FOS (Fos proto-oncogene, AP-1 transcription factor subunit)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2353
• Gene name: Fos proto-oncogene, AP-1 transcription factor subunit
• Gene symbol: FOS
• Synonyms (NCBI Gene): AP-1, C-FOS, p55
• Chromosome: 14
• Chromosome location: 14q24.3
• Summary: The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have b

miRNA Show/Hide all (366)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001219	hsa-miR-101-3p	qRT-PCR, Luciferase reporter assay, Western blot	19133651
MIRT001219	hsa-miR-101-3p	qRT-PCR, Luciferase reporter assay, Western blot	19133651
MIRT004484	hsa-miR-221-3p	qRT-PCR, Luciferase reporter assay, Western blot, Northern blot	20299489
MIRT004485	hsa-miR-222-3p	qRT-PCR, Luciferase reporter assay, Western blot, Northern blot	20299489
MIRT001219	hsa-miR-101-3p	Luciferase reporter assay	19133651
MIRT001219	hsa-miR-101-3p	Review	20026422
MIRT001219	hsa-miR-101-3p	qRT-PCR	20712078
MIRT001219	hsa-miR-101-3p	Western blot	19008416
MIRT006851	hsa-miR-181a-5p	Luciferase reporter assay	22956783
MIRT006851	hsa-miR-181a-5p	Luciferase reporter assay	22956783
MIRT006976	hsa-miR-139-5p	qRT-PCR, Western blot	23001723
MIRT007254	hsa-miR-29b-3p	Western blot	23254643
MIRT004485	hsa-miR-222-3p	Luciferase reporter assay	23400877
MIRT004484	hsa-miR-221-3p	Luciferase reporter assay	23400877
MIRT019187	hsa-miR-335-5p	Microarray	18185580
MIRT024954	hsa-miR-215-5p	Microarray	19074876
MIRT026898	hsa-miR-192-5p	Microarray	19074876
MIRT004484	hsa-miR-221-3p	Luciferase reporter assay	23400877
MIRT004484	hsa-miR-221-3p	Luciferase reporter assay	23400877
MIRT053066	hsa-miR-490-5p	Flow, Luciferase reporter assay, Western blot	24220339
MIRT053434	hsa-miR-155-5p	Microarray	23807165
MIRT437420	hsa-miR-181b-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23810250
MIRT437420	hsa-miR-181b-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23810250
MIRT509846	hsa-miR-4438	PAR-CLIP	23446348
MIRT509847	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT509845	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT509844	hsa-miR-1234-3p	PAR-CLIP	23446348
MIRT509843	hsa-miR-7107-5p	PAR-CLIP	23446348
MIRT509842	hsa-miR-3622b-5p	PAR-CLIP	23446348
MIRT509841	hsa-miR-4640-5p	PAR-CLIP	23446348
MIRT509840	hsa-miR-4726-5p	PAR-CLIP	23446348
MIRT509839	hsa-miR-6508-3p	PAR-CLIP	23446348
MIRT509838	hsa-miR-5095	PAR-CLIP	23446348
MIRT509837	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT509836	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT509846	hsa-miR-4438	PAR-CLIP	23446348
MIRT509847	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT509845	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT509844	hsa-miR-1234-3p	PAR-CLIP	23446348
MIRT509843	hsa-miR-7107-5p	PAR-CLIP	23446348
MIRT509842	hsa-miR-3622b-5p	PAR-CLIP	23446348
MIRT509841	hsa-miR-4640-5p	PAR-CLIP	23446348
MIRT509840	hsa-miR-4726-5p	PAR-CLIP	23446348
MIRT509839	hsa-miR-6508-3p	PAR-CLIP	23446348
MIRT509838	hsa-miR-5095	PAR-CLIP	23446348
MIRT509837	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT509836	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT004485	hsa-miR-222-3p	PAR-CLIP	23592263
MIRT004484	hsa-miR-221-3p	PAR-CLIP	23592263
MIRT476791	hsa-miR-8080	PAR-CLIP	23592263
MIRT476790	hsa-miR-6816-3p	PAR-CLIP	23592263
MIRT476789	hsa-miR-8083	PAR-CLIP	23592263
MIRT476787	hsa-miR-6872-3p	PAR-CLIP	23592263
MIRT476788	hsa-miR-6854-3p	PAR-CLIP	23592263
MIRT476786	hsa-miR-187-5p	PAR-CLIP	23592263
MIRT476785	hsa-miR-548v	PAR-CLIP	23592263
MIRT476784	hsa-miR-6077	PAR-CLIP	23592263
MIRT476783	hsa-miR-19a-5p	PAR-CLIP	23592263
MIRT476782	hsa-miR-19b-1-5p	PAR-CLIP	23592263
MIRT476781	hsa-miR-19b-2-5p	PAR-CLIP	23592263
MIRT476780	hsa-miR-5581-3p	PAR-CLIP	23592263
MIRT476779	hsa-miR-937-5p	PAR-CLIP	23592263
MIRT476778	hsa-miR-627-5p	PAR-CLIP	23592263
MIRT476777	hsa-miR-5089-3p	PAR-CLIP	23592263
MIRT476776	hsa-miR-8081	PAR-CLIP	23592263
MIRT476775	hsa-miR-6885-3p	PAR-CLIP	23592263
MIRT476774	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT476773	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT007254	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT476772	hsa-miR-5586-5p	PAR-CLIP	23592263
MIRT476770	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT476771	hsa-miR-3065-3p	PAR-CLIP	23592263
MIRT476769	hsa-miR-323b-3p	PAR-CLIP	23592263
MIRT476768	hsa-miR-4530	PAR-CLIP	23592263
MIRT476767	hsa-miR-338-3p	PAR-CLIP	23592263
MIRT440620	hsa-miR-493-5p	HITS-CLIP	24374217
MIRT440619	hsa-miR-543	HITS-CLIP	24374217
MIRT440618	hsa-miR-770-5p	HITS-CLIP	24374217
MIRT440620	hsa-miR-493-5p	HITS-CLIP	24374217
MIRT440619	hsa-miR-543	HITS-CLIP	24374217
MIRT440618	hsa-miR-770-5p	HITS-CLIP	24374217
MIRT001219	hsa-miR-101-3p	Luciferase reporter assay	27073439
MIRT001219	hsa-miR-101-3p	Luciferase reporter assay	27073439
MIRT001219	hsa-miR-101-3p	Luciferase reporter assay	27073439
MIRT731770	hsa-miR-7-5p	ChIP-seq, Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	26261179
MIRT731770	hsa-miR-7-5p	ChIP-seq, Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	26261179
MIRT731770	hsa-miR-7-5p	ChIP-seq, Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	26261179
MIRT731770	hsa-miR-7-5p	ChIP-seq, Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	26261179
MIRT731770	hsa-miR-7-5p	ChIP-seq, Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	26261179
MIRT731770	hsa-miR-7-5p	ChIP-seq, Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	26261179
MIRT053434	hsa-miR-155-5p	ChIP, mRNA decay, qRT-PCR, Western blot	27513856
MIRT006976	hsa-miR-139-5p	qRT-PCR, Western blot	27668889
MIRT006976	hsa-miR-139-5p	qRT-PCR, Western blot	27668889
MIRT053066	hsa-miR-490-5p	qRT-PCR, Western blot	26170849
MIRT734571	hsa-miR-766-3p	Microarray	32645133
MIRT735529	hsa-miR-203a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	32454462
MIRT006976	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, in vivo gain/loss-of-function experiments	32641995
MIRT006976	hsa-miR-139-5p	Western blotting, qRT-PCR, Flow cytometry	34249000
MIRT006976	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR	32641995
MIRT004484	hsa-miR-221-3p	Luciferase reporter assay, Western blotting, Microarray, RNA-seq, qRT-PCR, Flow cytometry	32188026
MIRT004484	hsa-miR-221-3p	qRT-PCR	32280695
MIRT509846	hsa-miR-4438	PAR-CLIP	23446348
MIRT509847	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT509845	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT509844	hsa-miR-1234-3p	PAR-CLIP	23446348
MIRT509843	hsa-miR-7107-5p	PAR-CLIP	23446348
MIRT509842	hsa-miR-3622b-5p	PAR-CLIP	23446348
MIRT509841	hsa-miR-4640-5p	PAR-CLIP	23446348
MIRT509840	hsa-miR-4726-5p	PAR-CLIP	23446348
MIRT509839	hsa-miR-6508-3p	PAR-CLIP	23446348
MIRT509838	hsa-miR-5095	PAR-CLIP	23446348
MIRT509837	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT509836	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT509846	hsa-miR-4438	PAR-CLIP	23446348
MIRT509847	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT509845	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT509844	hsa-miR-1234-3p	PAR-CLIP	23446348
MIRT509843	hsa-miR-7107-5p	PAR-CLIP	23446348
MIRT509842	hsa-miR-3622b-5p	PAR-CLIP	23446348
MIRT509841	hsa-miR-4640-5p	PAR-CLIP	23446348
MIRT509840	hsa-miR-4726-5p	PAR-CLIP	23446348
MIRT509839	hsa-miR-6508-3p	PAR-CLIP	23446348
MIRT509838	hsa-miR-5095	PAR-CLIP	23446348
MIRT509837	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT509836	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT004485	hsa-miR-222-3p	PAR-CLIP	23592263
MIRT004484	hsa-miR-221-3p	PAR-CLIP	23592263
MIRT476791	hsa-miR-8080	PAR-CLIP	23592263
MIRT476790	hsa-miR-6816-3p	PAR-CLIP	23592263
MIRT476789	hsa-miR-8083	PAR-CLIP	23592263
MIRT476787	hsa-miR-6872-3p	PAR-CLIP	23592263
MIRT476788	hsa-miR-6854-3p	PAR-CLIP	23592263
MIRT476786	hsa-miR-187-5p	PAR-CLIP	23592263
MIRT476785	hsa-miR-548v	PAR-CLIP	23592263
MIRT476784	hsa-miR-6077	PAR-CLIP	23592263
MIRT476783	hsa-miR-19a-5p	PAR-CLIP	23592263
MIRT476782	hsa-miR-19b-1-5p	PAR-CLIP	23592263
MIRT476781	hsa-miR-19b-2-5p	PAR-CLIP	23592263
MIRT476780	hsa-miR-5581-3p	PAR-CLIP	23592263
MIRT476779	hsa-miR-937-5p	PAR-CLIP	23592263
MIRT476778	hsa-miR-627-5p	PAR-CLIP	23592263
MIRT476777	hsa-miR-5089-3p	PAR-CLIP	23592263
MIRT476776	hsa-miR-8081	PAR-CLIP	23592263
MIRT476775	hsa-miR-6885-3p	PAR-CLIP	23592263
MIRT476774	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT476773	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT007254	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT476772	hsa-miR-5586-5p	PAR-CLIP	23592263
MIRT476770	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT476771	hsa-miR-3065-3p	PAR-CLIP	23592263
MIRT476769	hsa-miR-323b-3p	PAR-CLIP	23592263
MIRT476768	hsa-miR-4530	PAR-CLIP	23592263
MIRT476767	hsa-miR-338-3p	PAR-CLIP	23592263
MIRT1001050	hsa-miR-101	CLIP-seq
MIRT1001051	hsa-miR-1202	CLIP-seq
MIRT1001052	hsa-miR-1244	CLIP-seq
MIRT1001053	hsa-miR-1253	CLIP-seq
MIRT1001054	hsa-miR-1297	CLIP-seq
MIRT1001055	hsa-miR-1304	CLIP-seq
MIRT1001056	hsa-miR-144	CLIP-seq
MIRT1001057	hsa-miR-149	CLIP-seq
MIRT1001058	hsa-miR-155	CLIP-seq
MIRT1001059	hsa-miR-181a	CLIP-seq
MIRT1001060	hsa-miR-181b	CLIP-seq
MIRT1001061	hsa-miR-181c	CLIP-seq
MIRT1001062	hsa-miR-181d	CLIP-seq
MIRT1001063	hsa-miR-199a-3p	CLIP-seq
MIRT1001064	hsa-miR-199b-3p	CLIP-seq
MIRT1001065	hsa-miR-2053	CLIP-seq
MIRT1001066	hsa-miR-24	CLIP-seq
MIRT1001067	hsa-miR-26a	CLIP-seq
MIRT1001068	hsa-miR-26b	CLIP-seq
MIRT1001069	hsa-miR-29a	CLIP-seq
MIRT1001070	hsa-miR-29b	CLIP-seq
MIRT1001071	hsa-miR-29c	CLIP-seq
MIRT1001072	hsa-miR-3065-5p	CLIP-seq
MIRT1001073	hsa-miR-3129-5p	CLIP-seq
MIRT1001074	hsa-miR-3140-3p	CLIP-seq
MIRT1001075	hsa-miR-3143	CLIP-seq
MIRT1001076	hsa-miR-3160-5p	CLIP-seq
MIRT1001077	hsa-miR-3185	CLIP-seq
MIRT1001078	hsa-miR-3201	CLIP-seq
MIRT1001079	hsa-miR-323-3p	CLIP-seq
MIRT1001080	hsa-miR-3616-5p	CLIP-seq
MIRT1001081	hsa-miR-3647-3p	CLIP-seq
MIRT1001082	hsa-miR-3647-5p	CLIP-seq
MIRT1001083	hsa-miR-3692	CLIP-seq
MIRT1001084	hsa-miR-383	CLIP-seq
MIRT1001085	hsa-miR-3921	CLIP-seq
MIRT1001086	hsa-miR-3927	CLIP-seq
MIRT1001087	hsa-miR-3972	CLIP-seq
MIRT1001088	hsa-miR-4262	CLIP-seq
MIRT1001089	hsa-miR-4263	CLIP-seq
MIRT1001090	hsa-miR-4267	CLIP-seq
MIRT1001091	hsa-miR-4272	CLIP-seq
MIRT1001092	hsa-miR-4284	CLIP-seq
MIRT1001093	hsa-miR-4311	CLIP-seq
MIRT1001094	hsa-miR-4465	CLIP-seq
MIRT1001095	hsa-miR-4637	CLIP-seq
MIRT1001096	hsa-miR-4643	CLIP-seq
MIRT1001097	hsa-miR-4650-3p	CLIP-seq
MIRT1001098	hsa-miR-4650-5p	CLIP-seq
MIRT1001099	hsa-miR-4653-5p	CLIP-seq
MIRT1001100	hsa-miR-4668-3p	CLIP-seq
MIRT1001101	hsa-miR-4709-3p	CLIP-seq
MIRT1001102	hsa-miR-4712-3p	CLIP-seq
MIRT1001103	hsa-miR-4717-3p	CLIP-seq
MIRT1001104	hsa-miR-4755-3p	CLIP-seq
MIRT1001105	hsa-miR-4761-5p	CLIP-seq
MIRT1001106	hsa-miR-4772-5p	CLIP-seq
MIRT1001107	hsa-miR-4791	CLIP-seq
MIRT1001108	hsa-miR-4795-5p	CLIP-seq
MIRT1001109	hsa-miR-4802-3p	CLIP-seq
MIRT1001110	hsa-miR-498	CLIP-seq
MIRT1001111	hsa-miR-548ae	CLIP-seq
MIRT1001112	hsa-miR-548aj	CLIP-seq
MIRT1001113	hsa-miR-548am	CLIP-seq
MIRT1001114	hsa-miR-548x	CLIP-seq
MIRT1001115	hsa-miR-569	CLIP-seq
MIRT1001116	hsa-miR-573	CLIP-seq
MIRT1001117	hsa-miR-576-5p	CLIP-seq
MIRT1001118	hsa-miR-597	CLIP-seq
MIRT1001119	hsa-miR-603	CLIP-seq
MIRT1001120	hsa-miR-606	CLIP-seq
MIRT1001121	hsa-miR-627	CLIP-seq
MIRT1001122	hsa-miR-634	CLIP-seq
MIRT1001123	hsa-miR-653	CLIP-seq
MIRT1001124	hsa-miR-668	CLIP-seq
MIRT1001125	hsa-miR-802	CLIP-seq
MIRT1001126	hsa-miR-873	CLIP-seq
MIRT1548880	hsa-miR-221	CLIP-seq
MIRT1548881	hsa-miR-222	CLIP-seq
MIRT1001050	hsa-miR-101	CLIP-seq
MIRT1001051	hsa-miR-1202	CLIP-seq
MIRT1996575	hsa-miR-1207-3p	CLIP-seq
MIRT1001052	hsa-miR-1244	CLIP-seq
MIRT1996576	hsa-miR-1292	CLIP-seq
MIRT1001054	hsa-miR-1297	CLIP-seq
MIRT1996577	hsa-miR-1298	CLIP-seq
MIRT1001055	hsa-miR-1304	CLIP-seq
MIRT1996578	hsa-miR-142-5p	CLIP-seq
MIRT1001056	hsa-miR-144	CLIP-seq
MIRT1001059	hsa-miR-181a	CLIP-seq
MIRT1001060	hsa-miR-181b	CLIP-seq
MIRT1001061	hsa-miR-181c	CLIP-seq
MIRT1001062	hsa-miR-181d	CLIP-seq
MIRT1001063	hsa-miR-199a-3p	CLIP-seq
MIRT1001064	hsa-miR-199b-3p	CLIP-seq
MIRT1001065	hsa-miR-2053	CLIP-seq
MIRT1548880	hsa-miR-221	CLIP-seq
MIRT1548881	hsa-miR-222	CLIP-seq
MIRT1001067	hsa-miR-26a	CLIP-seq
MIRT1001068	hsa-miR-26b	CLIP-seq
MIRT1996579	hsa-miR-28-3p	CLIP-seq
MIRT1001069	hsa-miR-29a	CLIP-seq
MIRT1001070	hsa-miR-29b	CLIP-seq
MIRT1001071	hsa-miR-29c	CLIP-seq
MIRT1001072	hsa-miR-3065-5p	CLIP-seq
MIRT1001073	hsa-miR-3129-5p	CLIP-seq
MIRT1001074	hsa-miR-3140-3p	CLIP-seq
MIRT1001075	hsa-miR-3143	CLIP-seq
MIRT1996580	hsa-miR-3148	CLIP-seq
MIRT1001076	hsa-miR-3160-5p	CLIP-seq
MIRT1001077	hsa-miR-3185	CLIP-seq
MIRT1001078	hsa-miR-3201	CLIP-seq
MIRT1001079	hsa-miR-323-3p	CLIP-seq
MIRT1996581	hsa-miR-329	CLIP-seq
MIRT1001080	hsa-miR-3616-5p	CLIP-seq
MIRT1996582	hsa-miR-3618	CLIP-seq
MIRT1996583	hsa-miR-362-3p	CLIP-seq
MIRT1001081	hsa-miR-3647-3p	CLIP-seq
MIRT1001082	hsa-miR-3647-5p	CLIP-seq
MIRT1996584	hsa-miR-3650	CLIP-seq
MIRT1996585	hsa-miR-3671	CLIP-seq
MIRT1996586	hsa-miR-3688-3p	CLIP-seq
MIRT1001083	hsa-miR-3692	CLIP-seq
MIRT1996587	hsa-miR-369-3p	CLIP-seq
MIRT1996588	hsa-miR-374a	CLIP-seq
MIRT1996589	hsa-miR-374b	CLIP-seq
MIRT1001084	hsa-miR-383	CLIP-seq
MIRT1996590	hsa-miR-3914	CLIP-seq
MIRT1001085	hsa-miR-3921	CLIP-seq
MIRT1996591	hsa-miR-3941	CLIP-seq
MIRT1001087	hsa-miR-3972	CLIP-seq
MIRT1996592	hsa-miR-3974	CLIP-seq
MIRT1001088	hsa-miR-4262	CLIP-seq
MIRT1001089	hsa-miR-4263	CLIP-seq
MIRT1001090	hsa-miR-4267	CLIP-seq
MIRT1001091	hsa-miR-4272	CLIP-seq
MIRT1996593	hsa-miR-431	CLIP-seq
MIRT1996594	hsa-miR-432	CLIP-seq
MIRT1001094	hsa-miR-4465	CLIP-seq
MIRT1996595	hsa-miR-4471	CLIP-seq
MIRT1001096	hsa-miR-4643	CLIP-seq
MIRT1996596	hsa-miR-4646-5p	CLIP-seq
MIRT1001099	hsa-miR-4653-5p	CLIP-seq
MIRT1996597	hsa-miR-4666-3p	CLIP-seq
MIRT1001100	hsa-miR-4668-3p	CLIP-seq
MIRT1996598	hsa-miR-4700-3p	CLIP-seq
MIRT1001101	hsa-miR-4709-3p	CLIP-seq
MIRT1001103	hsa-miR-4717-3p	CLIP-seq
MIRT1996599	hsa-miR-4720-3p	CLIP-seq
MIRT1001104	hsa-miR-4755-3p	CLIP-seq
MIRT1001106	hsa-miR-4772-5p	CLIP-seq
MIRT1001107	hsa-miR-4791	CLIP-seq
MIRT1996600	hsa-miR-4793-3p	CLIP-seq
MIRT1001108	hsa-miR-4795-5p	CLIP-seq
MIRT1001109	hsa-miR-4802-3p	CLIP-seq
MIRT1996601	hsa-miR-4804-3p	CLIP-seq
MIRT1001110	hsa-miR-498	CLIP-seq
MIRT1996602	hsa-miR-501-3p	CLIP-seq
MIRT1996603	hsa-miR-502-3p	CLIP-seq
MIRT1996604	hsa-miR-513a-3p	CLIP-seq
MIRT1996605	hsa-miR-548a-3p	CLIP-seq
MIRT1996606	hsa-miR-548ad	CLIP-seq
MIRT1001111	hsa-miR-548ae	CLIP-seq
MIRT1001112	hsa-miR-548aj	CLIP-seq
MIRT1001113	hsa-miR-548am	CLIP-seq
MIRT1996607	hsa-miR-548e	CLIP-seq
MIRT1996608	hsa-miR-548f	CLIP-seq
MIRT1996609	hsa-miR-548g	CLIP-seq
MIRT1001114	hsa-miR-548x	CLIP-seq
MIRT1001115	hsa-miR-569	CLIP-seq
MIRT1001116	hsa-miR-573	CLIP-seq
MIRT1001117	hsa-miR-576-5p	CLIP-seq
MIRT1001118	hsa-miR-597	CLIP-seq
MIRT1001119	hsa-miR-603	CLIP-seq
MIRT1996610	hsa-miR-607	CLIP-seq
MIRT1001121	hsa-miR-627	CLIP-seq
MIRT1001122	hsa-miR-634	CLIP-seq
MIRT1001123	hsa-miR-653	CLIP-seq
MIRT1001124	hsa-miR-668	CLIP-seq
MIRT1001125	hsa-miR-802	CLIP-seq
MIRT1001126	hsa-miR-873	CLIP-seq
MIRT1996576	hsa-miR-1292	CLIP-seq
MIRT1996577	hsa-miR-1298	CLIP-seq
MIRT1001075	hsa-miR-3143	CLIP-seq
MIRT1001079	hsa-miR-323-3p	CLIP-seq
MIRT1996581	hsa-miR-329	CLIP-seq
MIRT1996583	hsa-miR-362-3p	CLIP-seq
MIRT1996585	hsa-miR-3671	CLIP-seq
MIRT1001083	hsa-miR-3692	CLIP-seq
MIRT1001084	hsa-miR-383	CLIP-seq
MIRT1996591	hsa-miR-3941	CLIP-seq
MIRT1001089	hsa-miR-4263	CLIP-seq
MIRT1996595	hsa-miR-4471	CLIP-seq
MIRT1996596	hsa-miR-4646-5p	CLIP-seq
MIRT1001106	hsa-miR-4772-5p	CLIP-seq
MIRT1001117	hsa-miR-576-5p	CLIP-seq
MIRT1001119	hsa-miR-603	CLIP-seq
MIRT1996610	hsa-miR-607	CLIP-seq
MIRT1001125	hsa-miR-802	CLIP-seq
MIRT1001059	hsa-miR-181a	CLIP-seq
MIRT1001060	hsa-miR-181b	CLIP-seq
MIRT1001061	hsa-miR-181c	CLIP-seq
MIRT1001062	hsa-miR-181d	CLIP-seq
MIRT1001065	hsa-miR-2053	CLIP-seq
MIRT1001072	hsa-miR-3065-5p	CLIP-seq
MIRT1001084	hsa-miR-383	CLIP-seq
MIRT1001088	hsa-miR-4262	CLIP-seq
MIRT1001106	hsa-miR-4772-5p	CLIP-seq
MIRT1996605	hsa-miR-548a-3p	CLIP-seq
MIRT1996607	hsa-miR-548e	CLIP-seq
MIRT1996608	hsa-miR-548f	CLIP-seq
MIRT1996609	hsa-miR-548g	CLIP-seq
MIRT1001115	hsa-miR-569	CLIP-seq

Transcription factors Show/Hide all (36)

Transcription factor	Regulation	Reference
AHR	Unknown	10478842
ARNT	Repression	21544813
BRCA1	Unknown	11313879
CREB1	Unknown	12432566
CREM	Repression	21757709
DACH1	Repression	17182846
ELK1	Unknown	11313879;11846562;20682780
ELK4	Activation	9734357
ELK4	Unknown	11846562
ESR1	Unknown	10037443
ESR2	Unknown	10037443
FOS	Repression	2498646
HDAC1	Repression	17056544
HMGN1	Unknown	17938209
HOPX	Repression	19173292
HSF2	Unknown	17915561
MITF	Activation	14737107
NCOA6	Activation	19329434
NF1	Activation	9562250
NFYB	Unknown	23595228
NFYC	Unknown	23595228
NKX3-1	Repression	22179513
RB1	Repression	1909121
RB1	Unknown	7680889
RBMX	Repression	16707624
SMARCA4	Repression	10082538
SP1	Unknown	9528985
SRF	Activation	10742173;9734357
SRF	Unknown	11846562;2200737;2493627
STAT3	Activation	12600988;14737107;17204573
STAT6	Activation	11922943
STAT6	Unknown	18342537
TBP	Activation	15767669
TWIST1	Activation	19051271
TWIST2	Activation	19051271
ZBTB7A	Repression	17189472

Gene ontology (GO) Show/Hide all (110)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	9732876
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	30670568
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000979	Function	RNA polymerase II core promoter sequence-specific DNA binding	IMP	10704222
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001221	Function	Transcription coregulator binding	IPI	10523647
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	30670568
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001661	Process	Conditioned taste aversion	IEA
GO:0003407	Process	Neural retina development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9732876
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IMP	10704222
GO:0005515	Function	Protein binding	IPI	7816143, 12788789, 16511568, 18172215, 19028685, 19064921, 20102225, 20195357, 20211142, 20511396, 20936779, 21199371, 22308434, 23602568, 23661758, 24029232, 25241761, 25609649, 26496610, 28514442, 29997244, 31467278, 31515488, 32296183, 32814053, 33961781, 35140242, 37398436
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9443941, 12370307, 22387553, 24184327
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20102225, 23661758
GO:0005634	Component	Nucleus	TAS	9443941
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	8628277
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	9510247, 20102225, 23661758
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	10918580
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	TAS	10918580
GO:0006954	Process	Inflammatory response	TAS	9443941
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	9732876
GO:0007399	Process	Nervous system development	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009416	Process	Response to light stimulus	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009629	Process	Response to gravity	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0014823	Process	Response to activity	IEA
GO:0014856	Process	Skeletal muscle cell proliferation	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0021987	Process	Cerebral cortex development	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032570	Process	Response to progesterone	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0032993	Component	Protein-DNA complex	IMP	10704222
GO:0034097	Process	Response to cytokine	IEA
GO:0034224	Process	Cellular response to zinc ion starvation	IEA
GO:0034614	Process	Cellular response to reactive oxygen species	IDA	17217916
GO:0035902	Process	Response to immobilization stress	IEA
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0035976	Component	Transcription factor AP-1 complex	IDA	10508860
GO:0035976	Component	Transcription factor AP-1 complex	IEA
GO:0035976	Component	Transcription factor AP-1 complex	IMP	26514923
GO:0035976	Component	Transcription factor AP-1 complex	IPI	7816143, 9510247
GO:0035994	Process	Response to muscle stretch	IEA
GO:0042802	Function	Identical protein binding	IPI	23661758, 25609649
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	9732876
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10508860
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	10523647
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	10704222
GO:0048545	Process	Response to steroid hormone	IEA
GO:0051412	Process	Response to corticosterone	IEA
GO:0051450	Process	Myoblast proliferation	IEA
GO:0051591	Process	Response to cAMP	IEA
GO:0060395	Process	SMAD protein signal transduction	IDA	9732876
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	10508860
GO:0070412	Function	R-SMAD binding	IPI	9732876
GO:0071277	Process	Cellular response to calcium ion	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0071374	Process	Cellular response to parathyroid hormone stimulus	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0072375	Process	Medium-term memory	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	30670568
GO:1902895	Process	Positive regulation of miRNA transcription	IEA
GO:1902895	Process	Positive regulation of miRNA transcription	ISS
GO:1903131	Process	Mononuclear cell differentiation	IEA
GO:1904321	Process	Response to forskolin	IEA
GO:1904628	Process	Cellular response to phorbol 13-acetate 12-myristate	IEA
GO:1990646	Process	Cellular response to prolactin	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA
GO:1990841	Function	Promoter-specific chromatin binding	IEA

Other IDs

• MIM: 164810
• HGNC: 3796
• e!Ensembl: ENSG00000170345

Protein

• UniProt ID: P01100
• Protein name: Protein c-Fos (Cellular oncogene fos) (Fos proto-oncogene, AP-1 transcription factor subunit) (G0/G1 switch regulatory protein 7) (Proto-oncogene c-Fos) (Transcription factor AP-1 subunit c-Fos)
• Protein function: Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. In the heterodimer, FOS and JUN/AP-1 basic regions each seems to interact with symmetrical DNA half sites. On TGF-beta activatio
• PDB: 1A02 , 1FOS , 1S9K
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00170	bZIP_1	135 → 197	bZIP transcription factor	Coiled-coil

• Sequence:

  MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
  IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRA
  QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
  TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT
  LPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
  ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK
  GSSSNEPSSDSLSSPTLLAL

• Sequence length: 380

Pathways

KEGG Pathway	Reactome Pathway
Endocrine resistance	Oxidative Stress Induced Senescence
MAPK signaling pathway	Senescence-Associated Secretory Phenotype (SASP)
cAMP signaling pathway	FCERI mediated MAPK activation
Apoptosis	Activation of the AP-1 family of transcription factors
Osteoclast differentiation	Interleukin-4 and Interleukin-13 signaling
Toll-like receptor signaling pathway	TP53 Regulates Transcription of DNA Repair Genes
IL-17 signaling pathway	Estrogen-dependent gene expression
Th1 and Th2 cell differentiation	NGF-stimulated transcription
Th17 cell differentiation	Estrogen-dependent nuclear events downstream of ESR-membrane signaling
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Circadian entrainment
Cholinergic synapse
Dopaminergic synapse
Estrogen signaling pathway
Prolactin signaling pathway
Oxytocin signaling pathway
Relaxin signaling pathway
Parathyroid hormone synthesis, secretion and action
Non-alcoholic fatty liver disease
Growth hormone synthesis, secretion and action
Amphetamine addiction
Pathogenic Escherichia coli infection
Salmonella infection
Pertussis
Yersinia infection
Leishmaniasis
Chagas disease
Hepatitis B
Measles
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19
Pathways in cancer
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Colorectal cancer
Breast cancer
Choline metabolism in cancer
PD-L1 expression and PD-1 checkpoint pathway in cancer
Rheumatoid arthritis
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (43)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	19689456	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	11796754	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	16488545	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	19565504	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BERARDINELLI-SEIP CONGENITAL LIPODYSTROPHY	—	GWAS catalog	23919306	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	9630518	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	16298037	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	28284560, 9029167	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, OVARIAN EPITHELIAL	—	CTD	28811376	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	28789951	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	37156999	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	23284138	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	15973680	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL GENERALIZED LIPODYSTROPHY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHAGE	—	CTD	7844257	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	27093858	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIS	—	CTD	18355967	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	12044476, 24039778	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	37156999	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	16289808	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISEASES	—	CTD	12890883	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	27071101	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	11955713, 12946577, 8923670, 9630518	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	16696126, 18587450, 18988310, 7984056	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	15196791, 15196794, 18485423	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIGEMINAL NEURALGIA	—	CTD, Disgenet CTD, Disgenet	27093858	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	37156999	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (509)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acanthosis Nigricans	Acanthosis Nigricans	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	2243505, 22869147		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	2834348		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10713684		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18032824		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	18436711		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16166335		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	2842040		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	2842040		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22869147		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	27600282, 28466382, 2847164, 30066853		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	20826579		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17712163	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	9880041	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	9180219		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	LHGDN	12147741		★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	17518770		★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	CTD_human_DG	11796754		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	CTD_human_DG	11796754		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	CTD_human_DG	11796754		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	28428828		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	21175428		★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	Pubtator	32422284	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29535371		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	31022457		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	16488545		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety Disorder	BEFREE	22832404, 31022457		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	16488545		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	20488324		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	23523566		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	19008257		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	39766890	Associate	★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	20826579		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21978922, 30785199		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16947419, 17626252		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	8601460, 9421489	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	37965313	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	23684916, 24089231, 27572279, 30893847, 31178673, 36439145, 8660103, 9613344	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	29487594		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11488985, 16452600, 31638834, 7500041, 7633872, 8541027		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	9854051	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	1322154, 1902475, 19320777	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	27229157	Stimulate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	30572904		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	28692051		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	15728378	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21978922, 30785199		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	29940585	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	HPO_DG			★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	29106869		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28824171		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	32042069, 34267747	Associate	★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	17518770		★☆☆☆☆ Found in Text Mining only
Awakening Epilepsy	Epilepsy	CTD_human_DG	15973680		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	22493372, 28233171, 29285195, 31754348		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	19064921		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	1398227	Associate	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	29858576		★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	31047984		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	19488045	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25050631, 27485165		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	10071076		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	19652200	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	11398843, 33034932	Associate	★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	11398843, 36426824	Associate	★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	29858576, 30361264, 31768625		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	23301044	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10369069, 11891846, 14985464, 16027729, 17637753, 1906001, 20457246, 22004728, 22132731, 23242121, 24073962, 25824986, 30013671, 7499402, 8314777, 8597534, 9270011, 9658402		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15090535, 15607537, 15746191, 18826606, 18928543, 1906001, 1922031, 20537635, 21167036, 21655091, 23135268, 23301044, 25824986, 26179713, 26415222, 26957268, 30087366, 31766464, 32350443, 32616754, 32649310, 33432018, 34707101, 34856073, 35037412, 36010586, 38063270, 7794075, 8206948, 9032254	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	33742056	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Calcinosis	Calcinosis	Pubtator	15728378	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11570575, 15507668, 15746191, 16475721, 18978706, 21496227, 24296757, 26581505, 28811522, 29150442, 29422527, 33836600, 33941222	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19758438, 25271301, 28502334, 29582647		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	11348463	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	23609359	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	23083134, 23301044	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15078869, 16038047, 1661347, 17278226, 19009649, 21862593, 23844083, 29391759, 31543683, 32280695, 32815653, 34238253, 37723590, 9030721	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30228980	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25050631, 27485165		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	29483928		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21847632, 22363436, 9662339		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	18854825	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	29130097	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10935492, 14966901, 18978706, 21822357, 24356192, 29582647, 9484827	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	1469506		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18854825, 24322891, 27553367		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	CTD_human_DG	28811376		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardioembolic stroke	Cardioembolic Stroke	BEFREE	31561071		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	30368515	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	23609359		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	17626252		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	32534225	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar diseases	Pubtator	40445405	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	11239196		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	25135788, 28834871, 37268894, 40629591	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21496227, 23682787, 9127136		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	10329043, 21496227, 23682787, 9127136		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22869147		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	31795085	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	28789951		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chondrosarcoma	Chondrosarcoma	Pubtator	11398843	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	34330313	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29642064		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19064921		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28602698		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	BEFREE	23281395		★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	11955713, 12946577, 8923670, 9630518		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31569788		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24118792, 26461477	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15139522, 19755660, 23210512, 2842040		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	18032824	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	14712303, 16259733, 16361535, 17510314, 21418301, 22489574, 26461477, 27065323, 28381157, 30569725, 30591445, 30945457, 31261535		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16207476, 26222778, 26461477, 31261535, 34337040, 36698183, 38233377	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	22108803		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23588207	Stimulate	★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	11955713, 12946577, 8923670, 9630518		★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	16696126, 18587450, 18988310, 7984056		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	8099316		★☆☆☆☆ Found in Text Mining only
Congenital generalized lipodystrophy	Congenital Lipodystrophy	Orphanet			★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28258798, 30158581		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	14521609	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21978922		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21978922		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	33849106, 40184077	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	21978922		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	12223450, 25182475		★☆☆☆☆ Found in Text Mining only
Cutis Laxa	Cutis Laxa	BEFREE	8617996		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	1320571, 21961038, 24089231, 26903440, 27082319, 28256567, 28627596, 30081074		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	23720503	Stimulate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30458222, 31299320		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28409880		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	11121152	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	11121152, 11912010, 24853951		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	26251042		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	26599598		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26599598		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28739185	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	30476653	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	24838153, 30476653, 7926295		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30708140		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	34926700	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	35721731	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	35991124, 36329882, 36585417, 37396184	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	26599598		★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	22820187	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27600282		★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	27651465	Associate	★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	24931237		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	11121152, 11912010, 24853951		★☆☆☆☆ Found in Text Mining only
Encephalocele	Encephalocele	Pubtator	12384753	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11720885, 25153722, 26437953, 28502334, 30464615		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	10393530, 11570575, 22706224, 23530112, 25153722, 8701784	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	19022561		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	23284138		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	17888430		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	17888430	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	19199093		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	CTD_human_DG	23284138		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	32240297, 33033989, 38456992	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Enteritis	Enteritis	BEFREE	17639289		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	CTD_human_DG	15973680		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	17910586	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	BEFREE	29399113		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy Partial with Variable Foci	Progressive myoclonic epilepsy	Pubtator	17910586	Stimulate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	15973680		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	11955713, 12946577, 8923670, 9630518		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	19558549, 19758438		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	14966901, 26858249, 27906434, 36569220	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	19558549, 19758438		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24052437, 31277149, 36466860	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	28748534		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	15895718		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	8232942, 8247328		★☆☆☆☆ Found in Text Mining only
Familial generalized lipodystrophy	Lipodystrophy	BEFREE	23919306		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial generalized lipodystrophy	Lipodystrophy	ORPHANET_DG	23919306		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial medullary thyroid carcinoma	Medullary thyroid carcinoma	BEFREE	17209045		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	38072306	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	11732005		★☆☆☆☆ Found in Text Mining only
Fibrocartilaginous Dysplasia of Bone	Fibrocartilaginous Dysplasia Of Bone	CTD_human_DG	7739708		★☆☆☆☆ Found in Text Mining only
Fibrocystic Dysplasia of Bone	Fibrocystic Dysplasia Of Bone	CTD_human_DG	7739708		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	12753293		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	8916147		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	14631383		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	24706321	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	24706321		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	11955713, 12946577, 8923670, 9630518		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	BEFREE	31539618		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	25764026	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Tendon Sheath	Giant cell tumor of tendon sheath	Pubtator	32108038	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	36727359	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10885623, 16849552, 19276385, 20467333, 7566386		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	12468535, 15831677, 24732116, 35538663	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10885623, 11778649, 16849552, 19276385, 30572904, 7566386		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	17235455		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26571389, 27602752		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27602752, 8910439	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	18443593		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	1712408, 24652774, 27127888, 31392215, 32791747, 38278877	Associate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	19482216		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	9497315	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35524416, 35813414	Associate	★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	16696126, 18587450, 18988310, 7984056		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	21480395		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	37268894	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	30368515, 36859608, 37334672	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	26173738		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	31305404	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	3499189	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	37795100	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	23844083	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytoid hemangioma	Epithelioid hemangioma	BEFREE	26135557, 29150442, 29266025		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	1691591, 27600282		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	22723319		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	11053476, 28478229		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	18923650	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	20359597, 37675573	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Renal	Renal hypertension	Pubtator	24085434	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CTD_human_DG	12044476, 24039778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	20430007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	31728912		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	29670181		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12737630, 18826606, 8065332, 9287359	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	15211754, 8536713	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	28653477		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31025089		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	34972106	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	24652774, 27127888		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	28502334		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	32083545	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	12374626		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28409880		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	23562910		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	29208967, 29286093		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	32572902	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	12384753	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Displacement	Intervertebral disc displacement	Pubtator	12384753	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	25135788	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28834871		★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	11955713, 12946577, 8923670, 9630518		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	25961698, 27600282, 28659618, 29588546, 29597249		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	11576350, 24652774	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	26860885, 30708140		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30659917		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	29483928	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	15228428, 18692824, 32108038, 7997802	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10713077, 19444595, 2506946, 2910363, 3276363, 3499189, 3520570, 3539224	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	28319094, 3539224		★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	3530350	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Lymphoid leukemia	Pubtator	3499189	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	2174893, 3547082	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24867525, 25340776, 3499189	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	2834348	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	1835747, 2146981		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23247046, 25340776, 25860293, 2653488, 8445947		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	12149223		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	31201998	Associate	★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	28941573, 29186377		★☆☆☆☆ Found in Text Mining only
Lipoatrophic Diabetes Mellitus	Lipoatrophic Diabetes Mellitus	ORPHANET_DG	23919306		★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lipodystrophy Congenital Generalized	Lipodystrophy	Pubtator	23919306	Associate	★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	32108038	Associate	★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple Symmetrical	Lipomatosis	BEFREE	28901441		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16038047, 17278226, 17543481, 18644981, 19133651, 21473287, 24659263, 25523140, 25526895, 28043148, 28356389, 29434983, 29731667, 30228980, 8692198		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16038047		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560, 9029167		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	28355233	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	10913062, 8601460	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	16038047		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28692045		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	12424143		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32457348, 34972106	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	16289808		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	22363436, 24132637, 28811522, 36224313	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28502334		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15322221, 21757709	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	3701256, 9822266	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	1472125, 15322221, 16224536, 21757709, 29593737		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18158562	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24052437, 33441952	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	15507668		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18494816, 23064464, 29597249		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	37569769	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	18494816, 9864169		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	25734512		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	23810250		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	21480395		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10369069, 14985464, 16027729, 17407600, 17637753, 18826606, 1906001, 20457246, 22004728, 22132731, 23242121, 24073962, 25824986, 30013671, 8314777, 8597534, 9270011, 9658402		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	11720885, 25153722, 26437953, 30464615		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	19558549, 19758438		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	29483928		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	17901709, 18644981		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	16289808		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21847632, 22363436, 9662339		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	19653276		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24322891, 27553367		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19435822, 19887609, 22109562, 30767554		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12727841, 16199533, 16272172, 16964758, 19787273, 21743958, 26786102, 27604827, 28386843, 29758263, 31276688		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	15972968		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11866445, 20944126, 26261179		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	12687275, 14602779		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25050631, 27485165		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10417766, 10449779, 10924853, 16272172, 16784822, 17510397, 17957143, 19057013, 19653276, 19850100, 20338993, 20433688, 21892628, 21981137, 22308434, 23828905, 24315690, 25260594, 25271301, 25865774, 26088082, 27132513, 27600282, 28315425, 28381157, 28951297, 29237043, 29379481, 29422527, 29597249, 30013671, 30569725, 30708140, 31229900, 9270011		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21496227, 23682787, 9127136		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15139522, 19755660, 23210512		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18368600		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18519796, 18928543, 24073962, 24345432		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	17951536		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11251188, 12939465, 1469506, 15492260, 16116595, 1712822, 23633675, 9824619		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	1372901, 14519134, 14717848, 16116595, 1712822, 23400877, 25695333, 33373316, 35926467, 8836133	Associate	★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	31177064		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	1353485, 29302888, 8057146		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30458222, 31299320		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	20374154, 30021357		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19815709	Associate	★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	12374626		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	28559979		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine	Pubtator	23720503	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	33097606	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	25451397	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	30170082		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	11398843, 18978706	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	18978706	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	29582647	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27890927, 28835615, 31284669		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	28487543, 28835615, 33963182, 36251145	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23456643, 29535371		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	29807388		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	23593403		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	23320102, 23593403, 27513856, 34944006	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	12573143		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10071076, 23919306, 26460262		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30053527, 31715034		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	34799616, 37334672	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	40685440	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	31456916		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	33318581	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	19158123, 20034923		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	9797757	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29017171		★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	20530413		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10449779, 10673028, 11108661, 11358840, 11570575, 11991252, 1469506, 15554385, 16166335, 16412434, 17297470, 17363560, 17440073, 17846172, 18084253, 18774655, 19329434, 21892628, 21975339, 22510872, 23242121, 23846687, 24042169, 24073962, 24341438, 2477687, 24980816, 25003254, 25153722, 26472150, 26571389, 27132513, 27965308, 28315425, 29150442, 29206716, 29483928, 29858032, 29858576, 30353072, 30704487, 31483418, 31490237, 31768625, 7766308, 8099529, 8387543, 8389028, 8597534, 8916147, 9270011, 9864169		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	28433687	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	CTD_human_DG	12890883		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurilemmoma	Neurilemmoma	BEFREE	1353485		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	1360635, 16484283, 1720402, 19269029, 26734995, 31303139, 9218873		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	17409494, 1902412	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26445738		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	29017171		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24411941, 31013265		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	16696126, 18587450, 18988310, 7984056		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29596910, 8542585, 9662339		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	6731000		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24558408	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	30063946, 31022457, 31364017		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	29885848		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	15375172	Associate	★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	8141796		★☆☆☆☆ Found in Text Mining only
Osteitis Fibrosa Disseminata	Fibrous dysplasia	CTD_human_DG	7739708		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27866912, 28256567, 30081074, 36619785, 38090564, 38401067	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	30893847	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29693149, 30661131		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	17412493, 28665975	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	2117257, 27072870, 28319094, 28425198, 28665975, 29796618, 29858576, 30001480, 31490237, 6306448, 6877368, 7933116		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24322891, 27553367		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18854825	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	2113532, 28407786, 29130097, 34737212, 8168613	Associate	★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	8141796		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19435822, 19887609, 22109562, 30767554		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10217407, 18832796, 25789763, 30696421, 30767554	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	19513551, 30704487		★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	29670181		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	29516510		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36389665	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	26498853		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	16696126, 18587450, 18988310, 7984056		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	31655798	Associate	★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	16049073		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	16049073, 22570239		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	LHGDN	16049073		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	22723319		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	HPO_DG			★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	2243505		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	28603286		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	3398845		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	12698259		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12727841, 15486991, 16199533, 16272172, 16964758, 19787273, 21617851, 21743958, 26786102, 27604827, 28386843, 29758263, 31276688		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	24500928		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	24500928	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10864209, 19123467, 24499138, 25281873, 30483762, 9166941	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15921770		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	16385345, 28502334		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	1940437	Inhibit	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	38115636	Associate	★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	23559854		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	33393628	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	22265050		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	18641127		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23583295		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	21975339		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	8649863		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28258798, 30158581		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28243236		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	2117257, 7702750		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	8230424	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	23797008	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	35879366	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10088772, 11037876, 11953970, 12705898, 1320571, 26211509, 26362732, 27653023, 8649863		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12705898		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	34383804	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	8456948	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	3138285		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	23281395, 30353072		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	37599787, 39201282	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	25903346	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	25658856, 31175266	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30967896, 31175266, 31299320		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	30312535	Stimulate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	31178673	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Secondary physiologic amenorrhea	Secondary Physiologic Amenorrhea	HPO_DG			★☆☆☆☆ Found in Text Mining only
Secondary Trigeminal Neuralgia	Trigeminal neuralgia	CTD_human_DG	27093858		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	33388373	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	16125115, 29406423, 29935173		★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	23637909		★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	11955713, 12946577, 8923670, 9630518		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	8120411	Associate	★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	27651465		★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	24465924		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22772468, 23633675, 24029918, 28751006		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31277149		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16050486, 24466237, 25945837, 27349552, 35211756	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	12393863, 20949447, 27965308		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	16696126, 18587450, 18988310, 7984056		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	16696126, 18587450, 18988310, 7984056		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31013265		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	HPO_DG			★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	28653477		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11866445, 20944126, 26261179		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	14606069, 16769709, 18158562, 21047770, 28058586, 28169308, 30266078, 31380415, 33441952, 36171622, 36609277, 36615849, 37460253, 8612619	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15188457		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	25135788, 32626985	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	29968759	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	21515915, 22139817		★☆☆☆☆ Found in Text Mining only
Talipes transversoplanus	Talipes Transversoplanus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	17167184	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	37460318	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	28077500		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	10504000	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30358208	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12687275, 14602779		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	24044365		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	12687275, 14602779		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	12687275		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	3348948	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	2803926	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	26581505	Associate	★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	11955713, 12946577, 8923670, 9630518		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	CTD_human_DG	27093858		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Trigeminal Neuralgia, Idiopathic	Trigeminal neuralgia	CTD_human_DG	27093858		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29273624, 33533919, 35355564, 39206896	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31015574		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	25182475, 26461477		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uremia	Uremia	Pubtator	34858433, 37795100	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25865820, 28358415, 29518027, 29532898	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15514944	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15548518, 21496227, 21937452, 22405256, 24987920, 29073938, 34151839, 35503086, 36431966, 8985358	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	15228428	Associate	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	26908399		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	11889018, 31720303		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	34858433	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular hypertrophy	Ventricular hypertrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	11955713, 12946577, 8923670, 9630518		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum Complementation Group G	Xeroderma pigmentosum	Pubtator	26149386	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

JUN 7 shared diseasesJuvenile arthritis, Brain injuries, Cholelithiasis, Juvenile idiopathic arthritis, Oligoarticular juvenile idiopathic arthritis, Lung neoplasms, Status epilepticus 44 shared pathwaysEndocrine resistance, MAPK signaling pathway, cAMP signaling pathway, Apoptosis, Osteoclast differentiation, Toll-like receptor signaling pathway, IL-17 signaling pathway, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, B cell receptor signaling pathway, TNF signaling pathway +32 more 10 shared evidence sourcesCTD (Juvenile arthritis), CTD (Brain injuries), CTD (Cholelithiasis), Disgenet (Cholelithiasis), CTD (Hypertension), Disgenet (Juvenile idiopathic arthritis), Disgenet (Oligoarticular juvenile idiopathic arthritis), CTD (Lung neoplasms), Disgenet (Status epilepticus), CTD (Status epilepticus) Related via 44 shared pathways including Endocrine resistance, MAPK signaling pathway — evidence mostly CTD. MAPK9 3 shared diseasesCholelithiasis, Hyperalgesia, Trigeminal neuralgia 35 shared pathwaysEndocrine resistance, MAPK signaling pathway, cAMP signaling pathway, Apoptosis, Osteoclast differentiation, Toll-like receptor signaling pathway, IL-17 signaling pathway, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, TNF signaling pathway, Dopaminergic synapse +23 more 5 shared evidence sourcesCTD (Cholelithiasis), Disgenet (Cholelithiasis), CTD (Hyperalgesia), CTD (Trigeminal neuralgia), Disgenet (Trigeminal neuralgia) Related via 35 shared pathways including Endocrine resistance, MAPK signaling pathway — evidence mostly CTD. MAPK1 7 shared diseasesJuvenile arthritis, Cholelithiasis, Hyperalgesia, Juvenile idiopathic arthritis, Oligoarticular juvenile idiopathic arthritis, Lung neoplasms, Trigeminal neuralgia 43 shared pathwaysEndocrine resistance, MAPK signaling pathway, cAMP signaling pathway, Apoptosis, Osteoclast differentiation, Toll-like receptor signaling pathway, IL-17 signaling pathway, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, B cell receptor signaling pathway, TNF signaling pathway +31 more 10 shared evidence sourcesCTD (Juvenile arthritis), CTD (Cholelithiasis), Disgenet (Cholelithiasis), CTD (Hyperalgesia), Disgenet (Juvenile idiopathic arthritis), Disgenet (Oligoarticular juvenile idiopathic arthritis), CTD (Lung neoplasms), CTD (Substance abuse), CTD (Trigeminal neuralgia), Disgenet (Trigeminal neuralgia) Related via 43 shared pathways including Endocrine resistance, MAPK signaling pathway — evidence mostly CTD. MAPK8 3 shared diseasesCholelithiasis, Hyperalgesia, Trigeminal neuralgia 35 shared pathwaysEndocrine resistance, MAPK signaling pathway, cAMP signaling pathway, Apoptosis, Osteoclast differentiation, Toll-like receptor signaling pathway, IL-17 signaling pathway, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, TNF signaling pathway, Dopaminergic synapse +23 more 5 shared evidence sourcesCTD (Cholelithiasis), Disgenet (Cholelithiasis), CTD (Hyperalgesia), CTD (Trigeminal neuralgia), Disgenet (Trigeminal neuralgia) Related via 35 shared pathways including Endocrine resistance, MAPK signaling pathway — evidence mostly CTD. MAPK3 4 shared diseasesCholelithiasis, Hyperalgesia, Lung neoplasms, Trigeminal neuralgia 42 shared pathwaysEndocrine resistance, MAPK signaling pathway, cAMP signaling pathway, Apoptosis, Osteoclast differentiation, Toll-like receptor signaling pathway, IL-17 signaling pathway, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, B cell receptor signaling pathway, TNF signaling pathway +30 more 7 shared evidence sourcesCTD (Cholelithiasis), Disgenet (Cholelithiasis), CTD (Hyperalgesia), CTD (Lung neoplasms), CTD (Substance abuse), CTD (Trigeminal neuralgia), Disgenet (Trigeminal neuralgia) Related via 42 shared pathways including Endocrine resistance, MAPK signaling pathway — evidence mostly CTD.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
JUN	7	["Juvenile arthritis","Brain injuries","Cholelithiasis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis","Lung neoplasms","Status epilepticus"]	44	["Endocrine resistance","MAPK signaling pathway","cAMP signaling pathway","Apoptosis","Osteoclast differentiation","Toll-like receptor signaling pathway","IL-17 signaling pathway","Th1 and Th2 cell differentiation","Th17 cell differentiation","T cell receptor signaling pathway","B cell receptor signaling pathway","TNF signaling pathway"]	10	["CTD (Juvenile arthritis)","CTD (Brain injuries)","CTD (Cholelithiasis)","Disgenet (Cholelithiasis)","CTD (Hypertension)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)","CTD (Lung neoplasms)","Disgenet (Status epilepticus)","CTD (Status epilepticus)"]
MAPK9	3	["Cholelithiasis","Hyperalgesia","Trigeminal neuralgia"]	35	["Endocrine resistance","MAPK signaling pathway","cAMP signaling pathway","Apoptosis","Osteoclast differentiation","Toll-like receptor signaling pathway","IL-17 signaling pathway","Th1 and Th2 cell differentiation","Th17 cell differentiation","T cell receptor signaling pathway","TNF signaling pathway","Dopaminergic synapse"]	5	["CTD (Cholelithiasis)","Disgenet (Cholelithiasis)","CTD (Hyperalgesia)","CTD (Trigeminal neuralgia)","Disgenet (Trigeminal neuralgia)"]
MAPK1	7	["Juvenile arthritis","Cholelithiasis","Hyperalgesia","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis","Lung neoplasms","Trigeminal neuralgia"]	43	["Endocrine resistance","MAPK signaling pathway","cAMP signaling pathway","Apoptosis","Osteoclast differentiation","Toll-like receptor signaling pathway","IL-17 signaling pathway","Th1 and Th2 cell differentiation","Th17 cell differentiation","T cell receptor signaling pathway","B cell receptor signaling pathway","TNF signaling pathway"]	10	["CTD (Juvenile arthritis)","CTD (Cholelithiasis)","Disgenet (Cholelithiasis)","CTD (Hyperalgesia)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)","CTD (Lung neoplasms)","CTD (Substance abuse)","CTD (Trigeminal neuralgia)","Disgenet (Trigeminal neuralgia)"]
MAPK8	3	["Cholelithiasis","Hyperalgesia","Trigeminal neuralgia"]	35	["Endocrine resistance","MAPK signaling pathway","cAMP signaling pathway","Apoptosis","Osteoclast differentiation","Toll-like receptor signaling pathway","IL-17 signaling pathway","Th1 and Th2 cell differentiation","Th17 cell differentiation","T cell receptor signaling pathway","TNF signaling pathway","Dopaminergic synapse"]	5	["CTD (Cholelithiasis)","Disgenet (Cholelithiasis)","CTD (Hyperalgesia)","CTD (Trigeminal neuralgia)","Disgenet (Trigeminal neuralgia)"]
MAPK3	4	["Cholelithiasis","Hyperalgesia","Lung neoplasms","Trigeminal neuralgia"]	42	["Endocrine resistance","MAPK signaling pathway","cAMP signaling pathway","Apoptosis","Osteoclast differentiation","Toll-like receptor signaling pathway","IL-17 signaling pathway","Th1 and Th2 cell differentiation","Th17 cell differentiation","T cell receptor signaling pathway","B cell receptor signaling pathway","TNF signaling pathway"]	7	["CTD (Cholelithiasis)","Disgenet (Cholelithiasis)","CTD (Hyperalgesia)","CTD (Lung neoplasms)","CTD (Substance abuse)","CTD (Trigeminal neuralgia)","Disgenet (Trigeminal neuralgia)"]

Diseases Linked via Similar Genes

Schizophrenia Linked via 4 of 5 related genesJUN, MAPK1, MAPK8, MAPK3 Stomach neoplasms Linked via 4 of 5 related genesJUN, MAPK1, MAPK8, MAPK3 Brain ischemia Linked via 3 of 5 related genesJUN, MAPK1, MAPK3 Diabetes mellitus type 2 Linked via 2 of 5 related genesMAPK9, MAPK8 Prostatic neoplasms Linked via 2 of 5 related genesMAPK9, MAPK3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Schizophrenia	4	["JUN","MAPK1","MAPK8","MAPK3"]
Stomach neoplasms	4	["JUN","MAPK1","MAPK8","MAPK3"]
Brain ischemia	3	["JUN","MAPK1","MAPK3"]
Diabetes mellitus type 2	2	["MAPK9","MAPK8"]
Prostatic neoplasms	2	["MAPK9","MAPK3"]