtator	17335802	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	15600254, 18575614, 26045828, 28060893, 32684830, 36363561, 40312440, 9067916	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	26045828, 32684830	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15600254, 15787661, 16141456, 17173255, 23594678, 23793620, 24073796, 24655058, 25704106, 25732517, 26045828, 27003829, 27218216, 28060893, 28414180, 28476763, 28566504, 28933050, 28944839, 29042282, 29250558, 29490938, 29507271, 29514038, 29910771, 29999450, 30015512, 30062492, 30212710, 30342113, 30355913, 30417374, 30478987, 30632070, 30862474, 30868076, 31207020, 31218128, 31258671, 31323309, 31344701, 31527864, 31637265, 9067916		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	15600254		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	30496699		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	37197158	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	11640992, 16979413, 24073796, 24655058, 25073020, 25634985, 26125742, 26710229, 26821796, 27288252, 28138697, 28262614, 28556866, 28767589, 28843858, 28852447, 28969616, 29678603, 29802904, 29850610, 29959897, 30244600, 30535867, 31341796, 31351870		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	15504978, 17716775, 18398712, 18413212		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	25073020, 25617622, 26710229, 33156339, 33396676, 35590353, 38194422, 38222451, 8814750	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	36465606	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diarrhea	Diarrhea	Pubtator	16760259, 20348510	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	35398299	Stimulate	★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	37895018	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	29168186, 31201646		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	16293872, 16389181, 16643431, 17056605, 17510437, 17606447, 19390683, 20047977, 20889926, 23391141, 23532628, 23640160, 24857911, 25962811, 26044172, 26722496, 27822610, 28060727, 28544905, 30165192, 31033093, 31335688, 31731887, 7812976		★☆☆☆☆ Found in Text Mining only
Diffuse panbronchiolitis	Diffuse panbronchiolitis	Pubtator	8915693	Associate	★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	DiGeorge Syndrome	BEFREE	8734789		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	10848881, 15219383, 31142672, 31609785		★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	21329569, 22404198		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	26544637, 29104039, 29589594, 30086263, 30212440		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated intravascular coagulation	Pubtator	18088351, 40513998, 8182139	Associate	★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	21777617, 25066751, 28252221, 28514870, 30991817		★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Distal myopathy	Pubtator	11159171, 23496965	Associate	★☆☆☆☆ Found in Text Mining only
dowling-degos disease	Dowling-Degos Disease	BEFREE	29320615, 31140325		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	1388194, 1408461, 14615042, 27770619, 29137441, 30902060, 31699819		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	14615042		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	29093484, 30902060, 36577365	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	31699819	Stimulate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	20036239, 21245952, 25817729, 34048779, 35916880, 36208723	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	23169882, 27489152, 32476816, 39884388	Stimulate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	24343449, 28511072, 29039509, 30325678, 30552892, 31430719		★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	29912900	Associate	★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	10435444, 11781708, 15381184, 15652446, 16164697, 19626584, 19804405, 23451177		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	LHGDN	15381184, 15652446, 19147919		★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	23431165, 29983350	Associate	★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	26152183	Stimulate	★☆☆☆☆ Found in Text Mining only
Dysautonomia, Familial	Dysautonomia	BEFREE	28457935		★☆☆☆☆ Found in Text Mining only
Dysbiosis	Dysbiosis	Pubtator	30818349, 39741321	Associate	★☆☆☆☆ Found in Text Mining only
Dysembryoplastic neuroepithelial tumor	Dysembryoplastic Neuroepithelial Tumor	BEFREE	29906494		★☆☆☆☆ Found in Text Mining only
Dysentery	Dysentery	Pubtator	20348510	Associate	★☆☆☆☆ Found in Text Mining only
Dysequilibrium syndrome	Dysequilibrium syndrome	Pubtator	37052975	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	24278120	Inhibit	★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	24278120, 31435075	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	31335998		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	10878750, 15809899, 17700364, 18278185, 20856927, 25439236, 26264374, 26618233, 27578290, 28965953, 29096839, 29236301, 29516281, 29980311, 30429440, 30535619, 31153461, 31185481, 31669886, 31671940, 31774317, 31781724		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	LHGDN	18278185		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	37531036	Associate	★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	25026000		★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	BEFREE	19419979		★☆☆☆☆ Found in Text Mining only
Dystonia 3, Torsion, X-Linked	Dystonia	BEFREE	28017799		★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	15787661, 22015686, 24845156		★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	31638207		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	29906710		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	12747232, 14963369, 15901845, 18705845, 22947907, 25879409, 27862673, 29109760, 29345041, 30606056, 8603520, 8875117		★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 10A, HYPOHIDROTIC/HAIR/NAIL TYPE, AUTOSOMAL DOMINANT	Ectodermal dysplasia	BEFREE	22296312, 26294279		★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 10B, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL RECESSIVE	Ectodermal Dysplasia	BEFREE	22296312, 26294279		★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 11A, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL DOMINANT	Ectodermal dysplasia	BEFREE	22296312, 26294279		★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 11B, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL RECESSIVE	Ectodermal dysplasia	BEFREE	22296312, 26294279		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia Anhidrotic with Immunodeficiency Osteopetrosis and Lymphedema	Anhidrotic ectodermal dysplasia with immunodeficiency, osteopetrosis, and lymphedema	Pubtator	10428056, 19860911	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	11133838, 12828754, 13679820, 15149503, 21453958, 22407167, 22427475, 23328497, 23454147, 26419317, 27240833, 27289147, 27554821, 27571340, 28530223, 28833499, 28990098, 29023827, 29212072, 29339444, 29353040, 29428424, 29660465, 29845271, 29977237, 29996938, 30025384, 30066901, 30183461, 30286163, 30400334, 31007602, 31059034, 31172723, 31308264, 31338033, 31437788, 31641232		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	26559252	Inhibit	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	29143979	Associate	★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	27869150, 35260880	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Edema	Edema	Pubtator	32357159, 39533623	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Elliptocytosis, Hereditary	Elliptocytosis	BEFREE	20655368		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	23734748, 32946850, 33936110	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	19479051, 24330827	Stimulate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	22276993	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	23382563, 23971732, 26816094, 28173746, 28284352, 29373982, 30044892, 30837977, 31049785		★☆☆☆☆ Found in Text Mining only
Encephalocele	Encephalocele	Pubtator	17688691	Associate	★☆☆☆☆ Found in Text Mining only
Encephalocele	Encephalocele	Pubtator	30511959	Stimulate	★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	12934185, 14968205, 23315809, 7695238, 9696492		★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	11192323, 12682890, 12911663, 17974504, 24361409		★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	BEFREE	10603382, 8613372		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	21891866	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	28145630, 9174153		★☆☆☆☆ Found in Text Mining only
Endogenous Hyperinsulinism	Endogenous Hyperinsulinism	CTD_human_DG	29035695		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	1312427, 20878137		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10671688, 12237915, 17013801, 19690133, 31043860		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	12237915		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	11285034, 16826583, 17013801, 21305022, 34712201, 37233761	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	12237915	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	16332726, 8001927		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32805626, 34528556	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	30152254		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	21640344, 23171678, 24654751, 29208847, 29679753, 30020448, 31148852		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	10690897, 11968047, 14506926, 14734195, 15212671, 15319381, 16911716, 17595314, 17644810, 18061171, 18272527, 18596029, 18684450, 18978361, 19238748, 19394608, 19661147, 20176595, 20435921, 20561612, 22392486, 23167810, 23269356, 23293332, 23427178, 23553861, 23935397, 23952049, 24308758, 24382102, 24791888, 24844917, 26191186, 27371899, 27515307, 27593876, 28412861, 28470452, 28992341, 29040578, 29771400, 29779473, 30732877, 31070761		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Endometriosis	Endometriosis	LHGDN	11968047, 15212671, 15319381, 16006475, 17207568, 18272527		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Endometriosis	Endometriosis	Pubtator	12372447, 15950634, 16759923, 17555752, 19394608, 21640344, 23952049, 24133591, 24844917, 26191186, 27542948, 29771400, 31551156, 34539624, 37389684, 39458478	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Endometriosis	Endometriosis	Pubtator	17548071, 37095705	Stimulate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Enterocolitis	Enterocolitis	Pubtator	33891982	Stimulate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	34418984, 39342173	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	8506954	Stimulate	★☆☆☆☆ Found in Text Mining only
Enthesitis	Enthesitis	BEFREE	15922688, 26821681, 28551170, 30037432, 30729703, 30824641		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	15100677, 22909167, 30453907		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	32170921, 8514874	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	29372536, 29895838, 30578874, 30791784, 31160974		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	30578874, 36591238, 37972740	Associate	★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	1919049, 23429285	Stimulate	★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia Verruciformis	BEFREE	29967610		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Epidermolysis Bullosa	BEFREE	26496255		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex	Epidermolysis bullosa	Pubtator	14660619	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex	Epidermolysis Bullosa Simplex	BEFREE	28647894		★☆☆☆☆ Found in Text Mining only
Epididymitis	Epididymitis	BEFREE	30398566		★☆☆☆☆ Found in Text Mining only
Epilepsies Partial	Partial epilepsy	Pubtator	39259090	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	22578659, 29363732, 29563977, 29937116, 30077908, 30130550, 30307467, 30316834, 30394583, 31144434, 31258675, 31572289		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	33920713, 39259090	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Absence	Absence epilepsy	Pubtator	30152135	Stimulate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	23634661, 27006531, 36977552	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	23634661, 23636891, 27006531, 30006293		★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	28125840, 7843589		★☆☆☆☆ Found in Text Mining only
Episodic Ataxia	Episodic ataxia	Pubtator	23527726	Associate	★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	28185403		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	16288025, 17234767, 20661217, 28848618, 29069020, 29286125, 29802567, 8166195, 8175024, 8387543		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	28458624, 29451063		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	27904147, 28763467, 29260891		★☆☆☆☆ Found in Text Mining only
Erectile Dysfunction	Erectile dysfunction	Pubtator	29233142	Stimulate	★☆☆☆☆ Found in Text Mining only
Erectile Dysfunction	Erectile dysfunction	Pubtator	39809170	Associate	★☆☆☆☆ Found in Text Mining only
Erythema Multiforme	Erythema	BEFREE	10571738		★☆☆☆☆ Found in Text Mining only
Erythema Nodosum	Erythema nodosum	BEFREE	11411907, 12198697, 15803022, 19225544, 27392760		★☆☆☆☆ Found in Text Mining only
Erythrocytosis Familial 2	Erythrocytosis	Pubtator	19062180	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Achalasia	BEFREE	24259423, 29698944		★☆☆☆☆ Found in Text Mining only
Esophageal and Gastric Varices	Esophageal And Gastric Varices	LHGDN	15754412		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	16153435, 17638919, 24754231, 24959694, 25814442, 26823692, 27697099, 27821804, 28283752, 30854115, 31109341		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	16153435, 17638919, 24754231, 24959694, 25814442, 26823692, 27697099, 27821804, 28283752, 30854115, 31109341		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	19339270, 23082063, 25292072, 29028942, 36555705	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	1351861, 24151445, 24324738, 24402574, 33374641, 33572115, 36357564, 39307133	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	21451212, 8040024		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	BEFREE	11315843, 18177730, 19557004, 22438881, 22536381, 26782547, 29258412, 29752343, 30359461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	Pubtator	22438881, 26782547, 26989902	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	Pubtator	26617860	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ethylmalonic encephalopathy	Ethylmalonic Encephalopathy	BEFREE	31160974		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	11289151, 12873688, 17525260, 17533390		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	12873688		★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	29142473, 33153894	Associate	★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	18852869, 19279689, 20029655, 21701244, 23559847, 25849827		★☆☆☆☆ Found in Text Mining only
Exocrine pancreatic insufficiency	Exocrine pancreatic insufficiency	BEFREE	29984678		★☆☆☆☆ Found in Text Mining only
Exogenous Hyperinsulinism	Exogenous Hyperinsulinism	CTD_human_DG	29035695		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	25363549, 29678603		★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	17032245	Associate	★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	15941417, 17353161, 39234251	Associate	★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	31221509, 31778662		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	31221509, 34287477, 35417091	Stimulate	★☆☆☆☆ Found in Text Mining only
Factor 8 deficiency, acquired	Factor VIII deficiency	BEFREE	30927215		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	17192785		★☆☆☆☆ Found in Text Mining only
Familial cold urticaria	Cold urticaria	BEFREE	17950649, 22714396		★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	16230348, 36553511, 37893484	Associate	★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	22832488	Inhibit	★☆☆☆☆ Found in Text Mining only
Familial Hemiplegic Migraine	Hemiplegic Migraine	BEFREE	23326332		★☆☆☆☆ Found in Text Mining only
Familial Hypophosphatemic Rickets	Hypophosphatemic Rickets	BEFREE	23482605		★☆☆☆☆ Found in Text Mining only
Familial intrahepatic cholestasis of pregnancy	Cholestasis of pregnancy	CTD_human_DG	23627780		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	30848471, 8899002		★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Familial mediterranean fever	Pubtator	14514692, 22593232, 31707933	Associate	★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	20399210, 22243485, 22439934, 31628913		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	11110692, 11500375, 15345282, 19850743, 21912593, 22234699, 22310912, 22482891, 23890415, 8118026		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fanconi Anemia	Fanconi Anemia	LHGDN	12750172, 18055871		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fanconi Anemia	Fanconi anemia	Pubtator	12750172, 20068062, 22310912	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fanconi Anemia	Fanconi anemia	Pubtator	12750172, 18055871, 21912593, 8118026	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fanconi Anemia	Fanconi Anemia	CTD_human_DG	22628295		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	11110692, 11500375, 15345282, 19850743, 21912593, 22234699, 22310912, 22482891, 23890415, 8118026		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP C	Fanconi Anemia	BEFREE	22234699		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	20447453, 30929860, 32328064, 9201656	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	21619669, 37179299, 9874656	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	8568312	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	12032170	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	LHGDN	16564703, 17395331		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	BEFREE	18190648, 19032584, 22327199, 23892696, 23996518, 28111231, 28257781, 28325574, 28882574, 28883393, 29684027, 29981260, 30359672, 30477827, 30705687, 31563650, 31747353		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty liver	Pubtator	20140224, 22327199, 25474087, 27678360, 30345259	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	CTD_human_DG	23348005		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	25474087	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	34440652	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	11732005, 16825325, 16848812, 17395331, 19629467, 22658783, 23009757, 23066023, 24486698, 25534427, 28011152, 28038359, 28063004, 28264426, 28842175, 28852433, 28922680, 29018408, 29154469, 29684027, 29897812, 30125542, 30218679, 30394550, 30675167, 30737662, 30841442, 31028903		★☆☆☆☆ Found in Text Mining only
Fatty Liver, Alcoholic	Alcoholic Fatty Liver	BEFREE	31193303		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Febrile Convulsions	Febrile seizures	BEFREE	19055487, 20486195, 26119396, 29727742, 29729582		★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	17234183	Associate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	15474092, 25398968, 31148852		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	15474092		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	CTD_human_DG	19944662		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	10455154, 10753499, 1450672, 15703873, 1617834, 18547669, 2169729, 2250017, 2324115, 24434512, 29080421, 3137305, 8528939, 9892984		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	11199370, 16698276, 17046548, 18030367, 21523796, 23092863, 24104560, 24400890, 24448807, 25013899, 25467797, 28151059, 29129819, 29174446, 29369172, 29375381, 30735937, 30906791, 31324181, 31502329, 31508820, 31662485, 31847135, 9307079		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	29162878, 29382328		★☆☆☆☆ Found in Text Mining only
Focal Emphysema	Emphysema	CTD_human_DG	25106431		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	15308875, 28629718, 31095586, 31581251		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	12144133		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	28438992		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	36890594	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	21645364		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	9234795	Associate	★☆☆☆☆ Found in Text Mining only
Fulminant Hepatic Failure with Cerebral Edema	Fulminant Hepatic Failure With Cerebral Edema	CTD_human_DG	16338762, 9696492		★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	15565405, 17559370, 1772964, 19189285, 25200905, 27714757, 30622241		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	15313687, 18260730, 19282655, 24676340, 25154789, 27009073, 29844685, 30902881		★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	LHGDN	18260730		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	18260730, 24676340	Associate	★☆☆☆☆ Found in Text Mining only
Gallstones	Gallstones	Pubtator	17148666	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	15112338, 24147811, 28074048, 28378198		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	11781708, 14714609, 17201881, 19276869, 24192345		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric ulcer	Gastric ulcer	CTD_human_DG	15138204		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastritis	Gastritis	Pubtator	12121897, 22714811, 22749770, 25008775, 26504356	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	15201584, 15667484, 17201881, 17667716, 17717744, 19751439, 20438867, 24072494, 26504356, 29250766, 29691371, 29765456, 30382864		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	LHGDN	17717744		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	26088449	Inhibit	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	27196487	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	15112338, 34104107, 35905420, 39259113	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	12891537, 15112338, 16622749, 19427781		★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	30939601		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	10732760	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	29449669, 30744559		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	19322919, 20659236, 29189428, 30011858		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	19322919, 22568453	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Hemorrhage	Gastrointestinal hemorrhage	Pubtator	36820674, 39194098	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal inflammation	Gastrointestinal inflammation	BEFREE	28270854		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	1846553, 23852308	Associate	★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	BEFREE	28327177		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	19375652	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	27409423	Inhibit	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	10400826, 34576075	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gaucher Disease	Gaucher Disease	BEFREE	15919211, 23010424		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gaucher Disease	Gaucher Disease	LHGDN	15919211		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gaucher Disease, Type 1	Gaucher Disease	BEFREE	15919211, 25978039, 27816428		★☆☆☆☆ Found in Text Mining only
Generalized glycogen storage disease of infants	Glycogen Storage Disease	BEFREE	28282939		★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	10519368, 11019918, 12234707, 12691703, 26470763, 29611085, 29852521, 31436328		★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	26662402		★☆☆☆☆ Found in Text Mining only
Geographic Atrophy	Geographic Atrophy	BEFREE	30644965		★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	9716562		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	10943865, 11138328, 12742994, 14679293, 21873264, 29146018, 30877209, 31162032, 9844760		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	10943865, 31162032, 37703805	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	23980866		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	21443923, 25256363, 27886579, 28624893, 31231976, 31243645		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	17953695, 23368949, 27998014, 29635809, 29896253, 30366216, 30536725, 31028890, 31269113, 31704504		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	LHGDN	18454664		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	32130362, 35665507	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	12379221, 15557444, 18852869, 19556827, 20029655, 21575121, 21701244, 23559847, 29285128, 30473883, 30632412, 31093481, 31132515		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	LHGDN	17702576		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	20467456, 21917936	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	36254076	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	22509108, 35052396	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	19556827, 23559847		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	12579167, 16138112, 19556827, 20357201, 21575121, 22509108, 24063017, 30473883, 31131239		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10087955, 10652573, 10674492, 10947938, 12499252, 14641910, 15374943, 16357155, 16871882, 17114809, 17699104, 17928957, 18670452, 18709644, 18794145, 19836430, 19996278, 21697087, 21757445, 21877214, 22266862, 22318540, 22571869, 22591734, 22992678, 23231075, 23699535, 23775076, 23975833, 24164301, 24244348, 25358253, 25677845, 25880091, 26410343, 26794430, 26971226, 27474433, 28135339, 28148846, 28317877, 28351321, 28604685, 29016934, 29453678, 29786075, 29897522, 30425514, 30718520, 30863846, 30867058, 31059805, 31125770, 31363754, 31565489, 31791385, 7566386, 8413882, 8912851		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	14641910, 1937574, 19383369, 1974176, 22396498, 22591734, 23538445, 24901050, 26017671, 28604685, 29016808, 31791385, 32326230, 34290231, 35186504, 35418179, 35851726, 36272241, 36849306, 37158962, 38068712, 7519747, 7531687, 7750120, 7908214	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10087955, 10674492, 10947938, 12499252, 14641910, 15374943, 16357155, 16871882, 17114809, 17699104, 17928957, 18670452, 18709644, 18794145, 19808964, 19836430, 19996278, 20484045, 21697087, 21757445, 21877214, 22266862, 22318540, 22571869, 22591734, 22699883, 22992678, 23231075, 23579274, 23699535, 23775076, 23975833, 24164301, 24244348, 25358253, 25677845, 25880091, 26410343, 26794430, 26971226, 27474433, 28135339, 28148846, 28317877, 28351321, 28604685, 29016934, 29453678, 29786075, 29897522, 30049387, 30341039, 30425514, 30718520, 30863846, 30867058, 31059805, 31125770, 31363754, 31565489, 31616474, 31791385, 7566386, 8413882, 8912851		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10744043, 1282676, 1563013, 16042757, 17011514, 17565690, 18708058, 19383369, 22318540, 23640457, 24787244, 25261660, 28604685, 35418179, 35592520, 35986882, 37052249, 39364412, 7519747, 7521890, 7915264, 8641993, 8910439	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	11751520, 12386831, 15611130, 15844877, 16033134, 16357155, 18341587, 18708058, 18709644, 18802741, 19544410, 19706813, 19861406, 21127499, 21220502, 21368892, 21573233, 22318540, 22964638, 23338605, 23640457, 23975833, 24451124, 24787244, 25622756, 26142735, 27393295, 28103571, 28450947, 29117939, 29486949, 29503195, 30049387, 30145468, 30839135, 30924024, 31599129, 31653130, 31691497, 7915264, 8421207, 8910439		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	LHGDN	12957651		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	21279667, 33227992	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	CTD_human_DG	22199285		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	CTD_human_DG	10910440, 9403216		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	BEFREE	10940893, 15068388, 17173255, 17533006, 21454254, 21637955, 22449555, 22950839, 24449581, 26410531, 28391344, 28469165, 29434693, 30389199, 7778683, 8015639, 8398664, 9669428		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	Pubtator	21454254, 8455368, 9067916	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis IGA	Iga nephropathy	Pubtator	10916103, 11748357, 18256354, 30029622, 31392215, 32791747, 33936064, 35769467, 8301931	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	11849463	Inhibit	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	18256312, 18496506, 20484297, 40322064	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	17213876, 34289975, 7543624, 7778683, 9551397	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	16025396, 20962742		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	28629718	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	31095586, 31581251	Stimulate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	30738043, 36139147	Associate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	31059804, 31316402		★☆☆☆☆ Found in Text Mining only
Glucocorticoid-remediable aldosteronism	Hyperaldosteronism	BEFREE	31050580		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	21060270, 28282939		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	25561807	Stimulate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	33416081	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	38051374	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	BEFREE	17631734		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	Pubtator	27169898, 35378210, 36550178	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft vs Host Disease	Graft-versus-host disease	Pubtator	10556195, 10572111, 11520812, 11532353, 15284108, 18021367, 19392797, 20100586, 29142307, 30349527, 32183881, 8496391	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	14993881, 20446793, 30142416, 35114361, 35486633	Stimulate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	10029618, 10572111, 11979305, 12393418, 12734353, 12756021, 15084940, 15449032, 18021367, 20397074, 21091241, 22469882, 22469883, 22982856, 25205119, 26012567, 26872287, 29101827, 29263228, 29296530, 29541073, 29593717, 30723481, 31051404, 31846439, 8136279, 9808588		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	LHGDN	11979305		★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	18455351		★☆☆☆☆ Found in Text Mining only
Granulomatosis	Granulomatosis	BEFREE	29644062		★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	10685804, 21553055, 31610684		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	11982607	Stimulate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	12000723, 15708894	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	11411907, 12000723, 17111046, 21058909, 23527726, 38309375	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	10848881, 11678832, 11820636, 15057268, 15219383, 15236755, 16313297, 17348243, 18472000, 18571427, 18989801, 19250279, 19732761, 23544060, 23638863, 24956560, 25127106, 25226272, 27929668, 29401539, 29440561, 29526119, 29847668, 31328557, 8421109, 8697623, 9174153		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	17032245, 17348243, 25226272	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	18369459, 19250279, 23544060, 25127106, 29526119, 7902787	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves Disease	GWASDB_DG	21900946		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	8697623	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	28119492, 29847668, 33542676, 36056316	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	30576385	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Growth Disorders	Growth disorder	Pubtator	31482782	Associate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	10405195, 17483581, 17761309, 18717726, 20600447, 21604171, 22236374, 24028188, 25954926, 27817222, 28147379, 28320438, 28778444, 28916318, 29153605, 31379477, 9818939		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	LHGDN	18717726		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	10405195, 28147379		★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	11755467, 1588375, 2114936, 2258703, 7845033, 8043432, 8840984, 9136953		★☆☆☆☆ Found in Text Mining only
Hajdu-Cheney Syndrome	Hajdu-Cheney Syndrome	BEFREE	31371452		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	11196710, 27466172, 28481651, 28731213, 28747340, 28879509, 29293965, 29991880, 30445421, 31011260, 31057027, 31415355		★☆☆☆☆ Found in Text Mining only
Hamman-Rich syndrome	Hamman-Rich syndrome	BEFREE	10934117		★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	28946816, 31315247		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	15236755, 19250279, 22366404, 25127106, 28198447, 28827034, 29434699, 29526119, 30399324		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	17115419, 19250279, 25127106, 29526119	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	19250279, 39913970, 8697623	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	17560079, 21933882, 26718429, 28640146, 30484735, 31076897, 9583800		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	17560079		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	21933882, 29802455, 31076897, 38376273	Associate	★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	32534515	Stimulate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	26392121, 28501927, 34758154	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	19833626, 28501927	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	32553077	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Block	Heart Block	LHGDN	12960355		★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	18274638	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	11796554, 15218506, 1928295, 24091885, 33060583, 34638889, 34867992, 36012347	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	15681825, 15840906, 27733811	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	16414985, 20007453, 26112171, 26195802, 27128104, 28352306, 28889349, 31324728, 31833408, 9577949		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	LHGDN	18274638		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	31524235	Inhibit	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	10329082, 10358791, 10430608, 11082413, 11309526, 11568062, 11789791, 11796554, 12411982, 15189946, 15867183, 15958363, 17116693, 18450464, 20571888, 21153921, 21503626, 22921902, 27409295, 28105731, 28367848, 28417241, 28515118, 28710070, 28722106, 28763371, 28925471, 29104628, 29175266, 29613828, 29895751, 30259192, 30476367, 30556887, 30586716, 30709867, 30744018, 30856027, 30958967, 31087601, 31154904, 31275453, 31501486, 8640999, 9577949, 9799654		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	10614840, 14973143, 22615818, 22790687, 24074138, 30968846, 34456907, 34744513	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	11796554, 14607202, 15556048, 15956282, 16427798, 17503796, 18353715, 22811738, 22921902, 31104495, 32844595, 33969695, 34787869, 35669500, 35775773, 36012347, 8609343	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	LHGDN	12133434, 14685701, 18068948		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	12388275	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	15135663, 15231041, 17337591, 18034274, 29959987		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Diastolic	Heart Failure	BEFREE	21263314, 28827564		★☆☆☆☆ Found in Text Mining only
Heart Failure, Right-Sided	Heart Failure	BEFREE	10899097		★☆☆☆☆ Found in Text Mining only
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	15135663, 15231041, 17337591, 18034274, 29959987		★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	35909487	Associate	★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	BEFREE	20093488, 26195802, 26321488, 30107066		★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	19040616, 29653899	Associate	★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	19169931	Stimulate	★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	18396154, 29321548, 9616877		★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	31242765		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	31851092		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	27421001	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	LHGDN	15273737		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	15289017, 18043245, 18203008, 25750171, 28716814, 8417962, 9136948		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	22310912	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	30997931		★☆☆☆☆ Found in Text Mining only
Hematoma	Hematoma	Pubtator	28282868, 37038178	Associate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	10188109, 11389006	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemochromatosis	Hemochromatosis	BEFREE	12940442, 1558977, 16793930, 20178892, 30660761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemochromatosis	Hemochromatosis	Pubtator	1558977	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemochromatosis	Hemochromatosis	CTD_human_DG	16793930		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	12940442, 1558977, 16793930, 20178892		★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	1911345	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	1333300, 17063173, 1911345, 21403867	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	25174507, 31924826, 40108621, 9767525	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	CTD_human_DG	15384034		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	21969092		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemophagocytic Syndrome	Hemophagocytic Syndrome	BEFREE	12607539		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	16926287, 20846164, 29550477, 30650445, 31261789		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	16926287, 21362111, 30650445	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	16926287, 29550477, 30650445		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	20534169, 28651907, 8342597	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	29567026	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	36941081	Inhibit	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Fever Crimean	Hemorrhagic fever crimean	Pubtator	27304063	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Fever with Renal Syndrome	Hemorrhagic fever with renal syndrome	Pubtator	31340562	Associate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	15257453, 22571267, 26547206, 31684904		★☆☆☆☆ Found in Text Mining only
Hepatic Coma	Hepatic Coma	CTD_human_DG	16338762, 9696492		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	CTD_human_DG	16338762, 9696492		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	21940902, 36293192	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	30134917		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatic Form of Wilson Disease	Hepatolenticular degeneration	CTD_human_DG	25002079		★☆☆☆☆ Found in Text Mining only
Hepatic Stupor	Hepatic Stupor	CTD_human_DG	16338762, 9696492		★☆☆☆☆ Found in Text Mining only
Hepatic Veno-Occlusive Disease	Hepatic veno-occlusive disease-immunodeficiency syndrome	BEFREE	8136279		★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	25149528	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	31158952	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	28257599, 31191516	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	37102762	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	12970895, 29682590, 31106596	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B	Hepatitis b	Pubtator	15188512, 16127755, 19470388, 22695741, 23395388, 27509979, 31441603, 32532356, 37585994, 9238048, 9528902	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B	Hepatitis b	Pubtator	24025329	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B Chronic	Hepatitis b	Pubtator	15188512, 22086795, 22147985, 22695741, 24520324, 31441603, 32664850, 9528902	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	26416327	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	16610058, 22200181, 25022296, 27678360, 28456632, 32532356, 8591843	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	17131467, 20483710, 23109461, 26023919, 31279905	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	14960532, 16425360, 18063307, 27175704, 27644640, 32050950, 32532356	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	8591843, 9626579	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	11944906, 1700483, 17498300, 17925029, 18752326, 22098164, 2555296, 31511432, 7657294		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	17570844	Associate	★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	20942594, 22139496		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatolenticular Degeneration	Hepatolenticular Degeneration	CTD_human_DG	25002079		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	18407820	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Autoinflammatory Diseases	Autoinflammatory Disease	BEFREE	19877056, 28942479		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	16984377, 17234183, 22228181, 26112140, 29636110	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	15201584, 1733439		★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	29795355		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	11389006, 1558977, 16793930, 24724627		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	CTD_human_DG	16793930		★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	29040306, 7595196		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	28810614, 30625342		★☆☆☆☆ Found in Text Mining only
Hereditary spherocytosis	Hereditary Spherocytosis	BEFREE	31076457		★☆☆☆☆ Found in Text Mining only
Hermanski-Pudlak Syndrome	Hermansky-Pudlak Syndrome	BEFREE	31441797		★☆☆☆☆ Found in Text Mining only
Hibernation, Myocardial	Hibernation, Myocardial	CTD_human_DG	11927517		★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	23106544, 26091259, 26422515, 28066879, 28256718, 28652108, 28656364, 29325465, 29405257, 29751976, 29878616, 30136871, 30140888, 30619323, 30657173, 30732563, 30854183, 30893386, 31191873, 31237104, 31282051, 31422449, 31519056, 31674740		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	31475008, 39199380	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytosis haematophagic	Histiocytosis Haematophagic	BEFREE	28719435		★☆☆☆☆ Found in Text Mining only
Histiocytosis with joint contractures and sensorineural deafness	Histiocytosis With Joint Contractures And Sensorineural Deafness	BEFREE	29079714		★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	LHGDN	12794527		★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	30468406, 9355965		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10050718, 10953976, 11092613, 11110706, 11418184, 12014672, 12030733, 1312061, 15670287, 17087739, 17261581, 17496310, 19131627, 21439852, 21631181, 2386200, 24033107, 24857911, 27943169, 28993768, 30065253, 30857150, 30952099, 31616638, 8217820, 8391931, 9885224		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	1605306, 1632458, 17496310, 2386200, 24008079, 24141626, 2801887, 30065253, 33684151	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	17496310		★☆☆☆☆ Found in Text Mining only
Humoral hypercalcemia of malignancy (disorder)	Humoral Hypercalcemia Of Malignancy	BEFREE	9242449		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	15670287, 21439852, 21631181, 24360910, 27943169, 31076648, 31188027		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	37674148	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyalinosis, Systemic	Hyalinosis	BEFREE	30612530, 30684712		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	28716226, 29277532, 29363904		★☆☆☆☆ Found in Text Mining only
Hydrocephalus, Normal Pressure	Hydrocephalus	BEFREE	29363904		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	29043426		★☆☆☆☆ Found in Text Mining only
Hyper-IgM Immunodeficiency Syndrome, Type 1	Hyper-IgM Immunodeficiency Syndrome	BEFREE	12823286		★☆☆☆☆ Found in Text Mining only
HYPER-IgM IMMUNODEFICIENCY, X-LINKED, WITH ECTODERMAL DYSPLASIA, HYPOHIDROTIC	Hyper-IgM immunodeficiency, X-linked, with hypohidrotic ectodermal dysplasia	BEFREE	11224521		★☆☆☆☆ Found in Text Mining only
Hyper-Immunoglobulin E Syndrome, Autosomal Dominant	STAT3 Deficiency	BEFREE	30035749		★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	33316770, 39252231	Associate	★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	11502808, 12161545, 23975191, 25083576, 30975191	Associate	★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	12161545, 24512496, 25083576, 30442458, 30975191		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	CTD_human_DG	10379864		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercalcemia	Hypercalcemia	CTD_human_DG	10638776		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercalcemia	Hypercalcemia	BEFREE	20050882, 2917519		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia	Hypercholesterolemia	BEFREE	25433555, 28382073, 28915536, 29081697, 29522534, 29713239, 30900815, 31479774		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	21040915, 22891927, 23131422		★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	BEFREE	31049005, 31581545		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	1972179, 8514874	Associate	★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	BEFREE	1376041		★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	Pubtator	1985116	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	10837498, 16370555, 17883332, 20145925, 20442402, 20696134, 21616679, 22500980, 24058525, 25003704, 26455386, 28161055, 28291973, 28753251, 28759152, 29195627, 29309791, 29402837, 29635231, 29675435, 29747815, 30054947, 30097812, 30365082, 30700738, 30897968, 31006095, 31165005, 31185481, 31346222, 31415598, 31421247, 31713299		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	10837498, 26997759, 32454945	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	LHGDN	17707405, 18608123		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	19262007, 20592773, 22266116, 22500980, 25888955, 25894202, 34493360	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	CTD_human_DG	12615666		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	19858416, 23107763, 29797117, 31146011		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperimmunoglobulinemia D	Hyperimmunoglobulinemia	BEFREE	12452839, 13130485, 16234278, 17950649, 19877056		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	10050654, 10320052, 12855762, 21852675, 22442376, 27777170, 27798951, 28485095, 28852804, 29500363, 31397188		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	Pubtator	12855762, 7738205	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	Pubtator	14532168, 23484124	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	LHGDN	17541791		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	CTD_human_DG	29035695		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia	Hyperlipidemia	BEFREE	11032739, 17043800, 17823444, 19926874, 25384966, 25712206, 28143622, 29372034, 29409499, 29787756, 29857297, 30020508, 30177636, 30944794		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia Familial Combined	Hyperlipidemia	Pubtator	12032168	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	10403784, 12032168, 16054550		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	17823444, 19249901, 23789212, 30020508	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type I	Hyperlipoproteinemia	BEFREE	29371243		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	16083882	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	16549444	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	17287608, 21040915, 23131422		★☆☆☆☆ Found in Text Mining only
Hyperoxaluria	Hyperoxaluria	BEFREE	27612997		★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	10070569	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	10666108, 14617515, 31411059	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	9529979	Associate	★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	BEFREE	20808842		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	29056164		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	12528110, 28851954, 33995367	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	24716596, 30303512, 9407493	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperprolactinemia	BEFREE	28763467		★☆☆☆☆ Found in Text Mining only
Hypersensitivity	Hypersensitivity	Pubtator	31577850	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypersensitivity Delayed	Hypersensitivity	Pubtator	1458689, 27383320	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	17346438, 21465273, 22493072, 25973747, 26198819, 26782547, 28033321, 28233393, 29940585, 30957546, 37782172	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	21558084, 33652665, 37838749	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Portal	Portal hypertension	Pubtator	24705150	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	31703702	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension, Renovascular	Hypertension	BEFREE	29590257, 31114507		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	10904006, 10942422, 11357933, 12009575, 12654703, 15808915, 16202847, 16421346, 16918352, 17346438, 17708628, 18981324, 19282863, 19557004, 20836698, 21616679, 22493072, 22813949, 23071256, 23590298, 24170558, 24877626, 27226618, 27903516, 28103274, 28233393, 28419227, 28595524, 28637815, 28724611, 28915536, 29081697, 29351002, 29473098, 29590257, 29668324, 29687969, 29843153, 30072126, 30186428, 30279269, 30344654, 30358805, 30359461, 30610955, 30686655, 30957546, 31042407, 31063551, 31114507, 31145298, 31427987, 31485188, 31646585, 31746626, 31756325, 31781724, 31786977, 31823500		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	17708628, 18093792		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	18605955, 27292124, 27659729, 27847271		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	27692815		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	23716650		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	19249901	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	2695592	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	11113012, 20624503, 29218105, 30186311		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30186311		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	31108390, 34854353	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	33995367	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	33879070	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	12654703, 15059615, 28901421, 29518608, 30544373		★☆☆☆☆ Found in Text Mining only
Hypoadiponectinemia	Hypoadiponectinemia	BEFREE	18565022		★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	BEFREE	15758650, 29259376, 31193303		★☆☆☆☆ Found in Text Mining only
Hypobetalipoproteinemia Familial Apolipoprotein B	Hypoalphalipoproteinemia	Pubtator	16936264	Associate	★☆☆☆☆ Found in Text Mining only
Hypocalciuric hypercalcemia familial type 1	Hypocalciuric hypercalcemia	Pubtator	38088554	Associate	★☆☆☆☆ Found in Text Mining only
Hypocalciuric hypercalcemia, familial, type 1	Hypocalciuric Hypercalcemia	BEFREE	11389006		★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	11278795		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	27456841, 36499023	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoglycemia	Hypoglycemia	BEFREE	29805094		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoglycemia	Hypoglycemia	CTD_human_DG	8774068		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	30188378		★☆☆☆☆ Found in Text Mining only
Hypoplastic enamel-onycholysis-hypohidrosis syndrome	Hypoplastic Enamel-Onycholysis-Hypohidrosis Syndrome	BEFREE	28754973		★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	10498591, 22080961	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothyroidism	Hypothyroidism	Pubtator	12799216	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothyroidism	Hypothyroidism	Pubtator	1600267, 31560937, 39185088	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothyroidism	Hypothyroidism	BEFREE	23716650, 29436670, 29579409, 30927245, 31350776		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothyroidism	Hypothyroidism	Pubtator	31350776	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	10383461, 11023511, 12874281, 14982858, 16014034, 17114296, 17456758, 21535870, 22863020, 22866899, 24270813, 24659848, 24933425, 26974319, 27408996, 28677369, 29949169, 30463908, 30659163, 30704983, 31746371, 33136275, 33389556, 34240756, 34456926, 38285930, 8901607	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12829075, 21787418, 22005158, 26045843, 27558590, 27792771, 31935962, 32028672, 34526760, 35874989, 37246768, 40513998	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	1373333, 30459756, 32665623, 7528138	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia-Ischemia, Brain	Ischemic Encephalopathy	LHGDN	16181755		★☆☆☆☆ Found in Text Mining only
Ichthyoses	Ichthyosis	BEFREE	27554821		★☆☆☆☆ Found in Text Mining only
Ichthyosis	Ichthyosis	Pubtator	27554821, 29803800	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Ichthyosis Bullosa Of Siemens	BEFREE	22684480, 29201045		★☆☆☆☆ Found in Text Mining only
Ichthyosis linearis circumflexa	Netherton syndrome	BEFREE	27554821		★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	12149303, 12763223, 20406839, 28658584		★☆☆☆☆ Found in Text Mining only
Idiopathic achalasia of esophagus	Idiopathic achalasia	BEFREE	24259423		★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	11092196, 15338498, 17586554, 22210660, 27936488		★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	17213876		★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	29190601, 7705373		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	23071256, 24270264, 28084316, 28292027, 28597756, 28776404, 29528272, 29540357, 30367500, 30409216, 30856466, 31023308, 31440380, 31692724, 31734320		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	10188109, 11282543, 15809201, 22037258, 26709222, 28314802, 28629363, 32213567, 37817229, 8362967	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	10934117, 11282543, 15030461, 15863652, 16573560, 17205112, 19117745, 21144722, 26709222, 26867691, 28178340, 28629363, 29727583, 30091381, 31611754, 8362967, 8473757, 9512902		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	36791050	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	24403074		★☆☆☆☆ Found in Text Mining only
IgA Deficiency	Selective immunoglobulin a deficiency	Pubtator	9508785	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	10916103, 11748357, 11849463, 12480958, 12637641, 14631563, 17988266, 18685143, 25770168, 28260100, 28349446, 28389814, 30428849, 30704417, 30880546, 30936328, 31392215, 9730085		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	18300111		★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	CTD_human_DG	10700533, 21829567		★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	20664576, 21327025, 23977323, 25637591, 27049060, 28472424, 28981653, 30295722		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	11009084, 1893618, 20722464, 21402907, 23493554, 23943614, 33704915, 8096802	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	11163083, 11324946, 15086336, 21402907, 23113841, 24958847, 26547206, 28038706, 28372498, 29610439, 30639220		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	16480433, 19499314, 21756542, 24509339, 25158149, 25806576, 26761582, 27007229, 27329949, 27960071, 29020887, 29971001, 30499734, 31014934		★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	BEFREE	10852388, 9508785		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10092095, 10194069, 10786999, 11146046, 11568004, 12860289, 16379012, 18234797, 22553338, 23493554, 23867674, 24130499, 25677845, 26776123, 26986868, 29538651, 29942298, 30118537, 30468733, 30480508, 30735676, 8498837		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	11517430, 22632257, 25542735, 27633985, 27697064, 27701469, 27788929, 27991935, 28157092, 28416092, 29306772, 29325450, 29521253, 29552684, 29633506, 29853963, 29867440, 29896269, 29969604, 30026058, 30150062, 30193769, 30256904, 30348620, 30586550, 30593843, 30855153, 31030091, 31158431, 31304907, 31381975, 31835282		★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	29238334		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	23209346, 29771400	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Female	Female infertility	Pubtator	36608061	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	26612435	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	12198697, 27775458, 27874029, 27896636, 29199855, 30862619		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10053016, 10450517, 10563674, 10577918, 11804840, 11904678, 12019209, 12198697, 12421092, 12428072, 12486099, 12508119, 12710125, 12811429, 12912861, 14678276, 15223609, 15790356, 1587185, 16299031, 16534418, 16611251, 16635910, 16638698, 16707968, 16714253, 16863613, 17207256, 17255827, 17565649, 17589947, 17661913, 18340362, 18698679, 19082505, 19230040, 19710421, 19786766, 19897967, 20100080, 20155851, 20177070, 20187130, 20693892, 20848487, 20943999, 21135124, 21248737, 21334981, 21640926, 21651357, 21994466, 22044414, 22044934, 22650374, 22913378, 22960943, 23103332, 23211301, 23250276, 23274341, 23414308, 23429464, 23448791, 23590430, 23723167, 23946436, 23949620, 24120915, 24192118, 24552830, 24705148, 24752065, 24769511, 24776844, 24802997, 24850427, 24906181, 25052345, 25105947, 25192497, 25208103, 25386052, 25501099, 25523553, 25544730, 25775453, 25800277, 25918954, 26263469, 26321488, 26422515, 26632999, 26641955, 26752469, 26821681, 26993096, 27197066, 27271497, 27392760, 27466172, 27528546, 27545119, 27562600, 27567553, 27571340, 27603297, 27636407, 27665099, 27723166, 27748629, 27796768, 27806638, 27875356, 27876682, 27879679, 27887202, 27889570, 27914136, 27931132, 27932454, 27958281, 27997433, 28035633, 28038706, 28039805, 28040992, 28084548, 28111380, 28120341, 28124979, 28139755, 28147370, 28165825, 28190384, 28191024, 28210077, 28211161, 28218339, 28221250, 28225051, 28232073, 28238957, 28243990, 28264814, 28265826, 28275260, 28283249, 28318043, 28328760, 28352306, 28365486, 28366760, 28368383, 28373759, 28375885, 28412413, 28417241, 28452812, 28472597, 28477389, 28482085, 28505128, 28523588, 28566881, 28597107, 28605520, 28690543, 28703718, 28711286, 28724302, 28747340, 28756234, 28796256, 28797042, 28816757, 28822915, 28823863, 28826571, 28858070, 28906475, 28934123, 28953529, 28960437, 28961920, 28981653, 29022926, 29052816, 29089374, 29114832, 29156761, 29175527, 29176974, 29197269, 29200737, 29202588, 29204064, 29210147, 29214394, 29224199, 29248493, 29256410, 29269245, 29286110, 29309905, 29333082, 29358708, 29363355, 29367619, 29370397, 29382683, 29383027, 29518097, 29545207, 29555502, 29562275, 29563546, 29579933, 29625582, 29631379, 29655972, 29663266, 29668916, 29673161, 29680064, 29701994, 29726958, 29729311, 29730603, 29736839, 29740202, 29746256, 29751976, 29754190, 29757355, 29763384, 29771301, 29774158, 29788214, 29796912, 29860435, 29860529, 29873318, 29875003, 29876995, 29910080, 29930467, 29973876, 29988118, 30028008, 30135331, 30151084, 30174665, 30175139, 30199539, 30205699, 30209212, 30219028, 30256926, 30286108, 30327532, 30338039, 30390672, 30390972, 30407662, 30426297, 30429108, 30450023, 30452927, 30500868, 30511938, 30521801, 30558178, 30572136, 30595227, 30595666, 30604370, 30615542, 30628109, 30655563, 30685385, 30689765, 30689771, 30694569, 30714345, 30728350, 30729703, 30745872, 30773667, 30810891, 30811631, 30818349, 30860423, 30876964, 30884245, 30884988, 30888405, 30891036, 30917710, 30930775, 30939120, 30941038, 30945576, 30949903, 31034508, 31052214, 31068803, 31093495, 31098835, 31169706, 31169926, 31191873, 31195433, 31206406, 31211836, 31238939, 31252191, 31267570, 31316377, 31323083, 31326413, 31335833, 31340002, 31358760, 31362580, 31382518, 31401142, 31446181, 31450748, 31457011, 31466830, 31488067, 31490707, 31491360, 31494100, 31498280, 31503216, 31504536, 31526845, 31535405, 31536991, 31556231, 31558705, 31567711, 31586441, 31634546, 31639514, 31646743, 31660029, 31672153, 31700633, 31758576, 31772929, 31814801, 7729636, 8608636, 8612993, 8668926, 8913936, 9246063		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	10053016, 10403730, 11804840, 14678276, 14871291, 15223609, 16195422, 16760259, 17589947, 18536746, 18698679, 20014019, 20629103, 21903765, 22937039, 23250276, 24130820, 24705148, 25171510, 25346048, 25377316, 25927528, 26307954, 26417049, 26559252, 26752469, 26806281, 28038706, 28105709, 28388655, 28590340, 29142473, 29182760, 29228965, 29333082, 29367619, 29710331, 30511938, 30533022, 30685385, 30689765, 30818349, 31039157, 31169706, 31326413, 31730855, 31814801, 32020185, 32478906, 32612071, 33114187, 33505153, 33622154, 34021361, 34380996, 35196350, 35383266, 35655783, 35660024, 35908771, 36153599, 36167345, 36361571, 36378498, 36384462, 36634565, 36916302, 37154720, 37314124, 37473877, 37740137, 37773535, 38238335, 38401525	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	12019209, 16611251, 18698679		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	15086448, 27793764		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19664152, 28797042, 30429108, 31034508, 39487408	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	27374101		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	20112373, 22303003, 23643662, 24211183, 26676608, 27586798, 27747869, 29105195, 29171393, 29728512, 30259241, 30321197, 31140657, 31515807, 31775224		★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	28990061		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	11001753, 11287357, 11469400, 12006640, 12032168, 14532168, 15650331, 16132956, 16784178, 17015957, 19633828, 19645041, 21047923, 21057163, 21147642, 21559831, 21846948, 22327199, 22949029, 25083576, 25888955, 26113076, 26352439, 26722602, 27903298, 28993561, 29256014, 29258102, 30635365, 30869115, 31443599, 31659105, 32651353, 34872092, 7738205	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	11342531, 17131467, 17227768, 17551966, 18443205, 19652946, 19769745, 23651848, 29409019, 30863203	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Interstitial Cystitis	Interstitial Cystitis	BEFREE	29137981, 29240250, 29465304		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	17688691, 19305384, 25304312, 26439025, 28586025, 29651107, 29656141, 29941029, 30076336, 30511959, 31056946, 31140325, 31322007, 33660790, 33869626, 34554926, 34805401, 35265264, 35730622, 37222533	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	19435506, 33251629	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	23438440, 25336289, 25476526, 25635047, 25909354, 26200140, 26439025, 26847698, 27207584, 27864283, 28233079, 29115481, 29284457, 29312639, 29319363, 29651107, 29652777, 29992506, 30092407, 30283339, 30511959, 30561076, 31029152, 31322007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	34190406	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral disc disease	Intervertebral disc disease	Pubtator	18302283, 20665551, 31056946, 35960059	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	26774625, 33251629, 40244065	Stimulate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	20665551, 23438440, 26847698, 28498809, 29284457, 29312639, 29652777, 29941029, 29992506, 30945295, 31800975		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Displacement	Intervertebral disc displacement	Pubtator	30511959, 33101543	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disk Displacement	Intervertebral Disk Displacement	BEFREE	11979160		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	10029618, 15274667, 17030185, 28954839, 29588183		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	15654837, 29142307, 8506954	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Obstruction	Intestinal obstruction	Pubtator	35528155	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal polyposis	Pubtator	38297356	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	21228795, 24685329, 26198819, 29027627, 30808715, 31785262		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	26198819, 31545495, 33511216	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	17986934	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Hemorrhages	Intracranial hemorrhage	Pubtator	17986934, 29932521	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Hypertension	Intracranial hypertension	Pubtator	21676422	Stimulate	★☆☆☆☆ Found in Text Mining only
Intracranial Hypertension	Intracranial hypertension	Pubtator	35812382	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	16009345, 28609656, 30139338		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	24489901	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intravascular hemolysis	Intravascular Hemolysis	BEFREE	31099890		★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	BEFREE	18716131		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	16793930, 29135935		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	33969695	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	16279907, 19034965, 19844779, 20337945, 21870243, 22684480, 22897390, 25386052, 25800277, 26180016, 26841770, 27197066, 28221250, 28505128, 28506572, 28796256, 28961920, 28981653, 29201045, 30256926, 30578560, 30657572, 30773667, 30842618, 31172560, 31340002, 31366385, 31498280, 31613423, 31615448		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	17170025, 24206549, 25927528	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	24667736, 34115808	Stimulate	★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	12356382, 15769906		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	11737243, 15036607, 16324093, 17452160, 19168815, 20493182, 20798494, 21219546, 22937788, 22986613, 23050663, 24817293, 25482248, 26231680, 26592822, 26856463, 27586239, 27809599, 28357403, 28382306, 29075930, 30171409, 30378715, 30484473, 30588195, 31221990, 31454695		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	23742289, 24817293, 33616302, 34921461, 34970793	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	30588195, 39394477	Stimulate	★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	31589938		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	11886974, 11975986, 16393767, 16467041, 16539828, 16951943, 17324969, 19208590, 20191493, 20596903, 21205466, 21996051, 22696185, 24000795, 24069456, 24112428, 25057181, 25837015, 26477692, 26934060, 27390133, 27562034, 27753221, 27849614, 28223750, 28593608, 28597133, 29138257, 29160524, 29214394, 30185135, 30412082, 30430682, 30663847, 31240749, 31335941, 31646743, 31823144, 7495783		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	LHGDN	11975986		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	12010819, 8417962, 9834232		★☆☆☆☆ Found in Text Mining only
Juvenile polyposis syndrome	Polyposis Syndrome	BEFREE	22568934		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	BEFREE	12483736		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	11001912, 25182322, 31733080, 9456251		★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	22431252, 24037056		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	17254567, 31067300, 31131227		★☆☆☆☆ Found in Text Mining only
Keratitis Herpetic	Herpetic keratitis	Pubtator	32867704	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	BEFREE	25613942, 29287776, 29369172, 29634381, 31430719		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	19304583, 22413749, 27207902	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	28702675		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	29021606	Stimulate	★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	19136037		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	11110706, 15291361, 16293872, 17261581, 17308066, 19131627, 20393185, 23028875		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	27612997		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	14613268, 16141456, 20962742, 22950839, 23796916, 25589331, 25736140, 26421528, 27353019, 27692815, 27838362, 27966776, 28300543, 28391344, 28683439, 29387201, 29605608, 30301439, 30389199, 31167971, 31527864, 31813103, 9085256, 9543565		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	14613268, 23796916, 24610932, 29555686, 31871930, 32684830, 33969695, 34045516, 34501555, 37859695, 37965310, 8455368	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	17541791, 18547996		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	34359843, 39476943	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	12036890, 16174285, 17173255, 17705580, 22813949, 30811871, 30826567, 31637265		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	12846752, 15600254, 27000486, 28651949	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	19684120, 29868028, 34045516	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	31875015	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	12215823, 15036247, 15627170, 23566289, 23607333, 23796916, 24059882, 26824356, 27788614, 28063928, 28410274, 28688148, 28821332, 28821873, 28840836, 29070568, 29357415, 29520166, 29805315, 29978383, 30027474, 30077612, 30392071, 30973904, 31217925, 31497913		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	16595132, 18460982, 20623750		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	11979341, 15068388, 15600254, 15717635, 16076356, 16545788, 17173255, 17705580, 19497039, 19539174, 22069557, 23777202, 25589331, 26421528, 28036114, 28256549, 28352125, 28765904, 28834898, 30152254, 31011203, 31101015, 31153055, 8015639		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	LHGDN	15068388, 15086488, 16545788, 17705580		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	19539174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasm	Kidney Neoplasm	LHGDN	18294286		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	18294286, 26500094, 29607933	Associate	★☆☆☆☆ Found in Text Mining only
Lambert-Eaton Myasthenic Syndrome	Lambert-Eaton Myasthenic Syndrome	BEFREE	12864989		★☆☆☆☆ Found in Text Mining only
Lambert-Eaton Myasthenic Syndrome	Lambert-Eaton Myasthenic Syndrome	LHGDN	12864989		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	23593411, 25605161		★☆☆☆☆ Found in Text Mining only
LATE-ONSET RETINAL DEGENERATION (disorder)	RETINAL DEGENERATION	BEFREE	20554618, 25814825		★☆☆☆☆ Found in Text Mining only
LAURIN-SANDROW SYNDROME	Laurin-Sandrow syndrome	BEFREE	29602073		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	11113012, 21740805, 28548091, 30287055		★☆☆☆☆ Found in Text Mining only
Left ventricular systolic dysfunction	Ventricular Systolic Dysfunction	BEFREE	21811191		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	15135663, 15231041, 17337591, 18034274, 29959987		★☆☆☆☆ Found in Text Mining only
Legg-Calve-Perthes Disease	Legg-Calve-Perthes Disease	BEFREE	28174772		★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh Syndrome	BEFREE	31813248		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	15193492, 15474092, 21138652, 22096007, 32372565, 36591830, 36771423	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	29809057	Stimulate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	37175660	Associate	★☆☆☆☆ Found in Text Mining only
Leishmaniasis	Leishmaniasis	Pubtator	30108591, 31469834, 9096369	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leishmaniasis Cutaneous	Leishmaniasis	Pubtator	15716079, 31469834, 32766167, 7595196	Associate	★☆☆☆☆ Found in Text Mining only
Leishmaniasis Mucocutaneous	Leishmaniasis	Pubtator	31469834, 7595196	Associate	★☆☆☆☆ Found in Text Mining only
Leishmaniasis Visceral	Visceral leishmaniasis	Pubtator	31469834	Associate	★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	Leopard syndrome	Pubtator	31112872	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	10540222, 19058987, 20640364, 20650301, 21925494, 25992795, 30652669, 32372760, 32433683, 9486396, 9822276	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy	Leprosy	BEFREE	12595904, 17868246, 19058987, 20650301, 21917899, 22071774, 23240095, 24189521, 24578538, 25636570, 26431782, 26829382, 28935761, 30442123		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy	Leprosy	LHGDN	17624216		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy	Leprosy	Pubtator	24578538	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy Lepromatous	Leprosy	Pubtator	10540222, 19058987, 20650301	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	26362198	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10029601, 10318796, 10783388, 11264180, 11880365, 12149200, 12586626, 1370201, 15196924, 15922966, 16020509, 17673311, 18807213, 19759901, 20105430, 2018837, 21820422, 22028622, 2435341, 27907031, 2823943, 35967339, 7994039, 8286744, 8805932, 9116291	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10416602, 10528229, 12380901, 15196924, 15515013, 1699775, 17511776, 18205178, 18952893, 19619938, 20307689, 21875833, 22232214, 22627572, 22705645, 22762939, 22830613, 23071570, 23288922, 24304929, 24488173, 26224647, 26255115, 26260845, 26516703, 26984209, 27411587, 27647233, 27748372, 27833035, 2783672, 2790197, 28453871, 29326123, 29803792, 30092310, 8043432, 9116291		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15152368, 15515013		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	3474039	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	2114936, 8227350, 9136953	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	2258703	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Lymphoid leukemia	Pubtator	1511460	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	15922966, 1688503, 18838202, 2022746, 2062856, 24307172, 2435341, 2537112, 8353281, 9565575	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	2823943	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10477734, 10812243, 12586626, 1381241, 1382704, 15922966, 1695108, 1714325, 18202225, 1825289, 21307400, 21520003, 23616009, 25795133, 26081440, 26365931, 26516703, 2664067, 27385100, 27748372, 29908545, 31263060, 31373163, 32995942, 33284559, 33985510, 34459452, 34504191, 35490594, 36418348, 37400761, 7522632, 8805932, 9593784, 9716596	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	1705566	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29922294	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	10554809, 31648319	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	30026572	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	10749583, 12010819, 8839857, 9185524, 9834232	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	15256426, 18039708, 28343272, 30237268, 3166411, 8193361	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	1327287		★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	29040306, 7595196		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11549518, 12028020, 12423681, 1381241, 1434798, 14984494, 15922966, 1705566, 17258890, 18187663, 18202225, 19117987, 1961022, 20332229, 2062856, 21307400, 21911919, 2197515, 2207323, 23380816, 2359342, 24842373, 25860293, 2642577, 26516703, 27096305, 27486989, 27748372, 27869161, 28031480, 28039479, 29346508, 29922294, 30013668, 30181021, 30500073, 30828789, 31090655, 31373163, 8319777, 8412318, 8907269, 9116291		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12031914, 16203766		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	31648319, 8417962		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	16928387		★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	BEFREE	21527907, 23063716		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	18490455, 25248876, 27402913		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	26372424		★☆☆☆☆ Found in Text Mining only
Leukostasis	Leukostasis	BEFREE	26527057, 27474370, 28274631, 31434194		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	18186919	Associate	★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	28348546		★☆☆☆☆ Found in Text Mining only
Lhermitte-Duclos disease	Lhermitte-Duclos disease	BEFREE	26261645		★☆☆☆☆ Found in Text Mining only
Lichenoid Eruptions	Lichenoid Eruptions	BEFREE	30971924		★☆☆☆☆ Found in Text Mining only
Limb-girdle muscular dystrophy type 2H	Sarcotubular myopathy	BEFREE	16816390		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	29135875		★☆☆☆☆ Found in Text Mining only
Linear Scleroderma	Linear Scleroderma	CTD_human_DG	9843018		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	11808761, 11827262, 15799583, 17592646, 18206417, 19528505, 21497332, 24460282, 25721693, 27312561, 28107185, 28397778, 28708091, 28885456, 30393585		★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	15809899, 29909063		★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	BEFREE	15809899		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	12370499, 15809899, 18430964, 20518840, 20854131, 21595566, 24583153, 25439236		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	LHGDN	12370499, 16423623		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	Pubtator	18430964	Associate	★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	12032170	Stimulate	★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	11278855	Stimulate	★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	31126284		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11059688, 11749866, 11916626, 14991932, 15280623, 15585621, 15849810, 15910501, 16103092, 16237754, 16425355, 16583461, 16627981, 16820920, 17700059, 18030367, 18070287, 18243134, 18603357, 18980244, 19272388, 19376776, 19683483, 19780956, 19795387, 19910749, 20014456, 20515870, 20819413, 20953524, 21107607, 21304407, 21319995, 21336601, 21401328, 21413021, 21469143, 21558328, 2156928, 21660448, 21928250, 21979578, 22200181, 22200406, 22330637, 22354988, 22361279, 22406869, 22530834, 22682513, 22843047, 22911714, 22922789, 22998440, 23141142, 23213087, 23299796, 23440427, 23464434, 23632060, 23751896, 23803115, 23811755, 23972653, 24066693, 24101445, 24409077, 24721706, 24751829, 24768182, 25319734, 25333816, 25339267, 25420786, 25447820, 25556449, 25774942, 25941903, 25982858, 26045814, 26221053, 26323317, 26348206, 26408704, 26587975, 26672513, 26683365, 26890368, 26933995, 27121136, 27154307, 27177758, 27509979, 27739418, 27858866, 28054958, 28063004, 28115787, 28138696, 28315997, 28367089, 28456632, 28579529, 28844984, 28865603, 28975649, 29090321, 29242605, 29444104, 29506556, 29615720, 29720829, 29940792, 29976395, 29981431, 30051596, 30116311, 30138716, 30145359, 30149917, 30178114, 30204505, 30415242, 30591653, 30594557, 30602571, 30712649, 30782845, 30809789, 30810331, 30824840, 30828998, 30844387, 31048666, 31065105, 31186704, 31268657, 31385458, 31448426, 31656043, 31710117, 31781194, 31807025, 9446586, 9594023		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18070287		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	27022031		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11196686, 11389006, 12717381, 12834858, 16340448, 18336639, 19018026, 21229279, 21319995, 22095602, 22200181, 22330637, 22682513, 23840511, 24043211, 24751829, 24953022, 25013899, 25319734, 25556449, 26725065, 27451931, 28614777, 30070728, 30204505, 31486016, 31572482		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	12801966, 18030367, 21212030, 22200181, 22695741, 23840511, 25467797, 27175704, 28865603, 31102558, 31847135, 31926856, 33291080, 36246566, 37995395	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	17036394	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	19278365	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	17158635, 20578265, 23000144, 23392275, 28922472, 33512089, 33815355, 34367180, 9014820, 9932110	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	1772964	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	27668889, 31867004, 33512089, 36982376, 38228248	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	10673067, 16340448, 19278365, 2010162, 7876633		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	CTD_human_DG	23274713		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases	Liver disease	Pubtator	11244168, 16425355, 1900574, 22330637, 23343370, 23967134, 27678360, 30133944, 39173437, 7509363	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases	Liver disease	Pubtator	1772964	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases	Liver disease	Pubtator	29969462	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases Alcoholic	Liver disease	Pubtator	15623531, 24224954, 38146363	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	12393901, 20537485, 27678360, 29229400, 31441603, 34971708, 37175814	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	26016454, 28542386, 29174983, 29789597, 29944201, 30206980, 31676378		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	33356606	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	35164651	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	1772964	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	29229400	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	10930380, 11689884, 18957043, 19390969, 20492508, 23202732, 26016454, 26481639, 26986512, 28628850, 29191769, 29357415, 29564668, 29855002, 29991758, 30134917, 31030090, 31032922, 31037135, 31061003, 31230087, 31545489, 9696492		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure, Acute	Liver failure	LHGDN	15968724		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure, Acute	Liver failure	CTD_human_DG	19505222		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	BEFREE	15910501, 16237754, 16820920, 21558328, 2156928, 22530834, 22911714, 22998440, 23299796, 23811755, 25774942, 28456632, 30602571, 9446586, 9594023		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Neoplasms	Liver neoplasm	Pubtator	1847844, 26301107, 27487029	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Neoplasms	Liver neoplasm	Pubtator	20433827	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	CTD_human_DG	24183702		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Localized scleroderma	Scleroderma	BEFREE	30268392		★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	CTD_human_DG	9843018		★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	23559847, 29775216		★☆☆☆☆ Found in Text Mining only
Luft Disease	Luft Disease	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Lumbar disc disease	Lumbar Disc Disease	BEFREE	26261645		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	CTD_human_DG	11472967		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	12176706, 12566517, 19009622, 20486865, 22660986, 24062613, 28642115, 28836545, 29233668, 30057321, 31085455		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	12566517, 15809210, 17306937, 19292764, 19835594, 24024324, 24553063, 26165383, 35680011, 38287362, 39249157, 9988757	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	25748325, 36480571	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	28169347	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases Interstitial	Lung disease	Pubtator	20404807, 33139675, 34001401, 37561311, 37817229	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	15338498, 21144722, 29320550, 31308625, 31318607, 31659014, 31777548		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	17509552, 28670246		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10945495, 12540537, 1299622, 1337797, 15527763, 18286287, 19448410, 22675434, 23437179, 24024324, 24113849, 24894428, 25268596, 25548907, 25897826, 26464679, 28099148, 28272488, 28446126, 32930123, 36035842, 37092550, 37307368, 38051374, 8144399, 8283917, 9353425	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	14587096, 22369883		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	16276011, 16476505, 16596276, 16757480, 17654453, 18286287		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	27611979, 28629997, 29348400		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	31552680, 32805626, 35184748	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	10940893, 1503608, 15565953, 18200501, 18759295, 20434119, 21907587, 22389764, 22890025, 24449581, 24865418, 28295231, 28396236, 29063464, 29526761		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	10998151, 12230503, 12485445, 15334474, 15692985, 16096331, 30227141, 7616001	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	15800006	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10643708, 10998151, 12562402, 13130473, 15565953, 15728381, 15800006, 17276734, 17665457, 18759295, 19121222, 19423430, 19479852, 20434119, 2105500, 21437440, 22028659, 22057071, 22389764, 22897816, 22966240, 23264357, 23439470, 23702100, 24530749, 25652333, 26583155, 27412348, 27852285, 28367002, 29526761, 29545790, 29912900, 30466076, 31409832, 32576231, 33549023, 33708222, 34596026, 35084314, 36482627, 36741410, 9822266	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10733475, 15751081, 16507146, 18438838, 19199277, 20954190, 25548434, 25762184, 26079624, 26790609, 28485798, 29142473, 29316941, 31808546, 31871930, 39818255	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	1893618, 19644848, 31049024, 35833144, 36740569	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Cutaneous	Lupus Erythematosus	BEFREE	30227141		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	10940893, 11115160, 11531784, 1503608, 15565953, 18200501, 18759295, 20434119, 21907587, 22389764, 24449581, 24865418, 26568320, 28295231, 28396236, 29063464		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10395102, 10643708, 10703622, 10940893, 10998151, 11169260, 11607787, 11704801, 11704803, 11958574, 12730512, 1503608, 15219382, 15565953, 15657613, 15674653, 15693080, 15932622, 15971421, 16095006, 16306881, 16391890, 16418737, 17503323, 17665457, 17683987, 18001298, 18172443, 18200501, 18295675, 18348311, 18597405, 18759295, 18764842, 1893618, 19121222, 19479852, 19480843, 19762398, 20012871, 20110525, 20112363, 20140011, 20166876, 20333386, 20434119, 20516030, 20576226, 20954190, 2105500, 21163672, 21499693, 21544635, 21907587, 21968693, 22057071, 22057691, 22196362, 22389764, 22723547, 22759859, 22820624, 22884981, 22913362, 22924496, 23139385, 23143392, 23171638, 23702100, 23911423, 24039598, 24420856, 24449581, 24530749, 24865418, 25151985, 25182168, 25359881, 25652333, 25661739, 25684197, 25762184, 26107748, 26116096, 26443253, 26582004, 27365371, 27726311, 27838362, 27943420, 28264814, 28295231, 28331294, 28367002, 28396236, 28485798, 28837372, 28848179, 29063464, 29298134, 29330524, 29333443, 29358664, 29397904, 29499037, 29545790, 29570934, 29611038, 29623390, 29635996, 29668584, 29778720, 29844438, 29912900, 30183357, 30282561, 30301439, 30414207, 30466076, 30572037, 30718722, 30729698, 30916218, 30952199, 31024730, 31049024, 31081141, 31299880, 31409832, 31519970, 31734262, 7614782, 7903914, 8020556, 8813745, 8895148, 9093873, 9098928, 9116707, 9182925, 9416858, 9543565, 9777334, 9822266		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	11958572, 16418737, 16507146, 16596274, 17665457, 18001298, 19110660		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	10940893, 2105500, 21163672, 21544635, 22896023, 23143392, 23273922, 24627031, 27365897, 27943420, 28216896, 29333443, 29369823, 29451067, 29456665, 29611038, 29668584, 30316188, 31409832, 9302664		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	16408116	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	2105500, 28527290, 31171837, 31409832	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	10940893, 1503608, 15565953, 18200501, 18759295, 20434119, 21907587, 22389764, 24449581, 24865418, 28295231, 28396236, 29063464		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	23867796		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25010932, 26464679, 29575464, 33158173	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	26992854, 29575464, 29844685, 29890027, 30902881		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28791816	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	28222785		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	17456766, 1954380, 9329960	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	11042520, 12607539, 17166738, 18566478, 28869447		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	LHGDN	17166738		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	LHGDN	11960393		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	2783672		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	11013462, 14978135, 18550789, 19201837, 19359411, 19717436, 20191326, 2066357, 20963937, 22125456, 2302463, 25962811, 26307954, 29504848, 30065253, 31118164	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11062439, 11274761, 11567226, 11704827, 11956026, 17071494, 17166738, 18456377, 21181928, 22830613, 2302463, 23306613, 24162786, 24206092, 25962811, 26255115, 28214146, 29114832, 29721369, 29762681, 29954352, 30821928, 30941038, 31204070, 31322018, 31335688, 7691638, 8217820, 9885224		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	11274761, 11956026, 35432366	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	10583231, 11756183, 16643431, 16763612, 18990758, 25733581	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	22015774	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Cutaneous Anaplastic Large Cell	Primary cutaneous anaplastic large cell lymphoma	Pubtator	19890350	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	10221513, 10583231, 11756183, 16389181, 16643431, 16763612, 17056605, 17510437, 20952689		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	17510437, 29569854		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	11092613, 12351419, 12472577, 16293872, 16389181, 16643431, 17018637, 17038522, 17056605, 17087739, 17311253, 17510437, 17606447, 17653830, 17971052, 18990758, 19021060, 19390683, 19654554, 20047977, 20087644, 20952689, 22096508, 22177457, 22649007, 23225254, 23277417, 23640160, 25204673, 28060727, 29569854, 29603214, 29930163, 9572991		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	17018637		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	12351419, 16293872, 16389181, 16643431, 17018637, 17510437, 18990758, 19021060, 19390683, 20047977, 22177457, 22649007, 23225254, 23640160, 25204673, 29569854, 29603214, 29930163, 9572991		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	12689942, 9593751		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	LHGDN	17495957		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	25692255		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	10953976, 11042520, 11434619, 11567226, 12607539, 1327287, 14521460, 16393214, 19738620, 2114936, 28993768, 29352500, 29462391, 29538028		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	1327287, 19738620, 2114936, 27402301	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	2258703, 8698322	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Syndrome, X-Linked, 2	Lymphoproliferative Disorder	BEFREE	24611904		★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	27246313		★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	28815559, 28960260, 30671214		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	24439028, 27733811, 39959181	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	35370941	Stimulate	★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	9669428		★☆☆☆☆ Found in Text Mining only
Magnesium Deficiency	Magnesium Deficiency	BEFREE	28306698		★☆☆☆☆ Found in Text Mining only
Majeed syndrome	Majeed Syndrome	BEFREE	23087183		★☆☆☆☆ Found in Text Mining only
Majeed syndrome	Majeed syndrome	Pubtator	33314777	Associate	★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	18515978		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	18515978		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	18515978		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	18515978		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	18515978		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	18515978		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	18515978		★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	24620999, 30591371		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	19175760, 19618378, 19836613, 20351714, 20661026, 22683211, 23608119, 26746105, 27187381, 27603714, 27718369, 28122130, 28384542, 28712427, 28833192, 28867391, 29069253, 29103192, 29298663, 29361849, 29427582, 29660639, 29670819, 29778935, 29856741, 29895893, 29968776, 30033161, 30310056, 30520409, 30564974, 30797959, 30826620, 30840161, 30870525, 31075818, 31100612, 31142907, 31275757, 31561419, 31622870, 31693974, 31847190		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	20351714, 22683211, 22683764, 23064081, 23608119		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malabsorption Syndrome	Malabsorption Syndrome	BEFREE	27467733, 29631379		★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	28565880, 30717619, 31002915, 31841444		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	23360674		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	23108118		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	21127499, 25622756, 31653130, 8421207, 8641993, 9614548		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	22199285		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	17560079, 21933882, 26718429, 28640146, 30484735, 31076897, 9583800		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	20087644, 21441465		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	2787682, 9891524		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of adrenal cortex	Adrenocortical carcinoma	BEFREE	26768118		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	29453678, 29603739		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10677530, 11431320, 11841482, 12206515, 14572152, 14633738, 15217507, 15265021, 15265702, 15286701, 15354201, 15623590, 15999154, 16243830, 17047073, 17216494, 17283156, 17428620, 17965799, 18234964, 18409070, 19087274, 19190336, 19553068, 19632771, 19760502, 19766100, 1977519, 19890662, 20035378, 20446019, 20509143, 20872355, 20878356, 20882404, 20924115, 21323572, 21444724, 21476000, 21480222, 21490427, 21523452, 22320863, 22362301, 22386367, 22447108, 22750628, 22767506, 22844580, 22941467, 23033967, 23053664, 23128672, 23143946, 23174100, 23263670, 23292149, 23338610, 23451065, 23991131, 24036252, 24299316, 24301937, 24509793, 24598028, 24724627, 24745479, 24990246, 25010932, 25149156, 25150312, 25175386, 25292037, 25328122, 25332681, 25401416, 25409762, 25419573, 25536365, 25559835, 25591657, 25659578, 25704480, 25813148, 25928089, 26011589, 26112140, 26165253, 26331901, 26383972, 26403072, 26464679, 26553968, 26820653, 26927216, 26935527, 27091479, 27282881, 27292433, 27351141, 27666521, 27832973, 27893337, 28081733, 28127258, 28173834, 28282786, 28369883, 28378740, 28441391, 28452243, 28460534, 28627683, 28651126, 28714000, 28723753, 28733879, 28764974, 28774312, 28791816, 28938560, 28945218, 28983080, 29088874, 29112895, 29175445, 29202842, 29256014, 29311633, 29620289, 29698439, 29751615, 29964331, 30082828, 30131941, 30132536, 30166590, 30177620, 30442350, 30657766, 30728901, 30850950, 30990165, 31032639, 31197211, 31239840, 31382678, 31454519, 31524251, 31571327, 31645610, 31659097, 31666931, 31730606, 31796638, 8661822, 9038615, 9157996, 9199297, 9816237		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16298037, 17516992, 19446661		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	10671688, 31043860		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	16153435, 17638919, 24409077, 24754231, 24959694, 25814442, 26823692, 27697099, 27821804, 28283752, 30854115, 31109341		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	18260730, 24676340, 26992854, 27009073, 29844685, 30902881		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	22411584, 23852308, 8894681		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	1404666, 19164706, 26662402		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	28667515, 9583800		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	17901709, 20962331, 22153863, 23943369, 26981838, 27121136, 28115787, 29981431, 30246718, 30723284, 30981080, 31781194		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	24183702		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10423407, 10945495, 11212267, 11773980, 15014984, 15746434, 15854959, 16476505, 17145853, 17316570, 18794145, 19469656, 19564826, 20068366, 20112337, 20360945, 20450916, 21699929, 22049529, 22160576, 23100065, 23174563, 23339680, 24113849, 24139238, 24969564, 25548907, 25889486, 25891208, 25897826, 25977341, 26464679, 26823692, 27344406, 27556690, 27706681, 27738385, 27998891, 28099148, 28199969, 28446126, 28470556, 28599466, 28672902, 28798777, 29080421, 29345337, 29379440, 29408308, 29613856, 29720822, 29735548, 29890027, 29975933, 30078713, 30214604, 30352911, 30405827, 30508513, 30573629, 31018714, 31362929, 31602275, 8086165, 8695164, 8978294		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	14587096, 22369883		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	11808761, 11827262, 15799583, 17592646, 19528505, 21497332, 24460282, 25721693, 27312561, 28107185, 28397778, 28708091, 28885456, 30393585		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	23183825		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10053112, 11406568, 12538625, 12576447, 15047209, 15870936, 15972852, 16044148, 16364318, 16505113, 17786312, 1868469, 19484142, 21081903, 22095071, 23634944, 24676340, 25677845, 26122654, 26617713, 27068525, 27206315, 28044937, 28410380, 30642295, 30697874, 8385577, 8387543		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10469042, 11590320, 11854621, 12219002, 12378118, 14560157, 15781649, 16614115, 17762760, 19444305, 19670328, 19671855, 20197756, 21482023, 21880146, 22038233, 22990108, 24213797, 24662747, 25213764, 28160574, 28440486, 29085463, 29410961, 30011858, 31424683, 31464604, 7882388, 9563482		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	16211219		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pharynx	Malignant Pharyngeal Neoplasm	BEFREE	9583800		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10751892, 10815922, 10953159, 11289153, 11909978, 12351634, 12663665, 12907654, 1319775, 14617795, 15131058, 15210850, 15252141, 15263792, 15466204, 15477874, 15545300, 15862966, 15904673, 17893044, 18174250, 18196539, 19099590, 19846139, 19895686, 19934328, 20482316, 20599703, 21097678, 21237555, 21326202, 21540577, 22355351, 22426894, 22923157, 22955280, 23065208, 24037407, 24058525, 24666463, 24970477, 25409762, 26164758, 26198640, 26327448, 26337231, 26480897, 27102235, 27941876, 28115787, 28223102, 28910408, 29441606, 29575464, 29899325, 29969844, 30027097, 30349042, 30817944, 30824526, 31667686, 31718684, 8899002, 9917088		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	12231187, 24206262, 28095714, 29103328, 9767235		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11494032, 12115538, 15381184, 15540224, 15579481, 15927855, 15978325, 16579840, 16885196, 17201881, 18350251, 19544559, 19604505, 19615068, 19626584, 19751439, 20200422, 20222161, 20512382, 20699000, 21246243, 22459353, 22714811, 23013936, 23326309, 23821300, 23828749, 23900678, 23975421, 24011243, 24072494, 24142527, 24249671, 24277417, 24789430, 25125137, 25526211, 25548484, 26069103, 26088449, 26464679, 26504356, 27373488, 28115787, 28482378, 28699601, 28970092, 29028942, 29551945, 29867530, 30094865, 30413607, 30544870, 31040894, 7961104		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	15201584, 1733439		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	24464184, 26577851, 26721202, 27555670		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	27511626		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10996723, 12966432, 14963492, 15533517, 15667866, 16094077, 16110031, 16882065, 18558283, 19338536, 22986753, 23442927, 23727622, 25955868, 26264279, 26662402, 27034531, 27092883, 30066919		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	1674182		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10652573, 10722927, 10744043, 10751892, 10757128, 10799332, 10945495, 10946322, 10953159, 11044363, 11092613, 11165872, 11221832, 11234890, 11295285, 11463453, 11823516, 11968052, 11983212, 12145682, 12386831, 12388254, 12478469, 12632104, 12654257, 12864989, 12894513, 14645705, 14701753, 14734634, 15150106, 15194046, 15252138, 15280623, 15374982, 15509531, 15569667, 15586230, 15733831, 15786692, 1579736, 15849810, 15958612, 15994939, 16081933, 16114000, 16132372, 16166346, 16178815, 16199861, 16357130, 16373718, 16450333, 16452207, 16505113, 16555058, 16675563, 16806476, 16820920, 16832350, 16891465, 16951164, 16951242, 17071494, 17106251, 17164537, 17172826, 17178846, 17201881, 17316570, 17363555, 17628160, 17674351, 17848598, 17909069, 17922852, 17981752, 18078328, 18196539, 18223207, 18234964, 18243134, 18374623, 18381408, 18450338, 18645026, 18701496, 18954521, 18988868, 18990758, 19001439, 19022814, 19096444, 19106147, 19147566, 19214542, 19347278, 19418484, 19461675, 19470238, 19486922, 19509255, 19540014, 19584265, 19617819, 19625257, 19683483, 19701890, 19758994, 19795387, 19800994, 19846961, 19895686, 20075981, 20087353, 20112337, 20189297, 20199238, 20354117, 20354842, 20388793, 20431601, 20446019, 20564512, 20590345, 20646319, 20651369, 2066357, 20682650, 20800309, 20874489, 20971503, 20978325, 21057457, 21102426, 21111705, 2114216, 21187523, 21237555, 21244577, 21269254, 21327457, 21476000, 21490678, 21497332, 21509525, 21573932, 21699929, 21771726, 21818296, 21904218, 21993017, 21993858, 22017428, 22019249, 22038233, 22085427, 22116377, 22177457, 22196886, 22228181, 22241084, 22253230, 22313685, 22386367, 22470125, 22554523, 22559302, 22589397, 22592655, 22675457, 22705846, 22707197, 22728043, 22733138, 22752926, 22768286, 22829912, 22898820, 22922338, 22965279, 23016583, 23100065, 23138871, 23145797, 23228130, 23261452, 23263670, 23292149, 23326309, 23339680, 23415892, 23426404, 23428290, 23431386, 23460481, 23464434, 23500081, 23579274, 23582782, 23593411, 23594457, 23637280, 23647548, 23674089, 23695722, 23794111, 23803115, 23972653, 23986445, 24002210, 24026882, 24056367, 24072494, 24107265, 24122460, 24164301, 24198065, 24213797, 24301937, 24356445, 24379239, 24404201, 24416732, 24469836, 24481457, 24501326, 24525736, 24530290, 24587411, 24612949, 24629840, 24662747, 24855648, 24857911, 24895231, 24901008, 2495037, 24953781, 24969828, 24971746, 24980554, 25015549, 25017974, 25102912, 25113639, 25123505, 25174275, 25204673, 25255422, 25276792, 25306394, 25318697, 25358405, 25519014, 25526211, 25557131, 25561807, 25577511, 25591657, 25704217, 2584719, 25849121, 25854358, 25888191, 25959126, 25987048, 26088082, 26107717, 26113409, 26214423, 26315998, 26381901, 26410343, 26480897, 26516157, 2662193, 26722496, 26788912, 26853468, 26918940, 26927216, 26983803, 26992854, 27129149, 27132513, 27147709, 27154307, 27327083, 27393295, 27422900, 27490929, 27511626, 27531077, 27569216, 27608596, 27641334, 27688201, 27698002, 27797827, 27889231, 27919820, 27927016, 27996200, 27997918, 28073079, 28098875, 28099781, 28115787, 28186089, 28202530, 28209985, 28209994, 28225020, 28256185, 28281970, 28286052, 28357602, 28381191, 28393234, 28397014, 28397778, 28446126, 28463788, 28476028, 28495792, 28513532, 28552580, 28575042, 28587286, 28628031, 28628401, 28639101, 28639887, 28640146, 28662099, 28676732, 28677724, 28687059, 28698503, 28705384, 28708091, 28717941, 28737121, 28737645, 28791816, 28820959, 28839362, 28872976, 28893679, 28900100, 28918048, 28925992, 28931678, 28938560, 28960310, 28969419, 28975649, 29016879, 29039537, 29079905, 29085463, 29090321, 29169370, 29172405, 29197678, 29217118, 29233887, 29238068, 29242605, 29267342, 29288972, 29295955, 29296923, 29305260, 29338031, 29370721, 29378114, 29389831, 29416724, 29419472, 29431638, 29439531, 29458160, 29462391, 29475966, 29490991, 29552185, 29613856, 29643993, 29668679, 29695633, 29720398, 29720822, 29725439, 29794474, 29940792, 29957472, 29963768, 29964331, 29967617, 29980532, 30011858, 30018735, 30049582, 30065253, 30066919, 30080276, 30093324, 30105374, 30137485, 30166590, 30167846, 30169594, 30185628, 30217305, 30252138, 30307772, 30327303, 30341686, 30389698, 30407345, 30459627, 30464207, 30476917, 30520987, 30546074, 30569150, 30628094, 30661394, 30696705, 30697874, 30724650, 30764482, 30818829, 30829675, 30836096, 30837284, 30839135, 30844387, 30923460, 30935038, 30944312, 30989732, 30999696, 31003933, 31013630, 31015764, 31040894, 31076897, 31137684, 31175552, 31181267, 31248045, 31262881, 31393373, 31400636, 31412671, 31432544, 31437790, 31509395, 31524243, 31534529, 31555271, 31610150, 31611882, 31645676, 31645897, 31657476, 31747664, 31752383, 31766230, 31790729, 31803890, 31817770, 31834407, 7485723, 7678547, 7961104, 8060337, 8101762, 8149602, 8217820, 8231032, 8387543, 8473752, 8528939, 8551796, 8912851, 8917114, 9207223, 9338474, 9572991, 9583800, 9642683, 9816329		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	23437333, 28991373		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	11600224, 12142377, 12657115, 15717274, 16438713, 17452777, 18650831, 19823053, 20117760, 21670964, 22019249, 22146770, 22592655, 23028877, 23317256, 23494178, 23824834, 23850705, 25069725, 25113639, 25572145, 25614219, 26191295, 26214423, 27039819, 27599897, 28009429, 28669929, 28901517, 29291370, 29725439, 29940817, 30387170, 30453149, 31825934		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10655513, 10784420, 10866999, 12215894, 16928387, 17283136, 20082449, 21183948, 21631297, 21994466, 22417974, 22677195, 23255489, 23869759, 24120915, 24176760, 24501326, 24662837, 24676340, 25102301, 25156145, 25704023, 26853468, 27991929, 28098359, 28190020, 28223102, 28293641, 28797636, 29467899, 30217305, 30824815, 30999696, 31353569, 31632588, 31838134, 7926038		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	12842827, 19028472		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	12032170	Associate	★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	18496743, 23777202, 29876995, 30180300		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	31398886	Stimulate	★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16298037, 17516992, 19446661		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15044327, 17216494, 17881900, 18416134, 18483465		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16114000, 16287071, 16969126, 17899369, 19920189, 21754991, 23128672, 25928089, 26071407, 27382069, 28441391, 28553282, 31659097, 3476961		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16298037, 17516992, 19446661		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16298037, 17516992, 19446661		★☆☆☆☆ Found in Text Mining only
Mandibulofacial Dysostosis	Mandibulofacial Dysostosis	BEFREE	30280214		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	28093238, 31398273		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	15718413, 20087644, 21441465, 29040306, 7595196		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	27163200, 29547877		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	37445606	Associate	★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	20952689		★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	18186919	Associate	★☆☆☆☆ Found in Text Mining only
Maternal hypertension	Maternal hypertension	BEFREE	27998008, 28626073		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	7992839		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	17550129, 21327638		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	20433827	Stimulate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	21327638	Associate	★☆☆☆☆ Found in Text Mining only
Megaconial Myopathies	Megaconial Myopathies	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
MEGALENCEPHALIC LEUKOENCEPHALOPATHY WITH SUBCORTICAL CYSTS	Megalencephalic Leukoencephalopathy With Subcortical Cysts	BEFREE	29953494		★☆☆☆☆ Found in Text Mining only
Meibomian gland dysfunction	Meibomian Gland Dysfunction	BEFREE	30356032		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10318823, 10493523, 10644010, 11004679, 11228537, 11313369, 11585775, 12388254, 12789291, 1281617, 12916466, 1389476, 14696119, 15383566, 15501965, 15827341, 16213477, 16778114, 16801397, 16835788, 17561097, 17703297, 19090007, 1991983, 20573279, 20977303, 23674089, 24211571, 2506138, 25256614, 25677845, 25724678, 26106605, 26122536, 26134947, 26279161, 26387540, 26632958, 27307502, 28043149, 28560396, 28881857, 29032405, 29459345, 29596115, 29931745, 30017877, 30028780, 30305327, 30451787, 30701020, 31175545, 31509504, 8062279, 8242663, 8562498, 8869681, 8894681, 9537260, 9892208, 9935217		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	10318823, 11399512, 12713589, 1281617, 12966436, 1347555, 1380648, 15054471, 15580309, 16645588, 16801397, 16835788, 19651643, 2007858, 20856146, 21268068, 23490134, 24200969, 25223735, 26106605, 27175588, 27549123, 30591049, 30953519, 31591149, 31611597, 32041674, 32939325, 33957885, 34638912, 35563820, 35580697, 35879777, 36071040, 37847239, 39216232, 7553683, 8006453, 8102061, 8242663, 8869681, 9298936	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	10379864, 18388930, 9794839, 9843018		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	11841484, 12445207		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	12445207, 1370233, 20052413, 23732752	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	19626699	Associate	★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	16391465, 29340080, 7778683		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	23530106	Associate	★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	19689163, 31488835		★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	23179933, 31133025		★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere disease	Pubtator	34920656	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	26943583	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	31653130		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	12084660, 19836613, 19891854, 20661026, 20955778, 21194425, 22580182, 22921153, 22990943, 23415700, 25596176, 26074461, 26083579, 26378439, 26812919, 27049572, 27187381, 27592314, 27840055, 27876634, 27991935, 28041597, 28093238, 28511072, 28536068, 28580183, 28670290, 28778811, 28809993, 28914726, 28918107, 28954415, 28958613, 29049348, 29059681, 29118582, 29408464, 29424322, 29427595, 29460011, 29500107, 29518097, 29543650, 29574669, 29765402, 29799484, 29849779, 29969604, 30035700, 30052465, 30098513, 30104698, 30136679, 30218782, 30334417, 30470307, 30572037, 30616482, 30711869, 30792669, 30957546, 30967802, 31017303, 31022424, 31049023, 31052597, 31064292, 31073553, 31125623, 31214095, 31296155, 31375659, 31513828, 31615595, 31616368, 31622870, 31736187, 31820774		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	24094876, 24620999, 25151093, 25315113, 25903726		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	28160694, 28969939, 30439824, 31381975		★☆☆☆☆ Found in Text Mining only
Mental Disorders, Severe	Mental Disorders	BEFREE	28049760, 28815548		★☆☆☆☆ Found in Text Mining only
Mesangial sclerosis diffuse	Diffuse mesangial sclerosis	Pubtator	29708439	Associate	★☆☆☆☆ Found in Text Mining only
Mesial temporal lobe epilepsy with hippocampal sclerosis	Mesial temporal lobe epilepsy with hippocampal sclerosis	BEFREE	28675059		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	15700263, 7947089	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	25525034		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	12612292, 15756029	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	23868066	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	12619938		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	12161545, 15677734, 17498300, 26722602, 30964608, 33417721, 33585287, 34779349	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	12378118, 16979382, 17593901, 25367327, 26722602, 27863345, 28166606, 28239164, 29056829, 31496037		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	21852675	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	17347550, 21147642, 21498926, 23010875, 25081719, 26722602, 29696068, 30345259, 30383538, 30635365, 31798282, 33033337, 39837875	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	22991262	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	10770222, 10916281, 10954020, 15735207, 16202847, 16421346, 16456090, 16468038, 16793965, 17160670, 17200772, 17347550, 20080841, 20177654, 20579864, 21147642, 21473680, 21616679, 21978920, 22081334, 23010875, 23980866, 24302289, 24753491, 25081719, 25329057, 25967388, 26722602, 26871396, 27720273, 27846925, 27901349, 28082237, 28265826, 28421729, 28759152, 29037330, 29334162, 29349831, 29390261, 29465355, 29807981, 29907916, 29975666, 30200422, 30206447, 30303269, 30338401, 30418124, 30426122, 30519766, 30555225, 30576798, 30614120, 30635365, 30642114, 30688550, 30858782, 31017459, 31060892, 31133498, 31137783, 31142251, 31311491, 31397188, 31476685, 31560233, 31661295, 31798282		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	26279161, 27934883, 30451787		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	24100420, 24680871, 25189320		★☆☆☆☆ Found in Text Mining only
Mevalonate Kinase Deficiency	Mevalonate kinase deficiency	Pubtator	13130485	Stimulate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	28549057, 31352487		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	33672623	Associate	★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	25256614		★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular Angina	BEFREE	22404441, 26058672		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	12047333, 14718719, 17635597, 19559392, 20035431, 20113413, 21812905, 22001640, 22342236, 23051989, 24054031, 24698360, 24959879, 25315199, 25434717, 26098763, 28478481, 28677995, 28950996, 30009333		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	LHGDN	17635597		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	Pubtator	19559392, 25315199, 28208835, 36614097, 39187749	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine with Aura	Migraine	Pubtator	19559392	Associate	★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	20035431, 24959879, 25434717		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	20930310, 21252552, 28982375, 29039020, 29478949, 30256904, 30641113		★☆☆☆☆ Found in Text Mining only
Milk-Alkali Syndrome	Milk-Alkali Syndrome	CTD_human_DG	10638776		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	11211945, 11737072, 18304462, 20106534, 20388617, 22131390, 22727980, 23656493, 29103803, 30953065, 7884745, 9222024		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	10383455, 12522001, 15623531, 29207128, 36047722, 37312126, 37656622	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	23619127		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	23705001	Inhibit	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	30897288, 33957885, 34867992, 36361846, 36982291, 39173437	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Myopathies	Mitochondrial myopathy	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	11444910, 21396892, 9094056		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	29408464		★☆☆☆☆ Found in Text Mining only
Mixed Connective Tissue Disease	Mixed connective tissue disease	Pubtator	25736140	Stimulate	★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	22199285		★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	28114570		★☆☆☆☆ Found in Text Mining only
Monoclonal B-Cell Lymphocytosis	B-Cell Lymphocytosis	BEFREE	30728747		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	10920132, 2665838, 28943924		★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	2486284		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	11324946, 19175760, 23064081, 26924347, 28929992, 29611101, 31837338		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	11324946, 18832862, 19175760, 23064081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	23064081	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Morphea	Morphea	CTD_human_DG	9843018		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	11847479		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Diseases	Mouth disease	Pubtator	10606965, 23226210, 23553861, 24453419, 27542948, 8537046	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	20008541	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	19528505	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	19528505, 30536317, 38376273, 8286215	Associate	★☆☆☆☆ Found in Text Mining only
Muckle-Wells Syndrome	Muckle-Wells Syndrome	BEFREE	12520003, 17950649, 22714396		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	10233729, 10902757, 10931145, 11328953, 12209524, 12783130, 14703611, 14985941, 1700705, 18050249, 18710885, 21315128, 22100609, 23298273, 23870089, 24162006, 24964229, 26794462, 27455075, 27550227, 28108813, 28526535, 28587409, 28915665, 29098351, 29360808, 29447181, 29623653, 29625336, 29913529, 30988740, 30996002, 31261503, 31425625, 31583766, 8387893, 8996256		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	10233729, 28069066, 32884012, 34035116	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	14703611, 15383707, 23298273, 26679344, 26794462, 32721809, 3491174, 35125343, 35692878, 35861833, 37820655, 38273388	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	LHGDN	18710885		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	LHGDN	15146559		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	19006194, 20952689, 21465313, 25248880, 31362580		★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	25915602, 32612071, 34697283	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10050719, 10210775, 10848780, 12200397, 12714512, 15842659, 18512025, 19191868, 21850048, 23632478, 24141333, 24875904, 25469832, 27039718, 29089645, 30872779, 31406107, 36105747	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10848780, 10920132, 11494147, 11562486, 11986233, 12200397, 14500379, 14512299, 15041705, 15842659, 17038522, 17071494, 17315188, 17927494, 19282458, 19561642, 20122728, 2065106, 22387051, 22427205, 22999526, 23785514, 23932230, 24151609, 25973846, 2665838, 27039718, 27611810, 27641334, 2790197, 28476134, 28943924, 29057477, 29214775, 29296860, 29296923, 29510136, 29773987, 29899820, 31035033, 31427721, 31681592, 31793411		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11986233, 15287939	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	12200397, 12574959, 18405969		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25526031	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10202987, 10408716, 10433357, 10450792, 10522904, 10550297, 10552245, 10652446, 10773851, 10871804, 11444910, 11571703, 11847479, 12045717, 12120698, 12175864, 12474981, 12568117, 12824709, 14651518, 14651520, 15007139, 15124762, 15149631, 16803996, 16900751, 17079667, 17268200, 17295710, 18051225, 18348311, 18573819, 18625522, 19018248, 19244395, 19246939, 1969423, 20082645, 20228669, 20499285, 20535037, 20558237, 20962851, 21136171, 21177755, 21396892, 21621860, 21908876, 22059991, 22641052, 22801493, 23595117, 23624563, 23787171, 24024893, 24174586, 24475162, 24696164, 24790215, 25575858, 25704169, 25801023, 26062845, 26267733, 26285213, 26819253, 26844569, 26906225, 27023227, 27831647, 27966076, 28082233, 28131210, 28161400, 28236206, 28422748, 28497341, 28616851, 28677863, 28847534, 28856541, 28922099, 28939293, 29057962, 29126030, 29210147, 29690885, 29760711, 29797117, 29844438, 29861718, 30009568, 30143908, 30206422, 30367633, 30409508, 30856027, 31033006, 31284389, 31379730, 31556809, 31559449, 31681293, 31704454, 31726376, 31781177, 31785393, 7486863, 8157738, 8550811, 8624683, 8872171, 8887999, 8964905, 9042107, 9094056, 9270565, 9270614, 9345390, 9345451, 9378125, 9395126, 9413269, 9628463, 9667591, 9762664, 9916885		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	10428056, 10550297, 14641910, 17212772, 17258784, 18322311, 22059991, 22801493, 23028349, 23661562, 24098530, 24278027, 25136908, 25704169, 26062845, 27310932, 29518260, 30409508, 31681293, 31810488, 32951330, 33285358, 33608417, 34359880, 35250986, 35648256, 36292599, 36604748, 37219933, 8697624, 9239408, 9883968	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	11956029, 12562396, 21298033, 23226199, 27916909, 9013604, 9771978	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	12084660, 12445803, 17079667, 17268200, 17439892, 18322311, 18388249, 18755820		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	23319192	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	24098530	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	11444910, 19201038, 1969423, 20499285, 28967047, 7818262, 9395126		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	21842588	Stimulate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	18215180, 20814569, 28188344, 29040534, 30552836		★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	25335775, 25702170, 28481651, 31478135		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	10199335, 10376950, 11574100, 20942939, 24389034, 25518708, 28429750, 31118027, 8982119, 9688335		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	25518708	Inhibit	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	28045063, 28119492	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis, Ocular	Myasthenia Gravis	BEFREE	28119492		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	12689942, 20047977	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	18205195		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10229321, 10497846, 10697556, 10752992, 11698291, 12028020, 12681357, 15370256, 15860935, 16204077, 16400883, 18081437, 18205195, 18838202, 18945969, 20061558, 20472834, 20541027, 20562331, 21983349, 22327869, 23236476, 23331180, 25608238, 25895473, 27513856, 27902785, 28601896, 28705782, 28983059, 29390339, 29749435, 8598233, 9447819, 9883804		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	18081437		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	10749583, 16091127, 18081437, 18945969, 20061558, 20472834, 20541027, 20562331, 21659535, 24652987, 27513856, 33050756, 35367529, 9883804	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	18287021, 38511647, 9792306	Stimulate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	25608238, 34335093, 36737440	Inhibit	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	29749399, 30718771, 31297883		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	18468786, 2062856, 28968948		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	11549518, 12036890, 1553580, 17900262, 18922853, 1961020, 20541027, 22232214, 24041577, 24819026, 2584719, 26911804, 28376476, 31015764, 31272418		★☆☆☆☆ Found in Text Mining only
Myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	8887052		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	12036890, 21860020, 26852656, 30647074		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorder Chronic with Eosinophilia	Myeloproliferative disorder	Pubtator	18563738	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	17942913		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Syndrome Transient	Transient myeloproliferative disorder	Pubtator	11966768	Stimulate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	31819634		★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	10716473		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	15135663, 15231041, 17337591, 18034274, 29959987		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	11113269, 11199329, 11399901, 11689215, 12747595, 14572794, 16243340, 16714144, 17002900, 17981284, 20421368, 21380730, 23415700, 24269648, 26455386, 26498282, 26648172, 27487851, 27706628, 27881030, 28174192, 28414590, 28599197, 28721450, 29177025, 29258676, 29415889, 29434760, 29949169, 30068867, 30116330, 30555342, 30586716, 30642049, 30953351, 30958967, 31059840, 31205590, 31218464, 31280453, 31284167, 31296837, 31364133, 31630586, 31666455, 31811327		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	11693755, 14711179, 21455632, 22408428, 33847684	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	15883752, 16310260		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	16243340, 16718633, 18056971		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	20467748	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	15760675, 17452160, 20571888, 28142118, 28383437, 28889349, 29175266, 29188498, 29862462, 29940243, 8640999		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533, 16775501		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	LHGDN	17452160		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	29940585, 33191336, 36012347	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Stunning	Myocardial Stunning	CTD_human_DG	11927517		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	11028485, 18303410, 8624580, 8892902, 9649940		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	Pubtator	11028485, 34414385	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	Pubtator	15218506, 34796122	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	CTD_human_DG	18627770, 25396421		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopia	Myopia	Pubtator	34160912	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	10399751, 15338498, 16970978, 17586554, 20980264, 24757153, 27578244, 29040534, 29173693, 29183282, 30604316, 31635041		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	15731288, 20980264, 27894310, 27936488, 37228600, 39946176	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	LHGDN	17586554		★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	18420712	Stimulate	★☆☆☆☆ Found in Text Mining only
Myotonia Fluctuans (disorder)	Myotonia Fluctuans	BEFREE	29481309		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	10999804, 18559347		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	LHGDN	12163195		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	15217754, 21414848	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	26211001	Inhibit	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	27294162, 30845774, 32684830, 33287713	Stimulate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	16437243, 18559347		★☆☆☆☆ Found in Text Mining only
Nail-Patella Syndrome	Nail-Patella Syndrome	BEFREE	24577461		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	10402494, 10459746, 10488740, 11285131, 12601524, 12823767, 24157100, 24994458		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	Pubtator	11235856, 32358372	Associate	★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	LHGDN	12823767		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	Pubtator	27821550	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	11892044, 16358608, 17424890, 19095579, 19405090, 19951374, 20012441, 20924287, 22759952, 23446846, 26433033, 29388847, 30003390, 31611936, 31794110		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	19405090, 36139155, 8514874	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	30040868, 33785041	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	10197635, 11968052, 12691826, 1325786, 15352039, 16970270, 20874489, 20886067, 21057457, 21936689, 23183825, 23597429, 24194922, 24696473, 25912222, 26172457, 26918942, 27424523, 29164771, 29735548, 29896278, 31295651, 31312900, 31522611		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	11968052, 16970270, 21057457, 22320262, 26198046, 32448862, 34114393, 34452547	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28207826	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	33545035	Stimulate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	10373561, 11278357, 15218506, 15699214, 18550789, 22345571, 22421439, 24336085, 28485798, 34625123, 37924741, 8901602	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrosis	Necrosis	Pubtator	11918694, 15461705, 16507998, 17565690, 19156215, 28097431, 30999696, 8675695	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrotizing Enterocolitis	Necrotizing Enterocolitis	LHGDN	11697432		★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	31125264, 8506954		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	11697432, 20716917, 28770467, 29399120, 29784900, 29950141, 30465999, 30542485, 31125264, 31190184, 31583737, 8506954, 9044137		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10228902, 10233685, 10493523, 10562548, 10646849, 10654199, 10713122, 10738180, 10757128, 10880020, 10945495, 10974403, 11004679, 11044363, 11045427, 11062439, 11067885, 11092613, 11104810, 11221832, 11228537, 11280794, 11289151, 11299763, 11313788, 11490359, 11545617, 11593333, 11594763, 11704860, 11733907, 11792173, 11809531, 11836673, 11840265, 11841482, 11841484, 11857407, 11896437, 11911240, 12032698, 12052763, 12072546, 12082613, 12182418, 12382527, 12385006, 12386834, 12388254, 12434133, 12526712, 12663665, 12679798, 12839959, 12873688, 12949814, 12960282, 12966432, 1325786, 1358347, 1389476, 1389482, 14508100, 14610084, 14614459, 14744790, 14759987, 14963492, 14978132, 1499722, 15014984, 15126334, 15210850, 15293344, 15313687, 15330168, 15374982, 15375575, 15501965, 15531454, 15533517, 15604260, 1563018, 1568183, 15695400, 15733831, 15743036, 15753363, 15766588, 15846369, 15864316, 15940637, 1596939, 16052233, 16059653, 16156899, 16166279, 16178815, 16237754, 16288025, 16438713, 16505113, 16555058, 16580499, 16951164, 16951242, 17189422, 17195449, 17234767, 17237282, 17256802, 17283136, 17394066, 17510428, 17560652, 17570219, 17594693, 17653087, 17653822, 17695527, 17899369, 17938269, 17942913, 17981752, 17991428, 18234964, 18264131, 18374623, 18508404, 18511911, 18654609, 1868469, 18787932, 18931692, 1905907, 19090007, 19096444, 19106147, 19226333, 19244371, 19336886, 19357993, 19407827, 19470238, 19517218, 19543243, 19565910, 1968360, 19701890, 19741298, 19760502, 19843672, 19846139, 1991983, 20026107, 20035378, 20082449, 20087353, 2016545, 20189297, 20197756, 20308427, 20332214, 20509143, 20580868, 20603617, 20650898, 20863894, 20874489, 20882532, 20924115, 20956527, 20971503, 20978188, 20978325, 21052099, 21057457, 21097678, 21133714, 2114216, 21165560, 21183948, 21251905, 21269254, 21437888, 21442077, 21480224, 2148874, 21536688, 21573932, 21681381, 21750868, 21771726, 21934654, 21945666, 21979578, 21980136, 22065587, 22086925, 22104567, 22108090, 22139443, 22293948, 22354145, 22554587, 22619347, 22728043, 22797667, 22922789, 22986753, 23016583, 23138871, 23178569, 23200674, 2324115, 23241893, 23247106, 23255489, 23292149, 23299796, 23339186, 23429495, 23460481, 23464051, 23531320, 2358679, 23593410, 23605004, 23674089, 23722548, 23743189, 23774209, 23817216, 23870134, 23972545, 23975421, 23999825, 24064911, 24066693, 24072494, 24101135, 24113849, 24122460, 24158182, 24260500, 24269672, 24324738, 2433337, 24356814, 24466321, 24489105, 24501326, 24598028, 24676340, 24678705, 24696473, 24754231, 24784717, 24788885, 24818725, 24832086, 24855648, 2486284, 24969564, 25010932, 25102301, 25113639, 25123505, 25225903, 25360740, 25402182, 25454946, 25501831, 25548907, 25557131, 2556069, 25561807, 25614219, 25622756, 25672264, 25677845, 25874673, 25891416, 25902748, 25912222, 25928089, 25959126, 25965265, 25973846, 26069103, 26106605, 26122654, 26124051, 26183926, 26208902, 26215403, 26261530, 26279161, 26327448, 26337231, 26426449, 26480897, 2662193, 26718030, 26768118, 26823692, 26853468, 26858439, 26876171, 26918942, 26921521, 26927216, 26935527, 26983803, 26996193, 27068525, 27129149, 27176505, 27192566, 27197066, 27254276, 27336718, 27375023, 27556690, 27556695, 27597531, 27599897, 27608596, 27656836, 27698002, 27712587, 27762493, 27793775, 27797827, 27826041, 27832973, 27833035, 27833109, 27896636, 27922077, 27924972, 27931288, 27941876, 27993206, 28007595, 28024448, 28035399, 28043149, 28044937, 28052202, 28075192, 28081733, 28087739, 28092866, 28096174, 28131629, 28134280, 28159925, 28160574, 28184968, 28189727, 28194716, 28198545, 28202530, 28259044, 28262268, 28263973, 28282786, 28303957, 28314212, 28323110, 28393234, 28405578, 28420351, 28448867, 28489607, 28553282, 28575042, 28612394, 28629783, 28640146, 28665401, 28687755, 28697305, 28733879, 28811490, 28817117, 28820959, 28822765, 28844984, 28874690, 28881825, 28891811, 28892675, 28914439, 28925992, 28969419, 28970092, 29038298, 29038485, 29042284, 29062041, 29109725, 29124765, 29127109, 29149434, 29153059, 29169725, 29190948, 29197088, 29234328, 29238068, 29256014, 29265918, 29296537, 29400948, 29460212, 29467899, 29467927, 29472271, 29490991, 29491184, 29493296, 29512745, 29528990, 29558152, 29575464, 29608425, 29632814, 29684350, 29692616, 29698439, 29715087, 29719394, 29720829, 29721366, 29725393, 29770821, 29786075, 29793087, 29796998, 29844827, 29870719, 29887396, 29892300, 29928491, 29981431, 29993310, 30013362, 30015957, 30018735, 30090962, 30103789, 30132512, 30166590, 30170303, 30170620, 30182839, 30184794, 30251217, 30273860, 30285829, 30310258, 30327303, 30341686, 30352261, 30451787, 30496733, 30515264, 30518097, 30545920, 30581847, 30591201, 30602571, 30622534, 30659574, 30661394, 30665937, 30675255, 30742987, 30778749, 30798159, 30802640, 30803506, 30816548, 30824549, 30844387, 30863846, 30872117, 30885361, 30910714, 30930215, 30945383, 31040894, 31078569, 31109341, 31137684, 31152624, 31181660, 31185226, 31186704, 31211796, 31213507, 31235854, 31239343, 31252477, 31270760, 31271855, 31288582, 31289564, 31303383, 31324613, 31354725, 31355333, 31392779, 31434495, 31439050, 31442303, 31460395, 31509504, 31521127, 31522446, 31530042, 31534529, 31550511, 31559608, 31565489, 31577702, 31591154, 31616474, 31638203, 31659097, 31660078, 31694526, 31702096, 31709774, 31726654, 31733286, 31741709, 31786227, 31790729, 31799191, 31803362, 7485723, 7508890, 7519125, 7585181, 7812976, 7882388, 7927889, 7958061, 8001927, 8014015, 8086165, 8162605, 8188614, 8215637, 8299097, 8380906, 8385577, 8387543, 8473752, 8483246, 8485728, 8548754, 8647234, 8661822, 8695814, 8751976, 8813113, 8826937, 8827016, 8912851, 8968046, 9165756, 9335010, 9419972, 9563482, 9573023, 9578844, 9614548, 9639400, 9685865, 9735418, 9743290, 9816329, 9865731, 9892208, 9917088, 9924699		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	LHGDN	12637641, 18656701		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	22057071, 22975019, 25343824, 28391344, 28849172, 31736350		★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Interstitial nephritis	Pubtator	17361117	Stimulate	★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Interstitial nephritis	Pubtator	30088539, 30779760	Associate	★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	30779760		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	30779760		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	27612997		★☆☆☆☆ Found in Text Mining only
Nephronophthisis	Nephronophthisis	BEFREE	26487268		★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	28963877	Stimulate	★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	29190601	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	12974763, 28629718, 31095586, 35837376	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	20446793	Stimulate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	28457111, 28803697		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	29190601, 7705373		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	11032886, 21891866, 39738562	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
nervous system disorder	Nervous System Disorder	BEFREE	12175864, 15307952, 15827736, 17347265, 21127499, 25245565, 28210955, 29301248, 29771234, 9119960, 9730685		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
nervous system disorder	Nervous System Disorder	CTD_human_DG	14999072		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural Tube Defects	Neural tube defect	Pubtator	18162123	Associate	★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	29693124		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10100634, 10936200, 11282550, 12709435, 17962944, 19638467, 21298033, 23967300, 25503960, 32514618, 8640845	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	BEFREE	10936200, 11282550, 12615731, 12730964, 12880977, 1354203, 15065018, 15065019, 15554267, 19954364, 21298033, 21457223, 22493319, 23299796, 23940760, 23967300, 25503960, 25890358, 26283214, 28671636, 30545920, 30552797, 31134519, 7616207, 7739519, 7906313		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	30629318	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	11450703, 14641910, 18422522, 21845541, 26439025, 31810488, 32854421, 35748636, 35889920, 39456170	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	16705810, 21298033, 9013604	Stimulate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	12565819, 18422522, 20826683, 21298033, 21763406, 22695677, 24998784, 26767514, 27791020, 28028734, 28266558, 28442538, 28826177, 28962574, 29548329, 29690885, 29915338, 30949935, 30975183, 31092047, 31098954, 31443122, 31549145, 8903852		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	17164537		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	LHGDN	17164537		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	23437333, 29141128		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	Pubtator	27448806	Stimulate	★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	18650488	Associate	★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	28174515, 29497397, 30219743, 30248528		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	17606879, 18834321, 20887379, 25847150, 26888306, 29372388, 29414152, 29805504, 30044892, 30173779, 30592963, 31680831, 31760656		★☆☆☆☆ Found in Text Mining only
Neuropathy, Painful	Neuropathy	BEFREE	17606879, 29372388		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	30524320		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	18490455, 25248876		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutropenia	Neutropenia	Pubtator	27421001, 9325020	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutrophilia (disorder)	Neutrophilia	BEFREE	11264706, 21688797, 27383371, 28801624, 30131242		★☆☆☆☆ Found in Text Mining only
Nevus comedonicus	Nevus comedonicus	BEFREE	28669805		★☆☆☆☆ Found in Text Mining only
Nevus Sebaceus of Jadassohn	Epidermal nevus syndrome	BEFREE	12687539		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	20886067, 23597429, 29164771		★☆☆☆☆ Found in Text Mining only
NIEMANN-PICK DISEASE, TYPE C2	Niemann-Pick Disease	BEFREE	29522534		★☆☆☆☆ Found in Text Mining only
Night blindness congenital stationary	Night blindness, congenital stationary	Pubtator	18186919	Associate	★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Psoriatic arthritis	Psoriatic Arthritis	Orphanet			★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	11832442, 17395331, 18469261, 18565022, 20579864, 22097889, 22658783, 25644696, 26028579, 26097546, 26212089, 26482537, 26608915, 27083404, 27309850, 27344153, 28086768, 28146130, 28265826, 28303724, 28388904, 28437890, 28600126, 28922680, 29037210, 29622764, 29697458, 29704818, 29768109, 29845362, 29860102, 30032465, 30096951, 30113661, 30137403, 30221732, 30235828, 30460863, 30470953, 30660761, 30680007, 30744124, 30824190, 30942432, 31216264, 31311491, 31324181, 31401392, 31440940, 31480575, 31602167, 31659105, 31756344		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	18455351		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10423407, 10945495, 11555578, 12434133, 16166445, 16476505, 16596276, 16707469, 17548900, 17620439, 17639997, 18078328, 18246122, 19661294, 19665818, 20388802, 20423229, 21769428, 21995493, 22541966, 23012423, 23658645, 23935876, 24969564, 25522273, 25897826, 26054751, 27016208, 27922077, 28101811, 28446126, 28599466, 28715437, 29242605, 29251323, 29312608, 29599338, 29613856, 29662549, 29720822, 29946223, 30214609, 30647851, 30659574, 30856555, 30866866, 30930968, 30956278, 30989732, 31090020, 31447002, 31466290		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	23496965, 26867523, 30193816, 30221721, 31215797		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	11732005, 17395331, 18000721, 21941003, 23009757, 23066023, 28285394, 28922680, 29684027, 30338039		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nongranulomatous uveitis	Nongranulomatous uveitis	BEFREE	31804623		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	28285148, 28483103, 30169868, 30407606, 30782515, 30836740, 31276524, 31509578		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome 1	Noonan Syndrome	BEFREE	27809499		★☆☆☆☆ Found in Text Mining only
Nuchal bleb, familial	Nuchal Bleb	BEFREE	10403784		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10050654, 10395191, 10457150, 10512379, 10672452, 10807515, 10885566, 10904006, 10954020, 11287357, 11732005, 11888514, 11916923, 12006640, 12031976, 12055326, 12149604, 12395215, 12690081, 12747594, 12855762, 15217754, 15223990, 15319168, 15650331, 16141456, 16202847, 16403817, 16421346, 16472051, 16503147, 16608891, 16731844, 17030965, 17046548, 17200772, 17438370, 17510437, 17698217, 17922949, 18278185, 18339717, 18571785, 19022640, 19188425, 19403722, 19680232, 19760027, 19808894, 20156727, 20177654, 20335630, 20382683, 20463885, 20660075, 20943789, 21111705, 21147642, 21224869, 21362361, 21386799, 21543429, 21559831, 21616679, 21660081, 21846948, 21904873, 22081334, 22106856, 22223069, 22309242, 22382194, 22408428, 22464010, 22513335, 22677195, 22835835, 22869322, 22949029, 23036713, 23080424, 23144726, 23372021, 23436919, 23756832, 24034586, 24078163, 24139907, 24285913, 24500802, 24782490, 24868113, 24961464, 25003704, 25028665, 25083576, 25384966, 25450249, 25478993, 25729992, 25921605, 25953302, 25962811, 26273678, 26472017, 26658801, 26884864, 27062372, 27083404, 27178044, 27487851, 27573980, 27840174, 27908311, 27918843, 27921254, 27966068, 28239164, 28243360, 28294290, 28402277, 28419227, 28430139, 28480767, 28489068, 28632765, 28683439, 28703289, 28724442, 28749076, 28809783, 28946816, 28985514, 28994813, 29018280, 29095915, 29165098, 29229313, 29246653, 29256014, 29365334, 29409019, 29483883, 29510322, 29632147, 29635809, 29755407, 29788214, 29860102, 29880016, 29955954, 29975666, 30137403, 30174020, 30246472, 30264458, 30350467, 30442458, 30591653, 30900134, 30904536, 30909151, 31070007, 31130918, 31198543, 31216264, 31275296, 31301539, 31420057, 31476685, 31526774, 31553329, 31577826, 31659105, 31677795, 31745566, 31817464, 7615786, 8899294, 9278582, 9287048, 9326333, 9502188, 9555938, 9609126		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	11287357, 12006640, 12690081, 12855762, 14981227, 15217754, 15489542, 15650331, 16464856, 16784178, 16968396, 17381056, 17498300, 19022640, 19196817, 19218687, 19549791, 19818126, 20156727, 20335630, 20930711, 21047923, 21147642, 21543429, 21559831, 21737013, 21846948, 21852675, 22301786, 22408428, 22949029, 23484124, 24285913, 24427296, 24428800, 24868113, 25083576, 25962811, 26113076, 26865587, 27079270, 27178044, 27735943, 27808366, 28402277, 28454543, 28887432, 28993561, 29115082, 29142617, 29256014, 29389973, 30390648, 30871547, 30871567, 30900134, 31130968, 31443599, 31546972, 32188105, 32192153, 33183332, 33678630, 33902539, 34024815, 34638889, 35219585, 35328687, 35409282, 35703718, 35712257, 36194662, 36572355, 36849131, 36897532, 37047308, 37964189, 38172514, 7615786, 7738178, 9555938	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	11328671, 20141834, 29035695, 9502777		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	15837949, 18390990, 19584886, 19633828, 19769745, 20943792, 21465273, 21558084, 22309242, 23110196, 23958744, 24262292, 25833255, 26273678, 26694359, 26884864, 27101398, 27677832, 28770317, 28994813, 30137403, 30845774, 32176045, 32469992, 33033337, 33809270, 34283808, 35390031, 35964108, 37219669, 37455922, 37658104, 39336564, 39837875, 7738205	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	24741586	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Morbid	Obesity	Pubtator	32545403	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	10457150, 20660075, 30137403, 30508579		★☆☆☆☆ Found in Text Mining only
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	BEFREE	28438992		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	16395130, 18639610, 22311210, 25256363, 28438992, 29384866, 30382535, 30594753		★☆☆☆☆ Found in Text Mining only
Ocular Cicatricial Pemphigoid	Ocular Cicatricial Pemphigoid	BEFREE	27381237		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	31415412	Stimulate	★☆☆☆☆ Found in Text Mining only
Oculovestibuloauditory syndrome	Oculovestibuloauditory Syndrome	BEFREE	29037902		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	30166590		★☆☆☆☆ Found in Text Mining only
Oligoarticular Juvenile Idiopathic Arthritis	Oligoarticular Arthritis	BEFREE	19806151, 24112428		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	12175864		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	18689851, 23465534		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	BEFREE	28114570, 28980003, 31087207		★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	1969423, 28088912, 8550811, 9443483		★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	BEFREE	30025145		★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	18164921, 19351790, 28401452, 28403570, 31076897		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	11808761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral Submucous Fibrosis	Oral Submucous Fibrosis	CTD_human_DG	16311067		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral Ulcer	Oral Ulcer	BEFREE	20576226, 22674015, 24420856		★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	1352354, 1679292, 8105683	Associate	★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	18765443, 20709566, 21917472, 23794264		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10088775, 10806049, 11352237, 15880345, 16141526, 16311048, 16492401, 16757188, 17386086, 17434489, 17945513, 18547825, 18565252, 19264156, 20515435, 21400477, 22362494, 22380539, 23036475, 23748461, 25252624, 25407789, 26713865, 26982743, 28668088, 28692119, 28912428, 29316707, 29463990, 29683034, 29763932, 29846433, 30186872, 30261513, 31055848, 31146598, 31282065, 31434236, 31812161, 32377698, 32516132, 33325525, 33495946, 33879632, 33953899, 34198264, 34735544, 34941032, 35023382, 35647200, 35937393, 36241903, 36262248, 36619785, 36681837, 36685529, 37312126, 37316888, 38157375, 39213112, 9536291	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	15731292, 21352802, 29128509, 29665766, 31042308, 32767318, 35733134, 35955467, 40429765	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	16679036, 38132170	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	33407301, 34370345	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	12932288, 32409720, 32917098, 34735544, 37573584	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	21538317, 32912331, 36216277	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	26713865		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	16282562, 19032806, 21538317, 25398219, 26350037, 28676900, 28695434, 28810618, 28829242, 29191221, 29424905, 29673544, 30134281, 30195882, 30233704, 30382270, 30663793, 31590365		★☆☆☆☆ Found in Text Mining only
Osteoarthropathy Primary Hypertrophic	Primary hypertrophic osteoarthropathy	Pubtator	28851954	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthropathy, Primary Hypertrophic	Pachydermoperiostosis syndrome	BEFREE	28851954		★☆☆☆☆ Found in Text Mining only
Osteochondritis Dissecans	Osteochondritis Dissecans	BEFREE	29384866		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	31026065		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	32096202, 32417847	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	11518271, 14606512, 19860911, 35798734	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteomyelitis	Osteomyelitis	BEFREE	31645276		★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	22975999	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	10678408, 11196702, 11329621, 14636987, 15777737, 15781582, 16126903, 17356374, 19151030, 20808842, 20920469, 21239502, 22101928, 22344264, 23691159, 23716650, 24916406, 24978678, 25326857, 25466887, 25760103, 25846459, 26503912, 27269414, 27943387, 28059444, 28289800, 28419209, 28438834, 28771604, 29046115, 29061958, 29311931, 29339399, 29435145, 29510810, 29993312, 30172945, 30597968, 30619321, 30737274, 30804932, 30806242, 30941138, 31214897, 31375349, 31404890, 31431733, 31551787, 31709730, 31758072, 31822927, 31846839		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	11196702, 12240899, 14636987, 15777737, 15797957, 16410254, 22380539, 23261243, 23460508, 23716650, 26700816, 27064449, 27401061, 28059444, 28121926, 28419209, 28496203, 28975973, 29203591, 29535527, 29571022, 30001654, 30179212, 30236554, 30387123, 30651805, 30701344, 31115543, 31273943, 31364143, 31381476, 31414225, 31551787, 31823500		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	12237295, 12396374, 12396377, 22897816, 23343370, 25384921, 29521042, 29745905, 31571846, 31887189, 32080087, 35791093, 36077598, 36311708, 36316863, 36626454, 37495941, 38184974, 38367924, 39213112, 39596387	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	LHGDN	15587751, 15797957, 16410254		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	18407820, 37038178	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	10678408, 28438834, 29046115, 29481288, 29571022, 30236554, 31433756, 31571846		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Postmenopausal	Osteoporosis	CTD_human_DG	9032749		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	10187798, 10691855, 10849374, 26097610, 30403180, 32686984, 9109391	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	12037623, 15516323, 15695400, 16691498, 20041491, 2169729, 22077664, 22355351, 22692803, 23999825, 24190483, 25335093, 25402182, 26097610, 27129149, 28448958, 28560396, 29228633, 29377600, 29476964, 29731867, 30093324, 30440055, 30591452, 31149396, 31521127		★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	17142509, 19586996, 21269505, 21818352, 26957492, 28847849, 30055742, 31176023, 9781987		★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	LHGDN	17908769		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	12018326, 21073541, 24434259, 8052085		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	LHGDN	12101072		★☆☆☆☆ Found in Text Mining only
Otosclerosis	Otosclerosis	BEFREE	16885748, 19816227, 20684053		★☆☆☆☆ Found in Text Mining only
OTULIN-related autoinflammatory syndrome	Autoinflammation, panniculitis, and dermatosis syndrome	BEFREE	28578473		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	1868469, 25677845, 27068525, 28410380		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian cysts	Pubtator	26003810	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	16908592, 26191186, 30975191, 37883761	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	22884017		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	31122524		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10053112, 11406568, 12538625, 12576447, 15047209, 15972852, 16044148, 16364318, 16505113, 19484142, 21081903, 22095071, 23634944, 24676340, 26122654, 26617713, 27068525, 27206315, 28044937, 30642295, 30697874, 8385577, 8387543		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16505113, 16908592		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10098742, 10811499, 1401076, 16908592, 23300534, 23469193, 24376747, 24676340, 25446129, 27206315, 28664898, 30697874, 3180149, 32020859, 32192517, 32441484, 32851734, 34328090, 35507102, 37800814, 8218597, 8387543, 8695362, 9681393, 9764576	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19484142, 27068525, 27458100, 37322531, 37644468	Stimulate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	17712489, 25655200		★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	26922678, 28450914, 28765945, 30196377		★☆☆☆☆ Found in Text Mining only
Panacinar Emphysema	Panacinar emphysema	CTD_human_DG	25106431		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10469042, 11590320, 11854621, 12219002, 12378118, 14560157, 15781649, 16614115, 17762760, 19444305, 19670328, 19671855, 20197756, 21187523, 21482023, 21880146, 22038233, 22990108, 24213797, 24662747, 25213764, 28160574, 28440486, 29085463, 29410961, 30011858, 31424683, 31464604, 7529022, 7882388, 8899800, 9563482		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	24091913, 25213764, 30375637, 31171367		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	12378118		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12378118, 18949385		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	16211219		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11572767, 14612914, 18163903, 21880146, 24146961, 24471499, 27143262, 30426611, 30558665, 30696421, 31424683, 32867538, 33661995, 33760162, 33804148, 34511884, 3499610, 35606086, 37575220, 38035702, 40216980, 8105469, 8430098, 9781666	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25274283	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	BEFREE	11855927, 12717265, 12888330, 14642160, 16614115, 17529903, 17981921, 19276869, 20396411, 21343291, 22579868, 23774701, 25120736, 29269298, 29512741, 30531679, 31177924, 31210708, 8674801, 9637544		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	12679941, 15714129, 16286275		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	18480551, 20396411, 22487520, 28935577	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	23608755, 31314190, 34599510	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	29436604, 30047498		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	14560157, 15841043, 15917409, 17400536, 19152246, 19276869, 24560933, 26852168, 27846147, 31506423		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	LHGDN	16407614		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	15345282, 16204077, 17666371, 25174587, 25895473, 27634200		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	Pubtator	17666371	Stimulate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	27264274, 28146444		★☆☆☆☆ Found in Text Mining only
Panniculitis	Panniculitis	BEFREE	27840174		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	10438545, 1320006, 19755523, 26289126, 29300929, 30617967, 9848725		★☆☆☆☆ Found in Text Mining only
Paralysis	Paralysis	Pubtator	24574500, 26843329	Associate	★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic syndrome	Pubtator	32771066	Stimulate	★☆☆☆☆ Found in Text Mining only
Paranoid Disorders	Paranoia	Pubtator	30254506, 30627222	Associate	★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	BEFREE	23265967, 23487197		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	2091326, 22335964, 26609200, 30466392, 33767694, 9636190	Associate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	8785452	Stimulate	★☆☆☆☆ Found in Text Mining only
PARIETAL FORAMINA	Parietal Foramina	BEFREE	30316007		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10212304, 12203044, 15120188, 17192953, 17562931, 17982884, 18284424, 18362084, 18930140, 19776336, 20880267, 20959812, 21472005, 23169921, 27624385, 27776205, 28623717, 28726961, 28821274, 28844731, 28856541, 28918840, 29054587, 29077524, 29183158, 29408778, 29478949, 29670828, 29710331, 29941879, 30041526, 30063943, 30344306, 30390673, 30400118, 30515090, 30554092, 30658122, 30815845, 30954070, 31125623, 31178335, 31228597, 31248424, 31335998, 31443122, 31654722, 31828965		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	10212304, 25481834, 27735031, 32375873, 34955458, 36301901, 38231411, 9013604	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	LHGDN	17192953, 17562931, 18678243, 18930140		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	18197754	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	21318773		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	22952715, 23745338, 24593806, 26911448, 28943632, 29710331, 31828965, 33608417, 34943986, 36306116, 36768317, 36926335, 39684585	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	29406912		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	21472005, 23212700, 28810246		★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	15194531, 15548264, 22800824, 28418828, 31099890		★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	18228126	Associate	★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	24091913, 24675460		★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	10685804, 21553055		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	29689651		★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	28384257, 29944680		★☆☆☆☆ Found in Text Mining only
Peeling Skin Syndrome	Peeling skin syndrome	Pubtator	32749463	Stimulate	★☆☆☆☆ Found in Text Mining only
Pelger-Huet Anomaly	Pelger-Huet Anomaly	BEFREE	29888601		★☆☆☆☆ Found in Text Mining only
Pemphigoid Benign Mucous Membrane	Benign mucous membrane pemphigoid	Pubtator	17488321	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	21224056, 29335495, 31001258, 35140724	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	31440247	Stimulate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	10620118, 14760938, 15650893, 22365967, 23439393, 26761187		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	LHGDN	14760938		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	14760938, 30116153, 31681304	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	14617046, 14760938, 31681304		★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	10620118, 14760938, 22365967		★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	22243485, 31602227		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	11781708, 17201881, 17667716, 19276869, 20586862, 25368751, 27990709, 29456060		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	12121897, 25368751, 33399167	Associate	★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	LHGDN	17667716		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	29022128, 30390972, 30756431		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical periodontitis	Pubtator	29898177	Associate	★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical periodontitis	Pubtator	35300329	Stimulate	★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	29384263		★☆☆☆☆ Found in Text Mining only
Periodic syndrome	Periodic Syndrome	BEFREE	10902757, 15630744, 17950649, 19180495, 19381634, 26598380, 28942479		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	10551423, 10685363, 12828656, 14723749, 15142214, 16677285, 18355201, 18435806, 19076989, 19948942, 20059422, 22691114, 23079986, 23368949, 23657600, 24905365, 25647273, 27755954, 27976595, 27987116, 28063227, 28282558, 28637991, 28800160, 28833486, 28906456, 28946056, 29740515, 29889832, 30158833, 30321542, 30405072, 30536725, 31214897, 9379326, 9609372		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	LHGDN	17763921		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	18435806, 20679442, 23368949, 27815441, 28637950, 30890897, 35665507, 39337647, 9605989	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	11846846, 12795791, 15142214, 16677285, 17944678, 18355201, 18363738, 19148387, 20718895, 21846573, 23079986, 23657600, 23973890, 24370191, 24905365, 26825585, 27283324, 27505147, 27739344, 27815441, 27858556, 27976595, 27982724, 28123644, 28244247, 28477234, 28492359, 28621056, 28776753, 28851350, 28886588, 28904316, 28964840, 28985543, 29129647, 29195233, 29240821, 29280184, 29460020, 29740515, 29993312, 30187338, 30366216, 30384973, 30536725, 30640129, 30719451, 30982988, 31055000, 31355282, 31461798, 31769563		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	LHGDN	18543247		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	23046796, 28341818, 28736819, 31978095, 32618013, 37986309	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	32130362, 34213019, 34484192, 34502071, 35665507	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	19778662, 32835907	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	25095746, 28406704	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	18835531, 19778662, 25095746, 28406704, 28789654, 30773823		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	25095746, 28789654		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	17828345	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	19608431, 26431782, 26797519, 28233109, 28251164, 30337056		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	27981790	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	19608431, 26431782, 26797519, 28251164, 30337056		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	12648503, 26719098		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	18835531		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	11135059, 21589907, 26453957, 39739693, 8807591	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	23392590, 26069103	Stimulate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	34360900	Inhibit	★☆☆☆☆ Found in Text Mining only
PEROXISOME BIOGENESIS DISORDER, COMPLEMENTATION GROUP A	Zellweger Syndrome	BEFREE	31190087		★☆☆☆☆ Found in Text Mining only
Peroxisome biogenesis disorders	Zellweger Syndrome	BEFREE	11401868		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	28007470		★☆☆☆☆ Found in Text Mining only
Petechiae	Petechiae	BEFREE	23925283		★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	18455351		★☆☆☆☆ Found in Text Mining only
Pharyngitis	Pharyngitis	BEFREE	20353817		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	17102096, 31738032		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	28438992		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	11399938, 16979413, 22105495, 27050952, 28125840, 28558009, 28914577, 29084332		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	29980532		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	30165750		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	27050975	Associate	★☆☆☆☆ Found in Text Mining only
Pleoconial Myopathies	Pleoconial myopathy	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Pleocytosis	CSF pleocytosis	BEFREE	30052102		★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural Diseases	BEFREE	17942913		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	CTD_human_DG	2518282		★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	CTD_human_DG	11181422		★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	18368292, 29973541, 31654745		★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	27345569, 30972576		★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	BEFREE	11975986, 12011375, 12672181, 16539828, 18205195, 19811297, 26195802, 28480797, 29475857, 29962245		★☆☆☆☆ Found in Text Mining only
POLYCYSTIC KIDNEY DISEASE 1	Polycystic kidney disease	BEFREE	16741147		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	Pubtator	26666710	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	28185403		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	18552856, 23990677, 28604386, 31790890		★☆☆☆☆ Found in Text Mining only
POLYCYSTIC LIPOMEMBRANOUS OSTEODYSPLASIA WITH SCLEROSING LEUKOENCEPHALOPATHY 1	Polycystic Lipomembranous Osteodysplasia With Sclerosing Leukoencephalopathy	BEFREE	30690291		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	10050654, 12161545, 12396555, 21970639, 22607892, 22945299, 23975191, 24512496, 25083576, 25246119, 25690158, 27323168, 27381237, 27578290, 27634381, 28082237, 28294594, 28337819, 28480767, 28619389, 28946816, 28949260, 28993561, 29306057, 29359480, 29456813, 30134857, 30590569, 30963410, 31005728, 31039949, 31148852, 31170164, 31185755, 31399035		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	12161545, 21970639, 23975191, 25083576, 26979943, 28949260, 28993561, 30975191, 34967266, 35485360, 35551681, 36793022, 37140276	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	12396555, 15985479		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	23118428, 28868943, 30134857, 32140727, 34873972	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	24463275, 30703493		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	24463275, 34059095	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	35025147	Stimulate	★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	11246532, 22964479, 30066937, 30953065		★☆☆☆☆ Found in Text Mining only
Polyglandular Type I Autoimmune Syndrome	Polyglandular autoimmune syndrome	BEFREE	21962774		★☆☆☆☆ Found in Text Mining only
Polymyalgia Rheumatica	Polymyalgia rheumatica	Pubtator	10943865, 22004920	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	10399751, 10805105, 11055823, 12147628, 15338498, 15577608, 16895750, 16970978, 17586554, 19953283, 22324944, 30645753		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis	Polymyositis	LHGDN	17408448		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis	Polymyositis	Pubtator	19953283	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis	Polymyositis	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis Ossificans	Polymyositis Ossificans	CTD_human_DG	7979221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis, Idiopathic	Polymyositis	CTD_human_DG	7979221		★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	16775170		★☆☆☆☆ Found in Text Mining only
Porphyria Cutanea Tarda	Porphyria Cutanea Tarda	BEFREE	23109461		★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	22637703, 29263339, 29929914		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	LHGDN	19107725		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	21714072, 28160694, 28521179, 28933225, 28958613, 29197197, 30127754, 30544002, 30711869, 31063551, 31280036, 31352811		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	29975666		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	23499421, 24798719, 26090405		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	16293872, 25545232, 28646023, 8417962		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	LHGDN	17495957		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	19737931, 20670671, 31722554, 31755306		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	22884017		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	11506397, 12782345, 14615042, 15271127, 15832029, 19618378, 19836613, 21509504, 30150062, 31145377, 31414991, 31497846, 8498837, 8943206, 9119960		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	17192785		★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	BEFREE	28403570		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	10068101, 10365808, 10453936, 10515837, 12911663, 15856047, 1684248, 16938647, 19758199, 20578265, 23011034, 26644386, 8706330		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	31118164		★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	31030304		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	29749399, 30718771, 31297883		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	10068102, 11454808, 12612912, 29655972, 31665288		★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	31410161		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	30390673		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	22105495, 25634985, 27050952, 28271611, 28558009, 28914577, 29084332		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	20663564, 22820188, 23258148, 29263305, 29296073, 7843589		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	29095436	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10751892, 10815922, 10953159, 11289153, 11568974, 11909978, 12351634, 12663665, 12907654, 1319775, 14617795, 15131058, 15210850, 15252141, 15263792, 15466204, 15545300, 15564138, 15862966, 15904673, 17893044, 18174250, 18196539, 18752500, 19099590, 19846139, 19895686, 19934328, 20482316, 20599703, 21097678, 21237555, 21270144, 21326202, 21540577, 22355351, 22426894, 22923157, 22955280, 23065208, 23247106, 24037407, 24058525, 24292881, 24666463, 24970477, 25409762, 26164758, 26198640, 26327448, 26337231, 26480897, 27102235, 27345628, 27941876, 28115787, 28223102, 28910408, 29441606, 29575464, 29899325, 29969844, 30027097, 30349042, 30817944, 30824526, 31667686, 31718684, 8899002, 9917088		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	34975070	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	37378942	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10360641, 10391095, 14523021, 15240830, 15477368, 1615580, 17200141, 17259348, 17712489, 17975021, 18561328, 19099590, 19123467, 19811499, 19934328, 20566643, 21430300, 21596021, 21904110, 22469032, 22475653, 23593410, 24885093, 25790448, 27672034, 28223102, 29575464, 29896191, 30027097, 30488530, 30824526, 33569050, 34399719, 34475205, 35369035, 36124532, 36371231, 37378942, 38087324, 9407088	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	10580840, 12351634, 15477874, 16467113, 21052099, 24910874		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19099590	Stimulate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	14613268	Stimulate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	16555943, 28963877, 8258957	Associate	★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	26922678, 28450914, 28765945, 30196377		★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	33982552	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	11455194, 12834858, 16938647, 17052277, 18190648, 18773295		★☆☆☆☆ Found in Text Mining only
Pseudohypoaldosteronism	Pseudohypoaldosteronism	BEFREE	28611771		★☆☆☆☆ Found in Text Mining only
Pseudohypoparathyroidism, Type Ia	Pseudohypoparathyroidism	BEFREE	17962410		★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	15186319, 23359500, 27747869, 28940220, 31362906		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	10469306, 10844563, 11298547, 11851889, 12011375, 12234707, 12653732, 12709814, 12763679, 12789169, 12828754, 14981113, 15086336, 15186319, 15251081, 15888146, 16081850, 16424170, 16441627, 1702929, 17074928, 17093502, 17244977, 17530646, 17553030, 17637826, 17671512, 17928893, 18209089, 18296259, 19568223, 19895991, 20050849, 20112373, 20444206, 20931685, 21085185, 21317854, 21346775, 21574971, 21672030, 21923840, 22111980, 22113471, 22158445, 22909235, 23274341, 23337970, 23359500, 23662788, 23677169, 23731727, 23834030, 23890755, 23946436, 24019554, 24048425, 24120361, 24135300, 24206262, 24211183, 24252077, 24324571, 24476008, 24587411, 24594293, 24802997, 25361234, 25384035, 25403996, 25496073, 25537528, 25679113, 25692775, 25946554, 26071216, 26267733, 26321488, 26415694, 26470763, 26563541, 26584427, 26613086, 26707913, 26780035, 26854129, 27043841, 27044681, 27096382, 27239673, 27258623, 27376466, 27451931, 27524442, 27538000, 27554821, 27571340, 27576147, 27627098, 27670766, 27720274, 27747869, 27774694, 27777066, 27793094, 27881030, 27894789, 27943384, 28077577, 28093730, 28109175, 28211161, 28217129, 28235443, 28239238, 28258057, 28271735, 28272075, 28386763, 28421729, 28477389, 28530223, 28547750, 28638112, 28643328, 28696418, 28704992, 28735613, 28737221, 28770513, 28809993, 28818461, 28837372, 28899951, 28940220, 28942364, 29023827, 29035933, 29062018, 29171393, 29173945, 29182760, 29193791, 29267456, 29299984, 29314201, 29334162, 29334280, 29389950, 29424306, 29428424, 29438576, 29455561, 29464730, 29477734, 29499292, 29535706, 29564871, 29575262, 29661487, 29676778, 29736839, 29737208, 29743640, 29751529, 29792084, 29802736, 29848153, 29859926, 29881431, 29914850, 29938921, 30004583, 30015892, 30016379, 30024620, 30030151, 30037762, 30066937, 30168849, 30206447, 30215629, 30224457, 30288872, 30307657, 30321197, 30372845, 30398009, 30430682, 30515970, 30555460, 30576759, 30579425, 30648836, 30654308, 30662676, 30672612, 30729703, 30839343, 30858782, 30893386, 30916734, 30953507, 30972872, 31012218, 31017250, 31017270, 31089365, 31094242, 31101850, 31240749, 31384317, 31384319, 31389789, 31424708, 31457011, 31485004, 31491865, 31502279, 31623470, 31639088, 31639514, 31646743, 31672774, 31673756, 31719235, 31751564, 31775137, 9326391		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	10469306, 10844563, 11851889, 12746914, 16409917, 16567387, 16831294, 1702929, 17530646, 17637826, 17928893, 18385757, 18669614, 19895991, 2002254, 20074459, 20653771, 21085185, 21346775, 23677169, 23732752, 24635218, 25333715, 25525775, 26613086, 26806281, 27088930, 27117051, 27438197, 27552000, 27627098, 28239238, 28942364, 29062018, 29143979, 29182760, 29389950, 29477734, 29696068, 29803800, 30030151, 30246571, 31577850, 32832675, 32962477, 33015854, 33114187, 33153894, 33982552, 34001401, 34992498, 35563587, 35886575, 36288286, 36833372, 37531036, 38003437, 7923918, 8721479, 9326391	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	16844318, 7744320		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	17053845, 21681565, 24587411, 28045034, 34691360, 35848967	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	LHGDN	17553030, 18385757, 18463678		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	26559252, 34001566	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	11851889, 12234707, 14657629, 17101473, 17182220, 17530646, 17553030, 19895991, 23717605, 23834030, 25200589, 28093730		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	24743863	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	28285148, 28483103, 30169868, 30407606, 30782515, 30836740, 31276524, 31509578		★☆☆☆☆ Found in Text Mining only
PTEN Hamartoma Tumor Syndrome	PTEN Hamartoma Tumor Syndrome	BEFREE	24379584		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	15184943, 27314284, 28803935		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	12376215, 21905008, 33531453, 37516840	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	20808962, 34238983	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28084316, 30367500, 30409216, 31692724		★☆☆☆☆ Found in Text Mining only
Pulmonary Cystic Fibrosis	Pulmonary Cystic Fibrosis	BEFREE	11591888		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	10706492, 12537602, 12765422, 15544629, 15817713, 16867312, 16971410, 17631613, 18256059, 19480658, 20075389, 21691053, 21840694, 21985478, 22183488, 23212542, 23267696, 23731729, 24818527, 24841653, 24975928, 25155252, 26170653, 26617776, 26620975, 26932696, 27035424, 27729782, 28178340, 28185567, 28526090, 29390434, 29497291, 29535517, 30178857, 30280794, 30676127, 31696490, 32160903, 32342557, 32842623, 33748274, 34125980, 34435653, 34479474, 34785892, 35064606, 37307368, 38412768, 7843076	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	15337792, 16029496, 16135718, 17626109, 18202163, 20351031, 20500811, 20529083, 20856828, 26809128, 27199554, 27274225, 27524865, 27883019, 30655663, 33590951, 34007171, 35553638	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	24465776	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	34483727	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	11796828, 12537602, 12661999, 23793505, 25172913, 28749079, 29329251, 30763575, 31191356		★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	CTD_human_DG	25106431		★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	28624607		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	11394717, 16324872, 17266442, 25216247, 26368622		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	12030733, 12816730, 17205112, 18312678, 20486865, 21633916, 25680454, 28731277, 28921394, 29093191, 29278701, 29623041, 29670467, 29793317, 30816470, 7684963, 9750937		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	12816730		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	20507572, 33832291, 34775492, 37898439	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pustular psoriasis	Pustular Psoriasis	BEFREE	30219743, 30246571		★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	BEFREE	10519368, 11019918, 12691703, 29611085, 29705819		★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	16844318, 7744320		★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	20636397, 22161697, 25501066	Associate	★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	21658319	Stimulate	★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma Gangrenosum	BEFREE	22161697, 30592563, 30604927		★☆☆☆☆ Found in Text Mining only
Pyogenic arthritis pyoderma gangrenosum and acne	Pyogenic arthritis-pyoderma gangrenosum-acne syndrome	Pubtator	22161697	Associate	★☆☆☆☆ Found in Text Mining only
Pyogenic Arthritis, Pyoderma Gangrenosum and Acne	Pyogenic Arthritis, Pyoderma Gangrenosum And Acne	BEFREE	15580218, 22161697		★☆☆☆☆ Found in Text Mining only
Quadriplegia	Quadriplegia	BEFREE	16522396		★☆☆☆☆ Found in Text Mining only
Raynaud Disease	Raynaud disease	Pubtator	22057071	Associate	★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	18001298, 25736140, 9098928		★☆☆☆☆ Found in Text Mining only
Reactive hypoglycemia	Reactive hypoglycemia	CTD_human_DG	8774068		★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	28834898, 30400666		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	28394749, 28575042		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	20630669		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	9681346		★☆☆☆☆ Found in Text Mining only
Recurrent otitis media	Otitis media	BEFREE	17142509		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	10221507, 12595628, 15571066, 15695296, 15860935, 16951485, 17207378, 18379788, 19443940, 19790066, 21813066, 24489016, 26339358, 26364660, 26792343, 28255642, 28407127, 28595367, 29422529, 29803792, 30232372, 30289537, 30289538, 30289539, 30289540, 30421069, 31143951, 31260948, 31376333, 31469238, 31691828		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Refractory anemias	Anemia	CTD_human_DG	10870480		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Regional enteritis	Crohn Disease	CTD_human_DG	10700533, 21829567		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	19164706, 24788726, 28257574		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11176446, 1389482, 1404666, 15572731, 15614529, 15814620, 1596939, 16635513, 1739130, 19164706, 20566746, 22707636, 24530290, 24788726, 27603297, 28257574, 28362712, 28599476, 28915665, 29796174, 30466107, 8189599, 8483246, 8894681		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	12640117, 14534724, 17475896, 18294286		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	22813949, 27365897, 28507324, 28875388, 30342194		★☆☆☆☆ Found in Text Mining only
Renal hypertension	Renal Hypertension	BEFREE	30359461		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	11244168, 14613268, 25243815, 31637265, 9767525		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	LHGDN	18573564		★☆☆☆☆ Found in Text Mining only
Renpenning syndrome 1	Renpenning Syndrome	BEFREE	28948356		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	20011590, 21357384, 21437888, 28859607		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	28298812		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	1883957, 21784970, 22507624, 23911438, 27670109, 28243236, 28298812, 28599503, 28642115, 28816340, 28962107, 29520236, 29606872, 30178862, 30584968, 30651808, 30692512, 31261506, 31696241, 9880689		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	17314689, 28298812		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	11401880, 18815552		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	20011590, 21437888		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	21357384, 21437888, 29172674, 35456412, 37958799, 38179046, 7813103	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Respiratory Tract Diseases	Respiratory Tract Diseases	CTD_human_DG	22414385		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	20627090, 27508393, 34987646, 38084427, 7670115	Associate	★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	30470307		★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	7812976		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	29215050		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	34794403	Inhibit	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	11640992, 15541048, 17065527, 24408972, 26527057, 26710229, 28767589, 30944099, 31834153, 9157089		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	CTD_human_DG	19324842		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	22266116, 25073020, 25086184	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	25675437, 37924741	Stimulate	★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	31814701		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	29242588		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	37656622, 39472110	Stimulate	★☆☆☆☆ Found in Text Mining only
RETINITIS PIGMENTOSA 27	Retinitis Pigmentosa	BEFREE	31639404		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	11463453, 14681231, 23339186		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	15133451	Associate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	15161830, 29260199, 29274846, 30225217		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	40084286	Associate	★☆☆☆☆ Found in Text Mining only
Retinoschisis	Retinoschisis	Pubtator	33601057	Associate	★☆☆☆☆ Found in Text Mining only
RETINOSCHISIS 1, X-LINKED, JUVENILE	Retinoschisis, X-Linked	BEFREE	30796650		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	11267936	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	11726199, 15475455, 17043658, 23294492, 24190483		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	23191987, 23797008, 24190483	Associate	★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	20663564, 28600710		★☆☆☆☆ Found in Text Mining only
Rheumatic Fever	Rheumatic fever	Pubtator	22004920, 35979368	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatic Fever	Rheumatic fever	Pubtator	40226625	Inhibit	★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	12892736, 16046099, 16467041, 17607501, 17804571, 19902201, 20563362, 23168096, 24751687, 27118427		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	15509528	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	LHGDN	17607501		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10088765, 10090156, 10204847, 10229398, 10332964, 10402163, 10431483, 10446857, 10450517, 10488748, 10616020, 10632674, 10685365, 10733472, 10765919, 10773354, 10817564, 10817565, 10836523, 10852383, 10857796, 11039782, 11056676, 11094425, 11170743, 11174466, 11196668, 11212177, 11229458, 11229461, 11269532, 11393661, 11406520, 11406522, 11407686, 11426322, 11454644, 11465706, 11465707, 11502070, 11508576, 11508580, 11685652, 11764389, 11791643, 11822409, 11824966, 11824970, 11838837, 11879547, 11920402, 11947922, 11966774, 12062421, 12077707, 12115244, 12148597, 12165799, 12209507, 12233877, 12375327, 12415586, 12508775, 12528108, 12571841, 12595628, 12651614, 12687539, 12687542, 12714388, 12730506, 12730509, 12750939, 12763679, 12794819, 12847678, 12847684, 12913922, 12960479, 12965196, 1320571, 14558084, 14613268, 14657510, 14687710, 14718605, 14962963, 14975191, 14994383, 15004722, 15104599, 15248209, 15361394, 15370717, 15498798, 15517620, 15517632, 15535838, 15571066, 15593196, 15640148, 15642135, 15684417, 15685549, 15692975, 15693080, 15695296, 15725578, 15743471, 15853915, 15899029, 15903021, 15940758, 15977405, 16013998, 16099338, 16142749, 16142751, 16154193, 16207322, 16277668, 16277680, 16277688, 16292516, 16331752, 16446172, 16507118, 16511915, 16519794, 16707469, 16720219, 16720636, 16774691, 16802346, 16820934, 16863659, 16881868, 16909270, 16947381, 16947419, 16951485, 1698773, 17054552, 17075836, 17122966, 17124250, 17143972, 17207378, 17216674, 17254348, 17265480, 17265482, 17314215, 17328045, 17343250, 17393389, 17408492, 17426140, 17456524, 17514770, 17530675, 17562093, 17569750, 17589850, 17599732, 17599736, 17609389, 17631742, 17638513, 17673491, 17710405, 17763852, 17824960, 17890271, 17896807, 17963166, 17963503, 17967830, 17968879, 18042642, 18050183, 18086728, 18205195, 18221983, 18309487, 18316202, 18348311, 18379788, 18381799, 18385279, 18427872, 18438841, 18438844, 18438857, 18461057, 18549443, 18634161, 18678578, 18681777, 18728048, 18759306, 18759964, 18772191, 18797411, 18820032, 18824582, 18975340, 19002558, 19117726, 19126414, 1914237, 1915559, 19242068, 19365401, 19389237, 19411391, 19443940, 19582456, 19660107, 19758178, 19779724, 19790066, 19804846, 19809821, 19822042, 19877072, 19895991, 19918040, 19926672, 19966089, 20003451, 20030635, 20032971, 20039412, 20053934, 20059371, 20080912, 20096109, 20112363, 20112373, 20187130, 20194454, 2026869, 20300049, 20309874, 20444206, 20444755, 20448286, 20472598, 20473500, 20478724, 20491788, 20555356, 20580552, 20593016, 20604932, 20609223, 20609399, 20664576, 20665032, 20691091, 20805296, 20886274, 20952465, 21039421, 21068383, 21109521, 21129157, 21179534, 21187297, 21296193, 21304506, 21337318, 21362769, 21373785, 21383200, 21393509, 21420089, 21423713, 21431944, 21452922, 21471444, 21549221, 21611196, 21633911, 21690378, 21708014, 21742641, 21777909, 21806780, 21813066, 21905018, 21952740, 21952924, 22039170, 22040886, 22044414, 22055894, 22093807, 22121133, 22129793, 22166956, 22196377, 22210441, 22246057, 22249931, 22258493, 22264405, 22354754, 22364134, 22402800, 22480748, 22532631, 22540992, 22562984, 22614743, 22650374, 22660986, 22661088, 22682473, 22685579, 22736176, 22753658, 22760475, 22762939, 22884682, 22927710, 22992305, 23007924, 23024462, 23092582, 23148991, 23217265, 23233654, 23264340, 23272690, 23280137, 23280418, 23294975, 23294992, 23295110, 23321589, 23322460, 23326596, 23327497, 23328930, 23335080, 23348744, 23480184, 23496259, 23517397, 23628802, 23632129, 23651021, 23684916, 23687262, 23746537, 23774171, 23784913, 23880957, 23912906, 24016860, 24040234, 24065540, 24078690, 24144456, 24234752, 24286116, 24286242, 24306269, 24321457, 24351865, 24382334, 24437572, 24489016, 24523570, 24534470, 24535543, 24558177, 24574213, 24574215, 24587984, 24612463, 24618052, 24634219, 24673827, 24720504, 24721042, 24728031, 24832108, 24833787, 24883332, 24884566, 24885217, 24967817, 24997655, 2505790, 25085274, 25114059, 25125695, 25167216, 25200589, 25263964, 25311255, 25348220, 25359150, 25371395, 25387578, 25403996, 25436214, 25452308, 25460501, 25510954, 25522907, 25561237, 25647275, 25652333, 25684197, 25707877, 25708025, 2573586, 25760103, 25817699, 25823782, 25848939, 25885039, 25896534, 25896535, 25919528, 25941031, 25959608, 26003199, 26071216, 26079957, 26093279, 26095630, 26103543, 26111149, 26125752, 26130073, 26149185, 26152731, 26166764, 26177310, 26247485, 26265114, 26296700, 26321488, 26339358, 26352810, 26362732, 26364660, 26440629, 26453102, 26521731, 26558442, 26560845, 26570984, 26658436, 26776603, 26792343, 26814849, 26844569, 27058440, 27072520, 27074847, 27126784, 27143107, 27172254, 27180831, 27255643, 27258623, 27273801, 27307502, 27342458, 27391352, 27413250, 27434862, 27435242, 27456070, 27567553, 27567629, 27589926, 27598995, 27619991, 27639923, 27665099, 27692391, 27731365, 27733572, 27733582, 27736946, 27748629, 27749227, 27777170, 27779104, 27787574, 27788309, 27820799, 27824863, 27830969, 27846751, 27860410, 27912794, 27920336, 27926504, 27931158, 27942977, 27943122, 27974105, 27992692, 28010149, 28032317, 28045034, 28068848, 28086756, 28107378, 28112584, 28113136, 28119289, 28120218, 28124979, 28132102, 28150360, 28165872, 28187781, 28199970, 28202745, 28205331, 28209985, 28212115, 28213049, 28215564, 28217871, 28239238, 28245350, 28245522, 28255642, 28260984, 28275260, 28286757, 28288327, 28288508, 28288790, 28295853, 28306596, 28314855, 28316377, 28336735, 28339004, 28352145, 28391344, 28392572, 28401267, 28407127, 28409894, 28412710, 28425772, 28426141, 28442538, 28448562, 28455580, 28461642, 28463788, 28472734, 28482701, 28484887, 28485187, 28488248, 28490617, 28506320, 28506571, 28506920, 28524434, 28530020, 28547815, 28552525, 28553958, 28570437, 28573370, 28577436, 28579757, 28594252, 28595367, 28597133, 28600618, 28604144, 28606961, 28608166, 28619088, 28622454, 28627619, 28658716, 28662934, 28674959, 28677621, 28690029, 28692770, 28700520, 28708839, 28719435, 28729087, 28734661, 28737121, 28737645, 28738524, 28742141, 28748515, 28770517, 28770826, 28771604, 28775366, 28776300, 28782994, 28783661, 28794503, 28800780, 28806729, 28819701, 28820959, 28833486, 28837372, 28837666, 28849205, 28850026, 28860618, 28861167, 28865493, 28866647, 28869414, 28871338, 28880683, 28884785, 28888761, 28898138, 28904316, 28906466, 28941039, 28941216, 28975211, 28978352, 28980085, 28986307, 29028148, 29038247, 29039054, 29042029, 29043871, 29046115, 29055489, 29062314, 29063463, 29067885, 29080328, 29082659, 29093151, 29094311, 29101675, 29134891, 29140972, 29149648, 29150565, 29158574, 29172405, 29173945, 29184553, 29191214, 29191820, 29197963, 29209219, 29217191, 29224127, 29226077, 29229311, 29237438, 29247146, 29254845, 29288410, 29314738, 29317823, 29328500, 29329557, 29341486, 29348703, 29352843, 29352846, 29363647, 29367417, 29391796, 29394098, 29404725, 29404828, 29422529, 29432051, 29434816, 29456830, 29458278, 29465348, 29465355, 29471588, 29495891, 29510810, 29518978, 29535527, 29540195, 29541795, 29550477, 29553845, 29563337, 29569514, 29575262, 29600354, 29614335, 29623390, 29626269, 29636466, 29652655, 29667330, 29687421, 29693122, 29693176, 29694426, 29706965, 29708588, 29730637, 29734345, 29743640, 29744553, 29748156, 29751165, 29752727, 29752913, 29760711, 29764964, 29771256, 29771477, 29776906, 29777367, 29786138, 29790131, 29791439, 29792084, 29801753, 29803792, 29808722, 29850502, 29852739, 29855172, 29859232, 29872265, 29881431, 29889832, 29895751, 29897007, 29920650, 29941879, 29949166, 29990875, 30001644, 30008151, 30020997, 30022333, 30047845, 30075997, 30079020, 30086795, 30096164, 30100905, 30105374, 30106091, 30106887, 30113458, 30132358, 30140263, 30142537, 30167920, 30221485, 30227885, 30230962, 30232372, 30287909, 30289537, 30289538, 30289539, 30289540, 30304567, 30314507, 30323820, 30342345, 30352759, 30358109, 30358982, 30367550, 30369929, 30378113, 30400666, 30402698, 30402834, 30413189, 30415451, 30417444, 30418120, 30418124, 30421069, 30421104, 30423415, 30430682, 30431436, 30465159, 30468406, 30476367, 30485517, 30488533, 30498756, 30506403, 30510188, 30526655, 30542493, 30545393, 30552833, 30557124, 30568660, 30570833, 30587928, 30591403, 30599401, 30630756, 30637590, 30648758, 30649521, 30655563, 30663847, 30666255, 30675683, 30696478, 30697037, 30698113, 30700574, 30718650, 30723161, 30727927, 30730220, 30732563, 30733963, 30745461, 30762811, 30778120, 30801951, 30818333, 30828336, 30844558, 30848077, 30858707, 30862896, 30875456, 30890451, 30897335, 30899307, 30900933, 30916218, 30941119, 30953327, 30954969, 30965588, 30967248, 30969024, 30971924, 30988705, 30999929, 31010320, 31012365, 31028551, 31036624, 31038654, 31049403, 31049794, 31050750, 31065895, 31068444, 31071076, 31077735, 31087226, 31089365, 31096451, 31097419, 31105703, 31143951, 31148057, 31154413, 31165341, 31171024, 31179526, 31197255, 31199978, 31208307, 31220991, 31234900, 31240234, 31245894, 31258709, 31260948, 31261500, 31280937, 31308625, 31311386, 31312201, 31318607, 31338093, 31339961, 31376333, 31397188, 31404890, 31408840, 31414225, 31433756, 31452079, 31457011, 31462329, 31469238, 31473844, 31474599, 31498069, 31513665, 31520227, 31523049, 31545398, 31555281, 31555283, 31587925, 31631790, 31632872, 31638264, 31644961, 31645276, 31659014, 31663465, 31666999, 31670976, 31687411, 31691828, 31712980, 31727153, 31758423, 31770089, 31779849, 31780864, 31787605, 31791585, 31801395, 31801802, 31812161, 31813561, 31814481, 31818460, 31820713, 31823140, 31830775, 31842396, 31845616, 7614782, 7622181, 7668906, 7809909, 8163935, 8216423, 8507217, 8582358, 8641702, 8670318, 8751869, 9002044, 9027971, 9032818, 9098456, 9117172, 9189051, 9255106, 9292787, 9331953, 9375863, 9378125, 9485208, 9525978, 9568723, 9653166, 9671990, 9717978, 9932110		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	11725485, 11838837, 11861275, 12067756, 12091338, 12528108, 14979058, 15723199, 15725578, 16446172, 16564576, 16569263, 16751383, 16820934, 16936264, 17343250, 17562093, 17631742, 17763921, 17896809, 18381799, 18668547, 18797411, 19017992		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	12566094, 2001072, 22450443, 8391952		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	17804836		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis Systemic Juvenile	Juvenile idiopathic arthritis	Pubtator	10616003	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	18201469		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis	Rhinitis	Pubtator	18201469	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	21313996, 23472126, 24654309, 34477124, 37430199	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	31185305, 38022554	Stimulate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic Seasonal	Seasonal allergic rhinitis	Pubtator	18201469	Stimulate	★☆☆☆☆ Found in Text Mining only
Rhinitis, Allergic, Perennial	Rhinitis	BEFREE	29109963		★☆☆☆☆ Found in Text Mining only
Right ventricular failure	Ventricular Failure	BEFREE	10899097		★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	30518018		★☆☆☆☆ Found in Text Mining only
Sacroiliitis	Sacroiliitis	BEFREE	15630744, 25835314, 27994095		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	16900776	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	16831928, 22480748, 27749227, 29411182, 29893926, 31321485, 31371659, 31672774		★☆☆☆☆ Found in Text Mining only
Sandhoff Disease	Sandhoff Disease	BEFREE	23727835		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	10400819, 10547277, 11243953, 11411907, 11587099, 11806841, 11956055, 12735669, 15713215, 17768594, 18062795, 19225544, 20070603, 20722470, 21319595, 22759465, 24197700, 24244632, 24558177, 24604725, 26164297, 27158798, 27591675, 27929051, 28223750, 28392046, 28469621, 28558009, 28564695, 29054587, 29496351, 30446173, 30839343, 31804623, 7663784, 8179912, 9344512		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	10400819, 11091281, 11411907, 11641969, 11817671, 12449172, 18451575, 18654018, 19225544, 21508170, 22195005, 22759465, 23745338, 24558177, 25866780, 32476962, 34399367, 38173720, 39284999, 7905208	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	LHGDN	12039524, 15713215, 17768594, 18451575		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	16889950, 20851927, 27929051	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	10400819, 26797030	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	12149303, 12763223, 12916466, 18065405, 19577358, 27884671, 29757258, 30170620		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	CTD_human_DG	15675481, 16767912, 17203757, 9794839		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	18065405, 2602359, 35069780, 8595164	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	22719951, 36005179	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Ewing	Sarcoma	Pubtator	15581626, 16857678, 9201246	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	34440851	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	34941134, 8669484	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	24373201	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	38217541	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	CTD_human_DG	15675481, 16767912, 17203757, 9794839		★☆☆☆☆ Found in Text Mining only
Sarcoma, Spindle Cell	Sarcoma	CTD_human_DG	15675481, 16767912, 17203757, 9794839		★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	24285913, 40162588	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11244489, 12451465, 12648734, 12839521, 12898567, 14623370, 14623371, 14643088, 14767724, 15276234, 15340354, 15927374, 16252073, 16503400, 16932925, 17140746, 17171665, 17234379, 17559942, 18515978, 19939410, 20067853, 20132993, 21127983, 21967963, 22227290, 22832610, 23212700, 23265967, 23453739, 26491028, 27840055, 27886578, 28049760, 28342013, 28442912, 29074356, 29306772, 29529289, 29633506, 29680514, 29969604, 30254506, 30268704, 30519766, 30627222, 30855153, 31053623, 31211828, 31473906, 9270565		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	14623370, 14623371, 14767724, 15340354, 15927374, 16027740, 17171665, 17234379		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	15340354, 24743863, 25433960, 27169466, 28049760, 28117656, 30254506, 30627222, 31954374, 36462601	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	16478754		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	20132993, 30630651	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	22832610, 37075652	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia Paranoid	Schizophrenia	Pubtator	30627222	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia Spectrum and Other Psychotic Disorders	Schizophrenia	Pubtator	15340354	Associate	★☆☆☆☆ Found in Text Mining only
Schnitzler Syndrome	Schnitzler Syndrome	BEFREE	23527164, 30339714		★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	29400697, 29713456		★☆☆☆☆ Found in Text Mining only
Scleritis	Scleritis	BEFREE	30862619		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	10809757, 14872499, 17084440, 28884475, 29339444, 31552041, 7636301, 8466280		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	CTD_human_DG	9843018		★☆☆☆☆ Found in Text Mining only
Scleroderma Localized	Scleroderma	Pubtator	38324287	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	11710721, 14872499, 15642145, 1569319, 21905008, 33922041, 9540985	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	38051374	Stimulate	★☆☆☆☆ Found in Text Mining only
Seborrheic dermatitis	Seborrheic dermatitis	BEFREE	21765951		★☆☆☆☆ Found in Text Mining only
Seborrheic keratosis	Seborrheic keratosis	BEFREE	11899142		★☆☆☆☆ Found in Text Mining only
Secondary hypothyroidism	Hypothyroidism	BEFREE	23716650		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	11045427		★☆☆☆☆ Found in Text Mining only
Secondary Trigeminal Neuralgia	Trigeminal neuralgia	CTD_human_DG	27093858		★☆☆☆☆ Found in Text Mining only
Seizure, Febrile, Complex	Seizure	BEFREE	31709864		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	29729582, 30700814, 35598439	Associate	★☆☆☆☆ Found in Text Mining only
Seizures Febrile	Seizures	Pubtator	29729582, 34449141, 38218765	Stimulate	★☆☆☆☆ Found in Text Mining only
Selective immunoglobulin A deficiency	Selective Immunoglobulin A Deficiency	BEFREE	10852388, 12738467		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	17220333		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	37242266	Associate	★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	11121190, 15091317, 27031470, 29915582		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	28501927		★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	BEFREE	18240960, 23777929, 24896147, 25756557, 29428485		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	10072898, 10450735, 10455128, 10477399, 12414751, 16444434, 17210974, 18088351, 18568240, 18949559, 2164042, 22842942, 23029405, 23796916, 23825193, 24165416, 26125767, 26535007, 27760554, 27878240, 28771573, 31093495, 31416821, 32171247, 32996896, 34566996, 35960063	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	22187279, 30666251, 31478785	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	31415369, 32496420, 9626052	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	10085413, 10782394, 10878750, 11278252, 12117955, 12406900, 12906716, 14500138, 15036247, 15041959, 15131465, 15187748, 15201277, 15526005, 15650061, 16051275, 16444434, 16859504, 18434886, 18848768, 19789454, 19901031, 20163933, 20217044, 20237583, 20805766, 20835611, 21245135, 21296198, 21317641, 21454555, 21633947, 21670923, 21777617, 21855288, 22266968, 22507624, 22609212, 22627572, 23033000, 23249930, 23317877, 23548047, 23723167, 23796916, 24084649, 24292568, 24371374, 24758719, 24796628, 24944154, 24945834, 25337817, 25628461, 26025100, 26117649, 26535007, 26561011, 27592234, 27630218, 27878240, 27879679, 27960200, 28086962, 28144786, 28278436, 28294408, 28372498, 28407580, 28408808, 28428949, 28459157, 28525674, 28587368, 28670310, 28675904, 28694565, 28771573, 28820494, 28824640, 28834898, 28840836, 28840846, 28859554, 28883754, 28965650, 29023360, 29028771, 29127203, 29170136, 29204105, 29212277, 29227823, 29274398, 29338031, 29340067, 29470918, 29493888, 29535830, 29599842, 29621735, 29664837, 29669785, 29683274, 29687346, 29762676, 29780390, 29847538, 29859746, 29968773, 29978383, 30037797, 30112039, 30116318, 30127927, 30131242, 30142533, 30150933, 30179122, 30221694, 30300408, 30317623, 30343600, 30400800, 30402800, 30538802, 30547887, 30555342, 30601406, 30664762, 30666251, 30802614, 30803045, 30817635, 30818829, 30915758, 30947238, 30956276, 30991817, 31006736, 31093495, 31093964, 31174699, 31207266, 31297113, 31354386, 31415369, 31450153, 31500303, 31658116, 31701129, 31701658, 31786500, 31787972, 7850574, 8625623, 8832971, 8843235, 9696492		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	CTD_human_DG	15489642, 8741040, 9806674		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	15860669, 18312678		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	12941546, 28760652		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	8525526, 8750012		★☆☆☆☆ Found in Text Mining only
Severe combined immunodeficiency due to adenosine deaminase deficiency	Severe combined immunodeficiency	Pubtator	29333082, 34946883	Associate	★☆☆☆☆ Found in Text Mining only
Severe combined immunodeficiency due to adenosine deaminase deficiency	Severe combined immunodeficiency	Pubtator	7511077	Stimulate	★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	28203105, 28833192, 30943938		★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	BEFREE	12795791, 16677285, 17257223		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	LHGDN	15315967		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	15315967, 22417305	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	18314443, 22417305		★☆☆☆☆ Found in Text Mining only
Sialic Acid Storage Disease, Finnish Type (disorder)	Sialic Acid Storage Disease	BEFREE	28547750		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	10814986, 26904697, 27390247, 28973855, 30423938		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	26976796, 31627295, 31766503		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	Pubtator	19405090, 27508393	Associate	★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	27958666		★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	10194069, 22403659, 22553338, 29391069, 29466439		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	10943866, 14872501, 16507175, 20131250, 22157716, 27188286, 29504848, 34596026, 35432384, 35705251, 35860283, 38013284, 38171773, 38416549, 39819714, 40650157, 9867125	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	16802368, 17898882, 26904697, 31281310	Stimulate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	27461134	Inhibit	★☆☆☆☆ Found in Text Mining only
Skin Abnormalities	Skin abnormalities	Pubtator	19920355	Associate	★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	21760883, 28045204, 31823140		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	12485445, 14962095, 1919049, 19479852, 21357384, 21437440, 23732752, 29143979, 32962477, 37207444	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Diseases	Skin disease	Pubtator	15963988	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Diseases	Skin disease	Pubtator	22673732	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Erosion	Skin Erosion	BEFREE	11947922, 12438440, 16539828, 16572445, 19770515, 21806780, 22644323, 23784913, 24767864, 27731365, 28562338		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	12388730, 14675284, 15908402, 16403098, 17182220, 19839494, 21035532, 21357384, 21455173, 21672030, 22407167, 23068083, 23454147, 23731727, 24504098, 25341795, 25384035, 27289147, 28272075, 28833499, 29143979, 29409331, 29455734, 29479352, 29611085, 29698775, 29713456, 29845271, 29932162, 29977237, 29996938, 30066901, 30168849, 30206447, 30268392, 30442123, 30503675, 30743203, 31017270, 31407330, 31437788, 31447855, 31705000, 9115924		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	18025480, 23429285	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	16204600, 19022640, 19218687, 26125882, 31210414, 32028672, 32029067, 36127647, 38172514, 38385464, 39252231	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	19581829, 20846669, 35652886	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	37217113	Inhibit	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	16204600, 16246965, 16840748, 19022640, 19218687, 19895425, 20846669, 21988415, 22043116, 23239459, 25192323, 25222485, 25917830, 25953302, 26125882, 26201496, 27621224, 27858556, 28131740, 28187003, 28215263, 29042934, 29152745, 29245360, 29482817, 29682699, 29991422, 30032465, 30678164, 30783447, 31210414		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea, Obstructive	Sleep Apnea	LHGDN	18685607		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Deprivation	Sleep deprivation	Pubtator	25373853, 25451613, 33146568, 38084427, 7662972, 8397114, 8980122, 9060702	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	25542735, 29029252, 33920292, 36982291	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	19419979		★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	29168015		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	17028268, 24969564, 2553249, 30180943, 8695164, 8880099		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	34867972, 36879122	Associate	★☆☆☆☆ Found in Text Mining only
Small Fiber Neuropathy	Small Fiber Neuropathy	BEFREE	20513817, 30173779		★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	BEFREE	20952689		★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	11748220, 27441378, 30262154		★☆☆☆☆ Found in Text Mining only
Social Communication Disorder	Social Communication Disorder	BEFREE	28007470		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	CTD_human_DG	16767912, 17203757		★☆☆☆☆ Found in Text Mining only
Spherocytosis Type 1	Spherocytosis	Pubtator	23634661	Stimulate	★☆☆☆☆ Found in Text Mining only
Spherocytosis Type 1	Spherocytosis	Pubtator	34540188	Inhibit	★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	30691854		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	11163081, 28131210, 8912208		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	LHGDN	18391721		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	27331400		★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA 29	Spinocerebellar Ataxia	BEFREE	29379012		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	29975753		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 6 (disorder)	Spinocerebellar Ataxia	BEFREE	11427317		★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	21802960	Associate	★☆☆☆☆ Found in Text Mining only
Split hand foot deformity 1	Split hand foot deformity	BEFREE	28068628		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	12011375, 12375327, 12492251, 15922688, 16720636, 16947381, 17055360, 18166219, 18975340, 19493331, 19897967, 21640926, 21968742, 22614743, 22736066, 22972410, 24192118, 25941031, 26149736, 26244882, 26471338, 27147709, 27490376, 27578555, 27696735, 28420081, 28646368, 28743358, 28791018, 28893679, 29299630, 29329443, 29419472, 29430880, 29505325, 29517554, 29579081, 29600354, 29606666, 29672807, 29751976, 29806090, 29869838, 30206711, 30390386, 30413189, 30673815, 30745872, 30767865, 30824658, 30941119, 31119895, 31145730, 31216488, 31302784, 31326602, 31474599, 31512766, 7622181		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	11114280, 17472990, 19318316, 23062122, 26125893, 26823867, 29546695, 29579081, 29744553, 29849482, 30075559, 30208882, 31195969, 33268443, 33622154, 33676382, 34880858, 35104386, 35450075, 37654221, 40593526	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	34497300	Stimulate	★☆☆☆☆ Found in Text Mining only
SPONDYLOCARPOTARSAL SYNOSTOSIS SYNDROME	Spondylocarpotarsal Synostosis Syndrome	BEFREE	20386338		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	25010932		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10408389, 10416616, 10651983, 11827262, 16166279, 16202081, 17695527, 18206417, 22808251, 22924547, 23850705, 23870134, 24550071, 25519014, 26241630, 28381191, 28881857, 28885456, 29260411, 30893332, 8044769, 8813113, 9039974		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18206417, 18273643		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16313841, 21271217, 21617867, 24151445, 24324738, 24754231, 26464679, 27731378, 27821804, 28050781, 28393234, 30933965		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	10543258, 11044363, 12771142, 16006770, 16376337, 18547033, 19789307, 20693797, 21788151, 21933882, 21990224, 22728043, 23313255, 23870134, 24278120, 25519014, 28112190, 28386055, 30192802, 30893332, 33569630, 33737574, 34553218, 34691075, 35176168, 35267186, 36969496, 37055579, 37505788, 38376273	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20084448	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	10423407		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	24122460		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	23379751, 30853615, 31823140		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	11044363, 11169220, 12034358, 12912965, 17822322, 21788151, 21990224, 22513214, 22554915, 23313255, 24858806, 28295222, 28915597, 29794474, 30192802, 31345665, 31437849, 31638203, 7485723, 9583800, 9831377		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	26113409		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	25391621, 31399243		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	16319659, 28028723, 29270001		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	12423320, 18226043, 30053815		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	CTD_human_DG	20981132		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	18455351		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus	Status Epilepticus	BEFREE	23636891, 28166388, 29326654, 29380527, 29549796, 29636074, 30006293, 30195730, 31061316		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus	Status epilepticus	Pubtator	36802956	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	18455351		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	11832442, 12653886, 15122751, 15256977, 16825325, 16848812, 17295176, 17395331, 18000721, 18190648, 18445359, 18571785, 18713975, 18773295, 19032584, 20929443, 22327199, 22658783, 23066023, 23892696, 23996518, 27678360, 28111231, 28257781, 28325574, 28710554, 28882574, 28883393, 29247122, 29367619, 29684027, 29864471, 29981260, 30066228, 30359672, 30477827, 30705687, 30793717, 31563650, 31618080, 31747353, 9214463		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	23348005		★☆☆☆☆ Found in Text Mining only
Steroid resistant nephrotic syndrome of childhood	Steroid resistant nephrotic syndrome	BEFREE	28457111, 31095586		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	12149303, 12763223, 20406839, 28658584		★☆☆☆☆ Found in Text Mining only
Steroid-sensitive nephrotic syndrome	Steroid-Sensitive Nephrotic Syndrome	BEFREE	12974763, 28457111		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum	Stevens-Johnson Syndrome	BEFREE	28949055, 29713456		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11494032, 12115538, 12594817, 12891537, 15201584, 15381184, 15540224, 15579481, 15704154, 15927855, 15978325, 16579840, 16885196, 17201881, 18350251, 18768512, 19544559, 19604505, 19615068, 19626584, 19751439, 20200422, 20222161, 20512382, 20699000, 21246243, 22459353, 22714811, 23013936, 23326309, 23821300, 23828749, 23900678, 23975421, 24011243, 24072494, 24142527, 24249671, 24277417, 24789430, 25125137, 25526211, 25548484, 26069103, 26088449, 26464679, 26504356, 27196487, 27373488, 27556695, 28115787, 28482378, 28699601, 28970092, 29028942, 29551945, 29867530, 30094865, 30413607, 30544870, 31040894, 7961104		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	11533078, 17562763, 22714811, 26504356, 32592356, 34104107	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	22714811, 26504356, 30413607, 31215272		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12730860, 15381184, 15523691, 16885196, 18350251		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	1331059, 14695763, 15112338, 16769709, 19615068, 19924065, 2108945, 22351606, 22471589, 22714811, 23072573, 23326309, 23828749, 25548484, 26069103, 26088449, 26464679, 26504356, 29028942, 29207128, 31659258, 31930120, 31983162, 32592356, 32883994, 32913031, 33312758, 33416081, 34766338, 35110948, 36158129, 36359738, 36580668, 36613819, 37431884, 38175202, 7819044, 7961104, 8855981, 9422527	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	15201584, 1733439		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	BEFREE	23016583		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	23117246, 26088449, 26219901, 28851954, 34773930	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	37047540	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomatitis	Stomatitis	BEFREE	16820919, 18164921, 19351790, 27392760, 28401452, 28403570, 31076897		★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	Pubtator	28401452, 31076897	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	21805152, 39343890	Associate	★☆☆☆☆ Found in Text Mining only
STRIATONIGRAL DEGENERATION, INFANTILE (disorder)	Striatonigral Degeneration	BEFREE	29510394		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	11553004, 14615367, 21455632, 21891866, 32503645, 36315566, 36911716, 37490433, 37794467	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	20090932, 21298033, 24167359, 34201498, 39394477, 9013604	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	36941081	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stunned Myocardium	Stunned Myocardium	CTD_human_DG	11927517		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	15726267, 16741147, 17415203, 20534169, 21562930, 23548604, 23951210, 28229304, 28236213, 28415958, 28543180, 29078973, 29277532, 29981464, 30646897, 30673997, 30791908, 30980845, 31082470, 31121365, 31361786, 31801411		★☆☆☆☆ Found in Text Mining only
Subclinical hypothyroidism	Subclinical Hypothyroidism	BEFREE	29440225, 31292885		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	22749237, 29321548, 30294905		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	10814986, 28609645, 28973855, 30423938		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet syndrome	Pubtator	20636397, 28609645	Stimulate	★☆☆☆☆ Found in Text Mining only
Synovial Hypertrophy	Synovial Hypertrophy	BEFREE	28871338, 31261789		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	10814986, 24373201, 28973855, 30423938		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	11212159, 22614743, 24349530, 26792343, 28708839, 32409720, 9358757	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	19333931	Inhibit	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	22121133, 23335080, 26792343, 28212115, 28506571, 28806729, 29663487, 29776906, 30022370, 31063606		★☆☆☆☆ Found in Text Mining only
Synovitis, Acne, Pustulosis, Hyperostosis, and Osteitis Syndrome	Synovitis, Acne, Pustulosis, Hyperostosis, and Osteitis (SAPHO) Syndrome	CTD_human_DG	27108452		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Synovitis, Acne, Pustulosis, Hyperostosis, and Osteitis Syndrome	Synovitis, Acne, Pustulosis, Hyperostosis, and Osteitis (SAPHO) Syndrome	BEFREE	29611085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYNOVITIS, GRANULOMATOUS, WITH UVEITIS AND CRANIAL NEUROPATHIES (disorder)	Arthrocutaneouveal granulomatosis	BEFREE	31006736, 31718710		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	16393767, 28815559, 30863782		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	10809757, 12154203, 14675284, 14872499, 15585313, 15654958, 17084440, 1718289, 17498268, 21769840, 23045159, 24982919, 25857445, 26245842, 28384257, 28532580, 28562527, 28884475, 29339444, 29528272, 29623390, 29944680, 30001654, 30268392, 30508197, 30978354, 31353423, 31552041, 7636301, 8466280, 9663489		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	17498268		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	12648503, 20087644, 20952689, 22573350, 22640629, 24035239, 24857911, 29938921, 8630415, 9593751		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	16720219, 21965637, 23703343, 24548718, 27564917, 27771172, 27815653, 28349250, 28521841, 28778711, 29146018, 29427826, 30010945, 30461542, 30877209, 31388749, 31816847		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	26792515		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	27131251, 27836101		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	28860425, 29203638, 30540601		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	17220333, 28471449		★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	12111782, 26376749	Associate	★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	36323999	Inhibit	★☆☆☆☆ Found in Text Mining only
THANATOPHORIC DYSPLASIA, TYPE I (disorder)	Thanatophoric Dysplasia	BEFREE	20643858		★☆☆☆☆ Found in Text Mining only
Thoracic Diseases	Thoracic disease	Pubtator	38173720	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	24463275, 33599741	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	25589894, 28865603, 36802017	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombophilia	Thrombophilia	Pubtator	15497022, 9633890	Associate	★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	28823228, 29608550, 9633890		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	35180460	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	10393703, 20536609, 35180460, 35297992, 38608731, 40513998	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Thymoma	BEFREE	28429750		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	15219383, 19798110, 22237514, 22661653, 24956560, 26087256, 28119492, 30325581, 30576385		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	1320006, 37898675	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	32050977	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer, follicular	Thyroid cancer	BEFREE	12144133		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12144133, 18430896, 24464184, 26577851, 26721202, 27555670		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	CTD_human_DG	26037280		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	8697623	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	15236755, 19250279, 7986390, 8697623		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	CTD_human_DG	26037280		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	29250672		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	24464184, 26577851, 27555670		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	CTD_human_DG	26037280		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	1375873, 19190106, 26577851, 37506147	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Neoplasms	Thyroid cancer	Pubtator	29953504	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroiditis	Thyroiditis	Pubtator	10464273	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	31350776, 8697623	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	19250279, 25127106, 29526119, 32604892, 36387897	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	36362417	Stimulate	★☆☆☆☆ Found in Text Mining only
Tight skin contracture syndrome lethal	Tight skin contracture syndrome	Pubtator	11173656	Associate	★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de Pointes	BEFREE	28490617		★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	28067847	Inhibit	★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	22992806, 29400697, 29529123, 29713456, 30834560		★☆☆☆☆ Found in Text Mining only
Toxic Shock Syndrome	Toxic Shock Syndrome	BEFREE	10603377, 25168152, 30175438, 9551921		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Toxic Shock Syndrome	Toxic Shock Syndrome	CTD_human_DG	20054000		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	29777731		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	28893572, 29777731		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	18558283		★☆☆☆☆ Found in Text Mining only
Transposition of Great Vessels	Transposition of the great arteries	Pubtator	35590253	Associate	★☆☆☆☆ Found in Text Mining only
Trichiasis	Trichiasis	BEFREE	17330135		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	12608883, 30124090, 9242449		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	CTD_human_DG	27093858		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	34067581	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Trigeminal Neuralgia, Idiopathic	Trigeminal neuralgia	CTD_human_DG	27093858		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23263670, 24025362, 25611337, 25762639, 26165253, 26227206, 26733177, 26792858, 27476169, 27656833, 29158255, 29434187, 29487338, 30166590, 30728901, 30802640, 31093512, 31355333, 31479522		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	23729230, 25762639, 26792858, 27476169, 27656833, 31105691, 31665136, 33599741, 33707603, 33918859, 34072893, 34197030, 34475205, 35228654, 35260587, 35631261, 35960749, 37147986, 37400144	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34848446, 35964108	Stimulate	★☆☆☆☆ Found in Text Mining only
Trisomy	Trisomy	Pubtator	12149200	Stimulate	★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	BEFREE	28991528		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	LHGDN	14572449		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	17079667		★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	31819634		★☆☆☆☆ Found in Text Mining only
Type II Mucolipidosis	Mucolipidosis	BEFREE	21329569, 22404198		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10321759, 10344681, 11196710, 11904678, 12019209, 12428072, 15103488, 15223609, 15325795, 16110831, 16534418, 16611251, 16707968, 16863613, 17207256, 17255827, 17347265, 17565649, 18289203, 18698679, 18827481, 18942752, 18942754, 19286392, 21248737, 21498716, 21877213, 21887729, 22223479, 22960943, 23211301, 23377880, 23595390, 23795660, 23942620, 24776844, 24793818, 24814920, 24971461, 25052149, 25501099, 26090671, 26288000, 26316104, 26418829, 26481742, 26632999, 26668517, 26752469, 26928573, 27077118, 27333824, 27467733, 27528546, 27693318, 27722996, 27781286, 27887202, 27890854, 27895399, 27960557, 28039805, 28078747, 28095262, 28139755, 28143741, 28221250, 28276855, 28279079, 28374338, 28408791, 28417241, 28472597, 28490715, 28505128, 28577692, 28581039, 28655067, 28796080, 28826571, 28837372, 28842689, 28884254, 28891095, 28922365, 29129493, 29182760, 29205406, 29226079, 29228739, 29286110, 29333082, 29336432, 29361101, 29372480, 29401402, 29462391, 29475099, 29505910, 29513111, 29529212, 29530609, 29535444, 29588183, 29625907, 29752633, 29774158, 29788272, 29857145, 29930467, 29981298, 30009157, 30054143, 30107214, 30134234, 30190207, 30205699, 30213584, 30315858, 30329067, 30369485, 30416313, 30426297, 30429108, 30430682, 30544140, 30555013, 30558178, 30615542, 30625408, 30648028, 30685385, 30783488, 30797423, 30821556, 30826279, 30897368, 30906432, 30906449, 31002701, 31012362, 31077582, 31098835, 31102937, 31103874, 31169706, 31206576, 31210713, 31252191, 31267570, 31489538, 31524230, 31562896, 31579961, 31628842, 31694526, 31714573, 31714673, 31731793, 31747580, 31782956, 31790426, 8608636, 9928378		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	LHGDN	11904678, 14731353, 17990358, 18289203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	19617644, 20452301, 22119283		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	19175760, 19618378, 19836613, 20661026, 22683211, 27187381, 28833192, 29361849, 29427582, 29670819, 30310056, 30520409, 30840161, 31142907, 31561419, 31622870		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	20351714, 22683211, 22683764, 23064081, 23608119		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uremia	Uremia	BEFREE	12671841, 29228352, 29257244		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	34858433	Associate	★☆☆☆☆ Found in Text Mining only
Urethral Obstruction	Urethral Obstruction	BEFREE	30993884		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	29920227	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neck Obstruction	Urinary bladder neck obstruction	Pubtator	29920227	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	10233685	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	12966432, 1450063, 17267001, 27034531, 29517678, 29854840, 33924332, 40312703, 40777041	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	23727622, 29951534, 30475756		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	CTD_human_DG	12121561, 19250144, 20485159		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urticaria	Urticaria	BEFREE	19250144, 22714396		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasm	Uterine cervix neoplasm	LHGDN	15878915		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	28009429		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	11278357, 11739693, 12657115, 16438713, 17177206, 17452777, 19369479, 19823053, 21119362, 22592655, 23028877, 23824834, 24197984, 24885472, 25113639, 26191295, 26214423, 26474968, 2813400, 28765959, 29935877, 29940817, 30453149, 31418900, 32596357, 35186243, 37445768, 40238841	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19823053	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	29664552, 34010983, 35279667	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	15474092, 21138652, 25398968, 29809057, 30518097, 31148852		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	20546535, 24001901, 24124368		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	24124368	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	10438385, 16581430, 19440225, 19657978, 20813201, 21334264, 21357402, 22736066, 25028373, 26487500, 26821681, 28088912, 28089968, 28528519, 28558009, 29455252, 30076542, 30732563, 30862619, 31021511, 31021540, 31673980, 31674159, 31804623, 8589268		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	Pubtator	14977779, 15196263, 21957872, 27028890, 30779760, 37924741	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	Pubtator	25354724, 35061677	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis Intermediate	Uveitis	Pubtator	14977779	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveitis Intermediate	Uveitis	Pubtator	23378732	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis, Posterior	Uveitis	BEFREE	28503960		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	29285231		★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	27914807, 28592841, 30210289, 30214381, 30251694, 30864715, 30964608, 30989463, 31059087, 31827377		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	30474123, 31781347		★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	36930472	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	11278252, 24486907, 29682517, 29956764, 31744135, 33236147, 33381228, 39578766	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Diseases	Vascular Diseases	BEFREE	11744409, 12972116, 15797745, 19282242, 25009787, 29464018, 30001654, 30104414, 30816914		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Diseases	Vascular Diseases	CTD_human_DG	14965870		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Diseases	Vascular disease	Pubtator	15102770, 21658307, 21754991, 24349153, 25963668, 27251500, 30526655, 32896251, 33196557, 34858433, 38195507	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Remodeling	Vascular remodeling	Pubtator	26667361	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	10948142, 21905018, 28848152	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular System Injuries	Vascular system injury	Pubtator	12855710, 27124409	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vasculitis	Vasculitis	BEFREE	10729297, 12783130, 14703611, 1696867, 19690440, 27455075, 27981463, 28390566, 28391344, 28705782, 28719435, 30073458, 30158835, 30375745, 30996002, 31632872, 31700711, 7589090, 8455368		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	10759767, 15479908, 17446240, 31945408, 33287909, 33299497	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	22152684	Stimulate	★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	29439934	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	23852308, 32805626, 34077299	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Venous Thrombosis	Venous thrombosis	Pubtator	35808901	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction	Ventricular dysfunction	Pubtator	9091515	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ventricular Remodeling	Ventricular remodeling	Pubtator	15388510, 36012347	Associate	★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	BEFREE	15371770		★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	28552580, 29142134, 30902577		★☆☆☆☆ Found in Text Mining only
VEXAS syndrome	Vexas syndrome	Pubtator	37586319	Associate	★☆☆☆☆ Found in Text Mining only
Visceral myopathy familial external ophthalmoplegia	Visceral neuropathy	Pubtator	23451225	Associate	★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	34424286	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	25380286	Stimulate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	27696575, 28464004, 29104377, 29684027, 30116326, 30651805, 31109269		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	16691430, 18820938, 22151832, 23284977, 23884763, 23912226, 24312346, 25283497, 26125752, 26224639, 26370050, 26681224, 28273427, 29504235, 30651813, 31781265		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	Pubtator	23284977, 26370050, 40723924	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	Pubtator	23884763, 24312346, 32616337, 32705792, 33370782, 9077486	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	CTD_human_DG	28836394		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	16691430, 18820938, 22151832, 23284977, 23884763, 23912226, 24312346, 25283497, 26125752, 26224639, 26370050, 26681224, 28273427, 29504235, 30651813, 31781265		★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	31069271	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	11434619		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	33690107	Associate	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	12175864		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner syndrome	Pubtator	26037922	Stimulate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	34519584	Inhibit	★☆☆☆☆ Found in Text Mining only
Wolfram Syndrome	Wolfram syndrome	Pubtator	33693650	Associate	★☆☆☆☆ Found in Text Mining only
X-linked agammaglobulinemia	Agammaglobulinemia, X-Linked	BEFREE	18204790, 30698158		★☆☆☆☆ Found in Text Mining only
Xanthomatosis	Xanthomatosis	Pubtator	16083882, 24428816	Stimulate	★☆☆☆☆ Found in Text Mining only
Xanthomatosis, Cerebrotendinous	Cholestanol storage disease	BEFREE	30296293		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	10998144	Associate	★☆☆☆☆ Found in Text Mining only
Zollinger-Ellison syndrome	Zollinger-Ellison syndrome	BEFREE	11866267		★☆☆☆☆ Found in Text Mining only