MAPK9 (mitogen-activated protein kinase 9)

Gene

• Entrez ID: 5601
• Gene name: Mitogen-activated protein kinase 9
• Gene symbol: MAPK9
• Synonyms (NCBI Gene): JNK-55, JNK2, JNK2A, JNK2ALPHA, JNK2B, JNK2BETA, PRKM9, SAPK, SAPK1a, p54a, p54aSAPK
• Chromosome: 5
• Chromosome location: 5q35.3
• Summary: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004359	hsa-miR-17-5p	qRT-PCR, Luciferase reporter assay, Western blot	18700987
MIRT003982	hsa-miR-199a-3p	Western blot	18456660
MIRT003240	hsa-miR-93-5p	Luciferase reporter assay	20065103
MIRT004359	hsa-miR-17-5p	Luciferase reporter assay	21283765
MIRT005856	hsa-miR-20a-5p	Luciferase reporter assay	21283765
MIRT005864	hsa-miR-106b-5p	Luciferase reporter assay	21283765
MIRT021647	hsa-miR-141-3p	Western blot	20053927
MIRT024284	hsa-miR-215-5p	Microarray	19074876
MIRT025800	hsa-miR-7-5p	Sequencing	20371350
MIRT026550	hsa-miR-192-5p	Microarray	19074876
MIRT049753	hsa-miR-92a-3p	CLASH	23622248
MIRT046207	hsa-miR-27b-3p	CLASH	23622248
MIRT004359	hsa-miR-17-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	23029228
MIRT054220	hsa-miR-20b-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	23029228
MIRT054221	hsa-miR-106a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	23029228
MIRT448681	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT448680	hsa-miR-3622a-3p	PAR-CLIP	22100165
MIRT448679	hsa-miR-3622b-3p	PAR-CLIP	22100165
MIRT448678	hsa-miR-6765-3p	PAR-CLIP	22100165
MIRT448677	hsa-miR-4635	PAR-CLIP	22100165
MIRT313265	hsa-miR-1178-3p	PAR-CLIP	22100165
MIRT448681	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT448680	hsa-miR-3622a-3p	PAR-CLIP	22100165
MIRT448679	hsa-miR-3622b-3p	PAR-CLIP	22100165
MIRT448678	hsa-miR-6765-3p	PAR-CLIP	22100165
MIRT448677	hsa-miR-4635	PAR-CLIP	22100165
MIRT313265	hsa-miR-1178-3p	PAR-CLIP	22100165
MIRT021647	hsa-miR-141-3p	Microarray, qRT-PCR	35816043
MIRT1131263	hsa-miR-106a	CLIP-seq
MIRT1131264	hsa-miR-106b	CLIP-seq
MIRT1131265	hsa-miR-1237	CLIP-seq
MIRT1131266	hsa-miR-1248	CLIP-seq
MIRT1131267	hsa-miR-1256	CLIP-seq
MIRT1131268	hsa-miR-1257	CLIP-seq
MIRT1131269	hsa-miR-1271	CLIP-seq
MIRT1131270	hsa-miR-1275	CLIP-seq
MIRT1131271	hsa-miR-150	CLIP-seq
MIRT1131272	hsa-miR-15a	CLIP-seq
MIRT1131273	hsa-miR-15b	CLIP-seq
MIRT1131274	hsa-miR-16	CLIP-seq
MIRT1131275	hsa-miR-17	CLIP-seq
MIRT1131276	hsa-miR-182	CLIP-seq
MIRT1131277	hsa-miR-185	CLIP-seq
MIRT1131278	hsa-miR-195	CLIP-seq
MIRT1131279	hsa-miR-200b	CLIP-seq
MIRT1131280	hsa-miR-200c	CLIP-seq
MIRT1131281	hsa-miR-205	CLIP-seq
MIRT1131282	hsa-miR-20a	CLIP-seq
MIRT1131283	hsa-miR-20b	CLIP-seq
MIRT1131284	hsa-miR-302a	CLIP-seq
MIRT1131285	hsa-miR-302b	CLIP-seq
MIRT1131286	hsa-miR-302c	CLIP-seq
MIRT1131287	hsa-miR-302d	CLIP-seq
MIRT1131288	hsa-miR-302e	CLIP-seq
MIRT1131289	hsa-miR-3126-5p	CLIP-seq
MIRT1131290	hsa-miR-3127-5p	CLIP-seq
MIRT1131291	hsa-miR-3153	CLIP-seq
MIRT1131292	hsa-miR-3159	CLIP-seq
MIRT1131293	hsa-miR-3167	CLIP-seq
MIRT1131294	hsa-miR-3175	CLIP-seq
MIRT1131295	hsa-miR-3609	CLIP-seq
MIRT1131296	hsa-miR-3653	CLIP-seq
MIRT1131297	hsa-miR-3661	CLIP-seq
MIRT1131298	hsa-miR-3690	CLIP-seq
MIRT1131299	hsa-miR-372	CLIP-seq
MIRT1131300	hsa-miR-373	CLIP-seq
MIRT1131301	hsa-miR-3909	CLIP-seq
MIRT1131302	hsa-miR-3910	CLIP-seq
MIRT1131303	hsa-miR-424	CLIP-seq
MIRT1131304	hsa-miR-4289	CLIP-seq
MIRT1131305	hsa-miR-429	CLIP-seq
MIRT1131306	hsa-miR-4306	CLIP-seq
MIRT1131307	hsa-miR-4311	CLIP-seq
MIRT1131308	hsa-miR-4419a	CLIP-seq
MIRT1131309	hsa-miR-4436b-3p	CLIP-seq
MIRT1131310	hsa-miR-4510	CLIP-seq
MIRT1131311	hsa-miR-4525	CLIP-seq
MIRT1131312	hsa-miR-4638-3p	CLIP-seq
MIRT1131313	hsa-miR-4642	CLIP-seq
MIRT1131314	hsa-miR-4644	CLIP-seq
MIRT1131315	hsa-miR-4665-5p	CLIP-seq
MIRT1131316	hsa-miR-4682	CLIP-seq
MIRT1131317	hsa-miR-4690-5p	CLIP-seq
MIRT1131318	hsa-miR-4708-3p	CLIP-seq
MIRT1131319	hsa-miR-4717-3p	CLIP-seq
MIRT1131320	hsa-miR-4723-5p	CLIP-seq
MIRT1131321	hsa-miR-4742-5p	CLIP-seq
MIRT1131322	hsa-miR-4760-3p	CLIP-seq
MIRT1131323	hsa-miR-4761-3p	CLIP-seq
MIRT1131324	hsa-miR-4786-5p	CLIP-seq
MIRT1131325	hsa-miR-497	CLIP-seq
MIRT1131326	hsa-miR-498	CLIP-seq
MIRT1131327	hsa-miR-519d	CLIP-seq
MIRT1131328	hsa-miR-520a-3p	CLIP-seq
MIRT1131329	hsa-miR-520b	CLIP-seq
MIRT1131330	hsa-miR-520c-3p	CLIP-seq
MIRT1131331	hsa-miR-520d-3p	CLIP-seq
MIRT1131332	hsa-miR-520e	CLIP-seq
MIRT1131333	hsa-miR-520g	CLIP-seq
MIRT1131334	hsa-miR-520h	CLIP-seq
MIRT1131335	hsa-miR-548ag	CLIP-seq
MIRT1131336	hsa-miR-548ah	CLIP-seq
MIRT1131337	hsa-miR-548ai	CLIP-seq
MIRT1131338	hsa-miR-548p	CLIP-seq
MIRT1131339	hsa-miR-619	CLIP-seq
MIRT1131340	hsa-miR-625	CLIP-seq
MIRT1131341	hsa-miR-631	CLIP-seq
MIRT1131342	hsa-miR-769-5p	CLIP-seq
MIRT1131343	hsa-miR-876-5p	CLIP-seq
MIRT1131344	hsa-miR-93	CLIP-seq
MIRT1131345	hsa-miR-96	CLIP-seq
MIRT1131263	hsa-miR-106a	CLIP-seq
MIRT1131264	hsa-miR-106b	CLIP-seq
MIRT1131267	hsa-miR-1256	CLIP-seq
MIRT1131269	hsa-miR-1271	CLIP-seq
MIRT1131346	hsa-miR-1299	CLIP-seq
MIRT1131347	hsa-miR-1324	CLIP-seq
MIRT1131272	hsa-miR-15a	CLIP-seq
MIRT1131273	hsa-miR-15b	CLIP-seq
MIRT1131274	hsa-miR-16	CLIP-seq
MIRT1131275	hsa-miR-17	CLIP-seq
MIRT1131276	hsa-miR-182	CLIP-seq
MIRT1131278	hsa-miR-195	CLIP-seq
MIRT1131279	hsa-miR-200b	CLIP-seq
MIRT1131280	hsa-miR-200c	CLIP-seq
MIRT1131282	hsa-miR-20a	CLIP-seq
MIRT1131283	hsa-miR-20b	CLIP-seq
MIRT1131284	hsa-miR-302a	CLIP-seq
MIRT1131285	hsa-miR-302b	CLIP-seq
MIRT1131286	hsa-miR-302c	CLIP-seq
MIRT1131287	hsa-miR-302d	CLIP-seq
MIRT1131288	hsa-miR-302e	CLIP-seq
MIRT1131292	hsa-miR-3159	CLIP-seq
MIRT1131293	hsa-miR-3167	CLIP-seq
MIRT1131348	hsa-miR-3170	CLIP-seq
MIRT1131349	hsa-miR-342-5p	CLIP-seq
MIRT1131350	hsa-miR-3605-3p	CLIP-seq
MIRT1131351	hsa-miR-3676	CLIP-seq
MIRT1131299	hsa-miR-372	CLIP-seq
MIRT1131300	hsa-miR-373	CLIP-seq
MIRT1131352	hsa-miR-374c	CLIP-seq
MIRT1131353	hsa-miR-378	CLIP-seq
MIRT1131354	hsa-miR-378b	CLIP-seq
MIRT1131355	hsa-miR-378c	CLIP-seq
MIRT1131356	hsa-miR-378d	CLIP-seq
MIRT1131357	hsa-miR-378e	CLIP-seq
MIRT1131358	hsa-miR-378f	CLIP-seq
MIRT1131359	hsa-miR-378h	CLIP-seq
MIRT1131360	hsa-miR-378i	CLIP-seq
MIRT1131361	hsa-miR-3926	CLIP-seq
MIRT1131362	hsa-miR-3942-3p	CLIP-seq
MIRT1131363	hsa-miR-422a	CLIP-seq
MIRT1131303	hsa-miR-424	CLIP-seq
MIRT1131305	hsa-miR-429	CLIP-seq
MIRT1131307	hsa-miR-4311	CLIP-seq
MIRT1131364	hsa-miR-433	CLIP-seq
MIRT1131365	hsa-miR-4462	CLIP-seq
MIRT1131366	hsa-miR-4514	CLIP-seq
MIRT1131312	hsa-miR-4638-3p	CLIP-seq
MIRT1131313	hsa-miR-4642	CLIP-seq
MIRT1131367	hsa-miR-4643	CLIP-seq
MIRT1131368	hsa-miR-4651	CLIP-seq
MIRT1131369	hsa-miR-4659a-3p	CLIP-seq
MIRT1131370	hsa-miR-4659b-3p	CLIP-seq
MIRT1131371	hsa-miR-466	CLIP-seq
MIRT1131372	hsa-miR-4664-5p	CLIP-seq
MIRT1131373	hsa-miR-4692	CLIP-seq
MIRT1131374	hsa-miR-4699-5p	CLIP-seq
MIRT1131319	hsa-miR-4717-3p	CLIP-seq
MIRT1131321	hsa-miR-4742-5p	CLIP-seq
MIRT1131375	hsa-miR-4778-5p	CLIP-seq
MIRT1131376	hsa-miR-4782-5p	CLIP-seq
MIRT1131377	hsa-miR-4789-3p	CLIP-seq
MIRT1131325	hsa-miR-497	CLIP-seq
MIRT1131326	hsa-miR-498	CLIP-seq
MIRT1131378	hsa-miR-516b	CLIP-seq
MIRT1131327	hsa-miR-519d	CLIP-seq
MIRT1131328	hsa-miR-520a-3p	CLIP-seq
MIRT1131329	hsa-miR-520b	CLIP-seq
MIRT1131330	hsa-miR-520c-3p	CLIP-seq
MIRT1131331	hsa-miR-520d-3p	CLIP-seq
MIRT1131332	hsa-miR-520e	CLIP-seq
MIRT1131333	hsa-miR-520g	CLIP-seq
MIRT1131334	hsa-miR-520h	CLIP-seq
MIRT1131379	hsa-miR-541	CLIP-seq
MIRT1131380	hsa-miR-545	CLIP-seq
MIRT1131335	hsa-miR-548ag	CLIP-seq
MIRT1131337	hsa-miR-548ai	CLIP-seq
MIRT1131338	hsa-miR-548p	CLIP-seq
MIRT1131381	hsa-miR-548s	CLIP-seq
MIRT1131382	hsa-miR-608	CLIP-seq
MIRT1131339	hsa-miR-619	CLIP-seq
MIRT1131383	hsa-miR-654-5p	CLIP-seq
MIRT1131384	hsa-miR-655	CLIP-seq
MIRT1131385	hsa-miR-7	CLIP-seq
MIRT1131343	hsa-miR-876-5p	CLIP-seq
MIRT1131344	hsa-miR-93	CLIP-seq
MIRT1131386	hsa-miR-940	CLIP-seq
MIRT1131345	hsa-miR-96	CLIP-seq
MIRT1131267	hsa-miR-1256	CLIP-seq
MIRT1131269	hsa-miR-1271	CLIP-seq
MIRT1131272	hsa-miR-15a	CLIP-seq
MIRT1131273	hsa-miR-15b	CLIP-seq
MIRT1131274	hsa-miR-16	CLIP-seq
MIRT1131276	hsa-miR-182	CLIP-seq
MIRT1131278	hsa-miR-195	CLIP-seq
MIRT1131292	hsa-miR-3159	CLIP-seq
MIRT1131301	hsa-miR-3909	CLIP-seq
MIRT1131303	hsa-miR-424	CLIP-seq
MIRT2037391	hsa-miR-4427	CLIP-seq
MIRT1131313	hsa-miR-4642	CLIP-seq
MIRT2037392	hsa-miR-4680-3p	CLIP-seq
MIRT1131374	hsa-miR-4699-5p	CLIP-seq
MIRT2037393	hsa-miR-4709-3p	CLIP-seq
MIRT2037394	hsa-miR-4766-5p	CLIP-seq
MIRT1131325	hsa-miR-497	CLIP-seq
MIRT1131339	hsa-miR-619	CLIP-seq
MIRT2037395	hsa-miR-659	CLIP-seq
MIRT1131385	hsa-miR-7	CLIP-seq
MIRT1131345	hsa-miR-96	CLIP-seq
MIRT1131267	hsa-miR-1256	CLIP-seq
MIRT2037396	hsa-miR-4282	CLIP-seq
MIRT1131377	hsa-miR-4789-3p	CLIP-seq
MIRT2037397	hsa-miR-556-3p	CLIP-seq
MIRT2037398	hsa-miR-595	CLIP-seq
MIRT1131263	hsa-miR-106a	CLIP-seq
MIRT1131264	hsa-miR-106b	CLIP-seq
MIRT1131267	hsa-miR-1256	CLIP-seq
MIRT1131269	hsa-miR-1271	CLIP-seq
MIRT2267301	hsa-miR-128	CLIP-seq
MIRT2267302	hsa-miR-1295	CLIP-seq
MIRT1131346	hsa-miR-1299	CLIP-seq
MIRT1131347	hsa-miR-1324	CLIP-seq
MIRT1131271	hsa-miR-150	CLIP-seq
MIRT1131272	hsa-miR-15a	CLIP-seq
MIRT1131273	hsa-miR-15b	CLIP-seq
MIRT1131274	hsa-miR-16	CLIP-seq
MIRT1131275	hsa-miR-17	CLIP-seq
MIRT1131276	hsa-miR-182	CLIP-seq
MIRT1131277	hsa-miR-185	CLIP-seq
MIRT2267303	hsa-miR-1913	CLIP-seq
MIRT1131278	hsa-miR-195	CLIP-seq
MIRT2267304	hsa-miR-197	CLIP-seq
MIRT2267305	hsa-miR-1972	CLIP-seq
MIRT2267306	hsa-miR-1976	CLIP-seq
MIRT1131282	hsa-miR-20a	CLIP-seq
MIRT1131283	hsa-miR-20b	CLIP-seq
MIRT2267307	hsa-miR-27a	CLIP-seq
MIRT2267308	hsa-miR-27b	CLIP-seq
MIRT1131284	hsa-miR-302a	CLIP-seq
MIRT1131285	hsa-miR-302b	CLIP-seq
MIRT1131286	hsa-miR-302c	CLIP-seq
MIRT1131287	hsa-miR-302d	CLIP-seq
MIRT1131288	hsa-miR-302e	CLIP-seq
MIRT2267309	hsa-miR-3117-5p	CLIP-seq
MIRT2267310	hsa-miR-3145-5p	CLIP-seq
MIRT1131292	hsa-miR-3159	CLIP-seq
MIRT2267311	hsa-miR-3180-5p	CLIP-seq
MIRT2267312	hsa-miR-324-3p	CLIP-seq
MIRT2267313	hsa-miR-326	CLIP-seq
MIRT2267314	hsa-miR-330-5p	CLIP-seq
MIRT2267315	hsa-miR-338-5p	CLIP-seq
MIRT1131296	hsa-miR-3653	CLIP-seq
MIRT2267316	hsa-miR-3689d	CLIP-seq
MIRT2267317	hsa-miR-370	CLIP-seq
MIRT1131299	hsa-miR-372	CLIP-seq
MIRT1131300	hsa-miR-373	CLIP-seq
MIRT1131353	hsa-miR-378	CLIP-seq
MIRT1131354	hsa-miR-378b	CLIP-seq
MIRT1131355	hsa-miR-378c	CLIP-seq
MIRT1131356	hsa-miR-378d	CLIP-seq
MIRT1131357	hsa-miR-378e	CLIP-seq
MIRT1131358	hsa-miR-378f	CLIP-seq
MIRT1131359	hsa-miR-378h	CLIP-seq
MIRT1131360	hsa-miR-378i	CLIP-seq
MIRT2267318	hsa-miR-3976	CLIP-seq
MIRT2267319	hsa-miR-410	CLIP-seq
MIRT1131363	hsa-miR-422a	CLIP-seq
MIRT1131303	hsa-miR-424	CLIP-seq
MIRT2037396	hsa-miR-4282	CLIP-seq
MIRT1131306	hsa-miR-4306	CLIP-seq
MIRT2267320	hsa-miR-4326	CLIP-seq
MIRT2267321	hsa-miR-4436b-5p	CLIP-seq
MIRT2267322	hsa-miR-4459	CLIP-seq
MIRT2267323	hsa-miR-4520a-3p	CLIP-seq
MIRT2267324	hsa-miR-4522	CLIP-seq
MIRT1131312	hsa-miR-4638-3p	CLIP-seq
MIRT1131313	hsa-miR-4642	CLIP-seq
MIRT1131314	hsa-miR-4644	CLIP-seq
MIRT2267325	hsa-miR-4650-5p	CLIP-seq
MIRT1131369	hsa-miR-4659a-3p	CLIP-seq
MIRT1131370	hsa-miR-4659b-3p	CLIP-seq
MIRT2267326	hsa-miR-4662a-3p	CLIP-seq
MIRT2267327	hsa-miR-4686	CLIP-seq
MIRT1131317	hsa-miR-4690-5p	CLIP-seq
MIRT2267328	hsa-miR-4691-5p	CLIP-seq
MIRT2267329	hsa-miR-4693-3p	CLIP-seq
MIRT1131374	hsa-miR-4699-5p	CLIP-seq
MIRT2267330	hsa-miR-4717-5p	CLIP-seq
MIRT2267331	hsa-miR-4729	CLIP-seq
MIRT2267332	hsa-miR-4738-3p	CLIP-seq
MIRT1131321	hsa-miR-4742-5p	CLIP-seq
MIRT2267333	hsa-miR-4780	CLIP-seq
MIRT1131376	hsa-miR-4782-5p	CLIP-seq
MIRT1131377	hsa-miR-4789-3p	CLIP-seq
MIRT2267334	hsa-miR-4795-3p	CLIP-seq
MIRT2267335	hsa-miR-490-5p	CLIP-seq
MIRT1131325	hsa-miR-497	CLIP-seq
MIRT2267336	hsa-miR-5096	CLIP-seq
MIRT1131378	hsa-miR-516b	CLIP-seq
MIRT1131327	hsa-miR-519d	CLIP-seq
MIRT1131328	hsa-miR-520a-3p	CLIP-seq
MIRT1131329	hsa-miR-520b	CLIP-seq
MIRT1131330	hsa-miR-520c-3p	CLIP-seq
MIRT1131331	hsa-miR-520d-3p	CLIP-seq
MIRT1131332	hsa-miR-520e	CLIP-seq
MIRT1131333	hsa-miR-520g	CLIP-seq
MIRT1131334	hsa-miR-520h	CLIP-seq
MIRT2037398	hsa-miR-595	CLIP-seq
MIRT2267337	hsa-miR-603	CLIP-seq
MIRT1131339	hsa-miR-619	CLIP-seq
MIRT2267338	hsa-miR-665	CLIP-seq
MIRT1131385	hsa-miR-7	CLIP-seq
MIRT1131344	hsa-miR-93	CLIP-seq
MIRT2267339	hsa-miR-938	CLIP-seq
MIRT1131345	hsa-miR-96	CLIP-seq
MIRT1131307	hsa-miR-4311	CLIP-seq
MIRT2567060	hsa-miR-4468	CLIP-seq
MIRT2567061	hsa-miR-767-3p	CLIP-seq
MIRT2567062	hsa-miR-1178	CLIP-seq
MIRT2267303	hsa-miR-1913	CLIP-seq
MIRT2267306	hsa-miR-1976	CLIP-seq
MIRT2567063	hsa-miR-203	CLIP-seq
MIRT2267309	hsa-miR-3117-5p	CLIP-seq
MIRT2567064	hsa-miR-3120-5p	CLIP-seq
MIRT2567065	hsa-miR-3143	CLIP-seq
MIRT2267311	hsa-miR-3180-5p	CLIP-seq
MIRT2267312	hsa-miR-324-3p	CLIP-seq
MIRT2267313	hsa-miR-326	CLIP-seq
MIRT2267314	hsa-miR-330-5p	CLIP-seq
MIRT2567066	hsa-miR-342-3p	CLIP-seq
MIRT2567067	hsa-miR-346	CLIP-seq
MIRT2567068	hsa-miR-3664-5p	CLIP-seq
MIRT2267317	hsa-miR-370	CLIP-seq
MIRT1131353	hsa-miR-378	CLIP-seq
MIRT1131354	hsa-miR-378b	CLIP-seq
MIRT1131355	hsa-miR-378c	CLIP-seq
MIRT1131356	hsa-miR-378d	CLIP-seq
MIRT1131357	hsa-miR-378e	CLIP-seq
MIRT1131358	hsa-miR-378f	CLIP-seq
MIRT1131359	hsa-miR-378h	CLIP-seq
MIRT1131360	hsa-miR-378i	CLIP-seq
MIRT2567069	hsa-miR-3923	CLIP-seq
MIRT1131363	hsa-miR-422a	CLIP-seq
MIRT2567070	hsa-miR-4288	CLIP-seq
MIRT2567071	hsa-miR-4310	CLIP-seq
MIRT1131364	hsa-miR-433	CLIP-seq
MIRT2567072	hsa-miR-4452	CLIP-seq
MIRT1131365	hsa-miR-4462	CLIP-seq
MIRT2567073	hsa-miR-4494	CLIP-seq
MIRT2267324	hsa-miR-4522	CLIP-seq
MIRT1131312	hsa-miR-4638-3p	CLIP-seq
MIRT2567074	hsa-miR-4680-5p	CLIP-seq
MIRT2567075	hsa-miR-4803	CLIP-seq
MIRT2567076	hsa-miR-494	CLIP-seq
MIRT2567077	hsa-miR-501-3p	CLIP-seq
MIRT2567078	hsa-miR-502-3p	CLIP-seq
MIRT2567079	hsa-miR-510	CLIP-seq
MIRT2567080	hsa-miR-512-5p	CLIP-seq
MIRT2567081	hsa-miR-520a-5p	CLIP-seq
MIRT2567082	hsa-miR-525-5p	CLIP-seq
MIRT1131339	hsa-miR-619	CLIP-seq
MIRT2567083	hsa-miR-632	CLIP-seq
MIRT2567084	hsa-miR-668	CLIP-seq
MIRT2567061	hsa-miR-767-3p	CLIP-seq
MIRT2267339	hsa-miR-938	CLIP-seq
MIRT2267311	hsa-miR-3180-5p	CLIP-seq
MIRT2567073	hsa-miR-4494	CLIP-seq
MIRT2567081	hsa-miR-520a-5p	CLIP-seq
MIRT2567082	hsa-miR-525-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	34048572
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004705	Function	JUN kinase activity	IBA
GO:0004705	Function	JUN kinase activity	IDA	8654373
GO:0004705	Function	JUN kinase activity	IEA
GO:0004705	Function	JUN kinase activity	TAS
GO:0004707	Function	MAP kinase activity	IEA
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	10376527, 15158451, 16189514, 16288922, 19060904, 20871632, 21516116, 21900206, 21988832, 23602568, 25241761, 25284480, 25416956, 27880917, 28089251, 29892012, 31515488, 32296183, 32707033, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	27830702
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006468	Process	Protein phosphorylation	IMP	22441692
GO:0007254	Process	JNK cascade	IBA
GO:0007254	Process	JNK cascade	IDA	8654373
GO:0010628	Process	Positive regulation of gene expression	IMP	18262097
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IMP	18262097
GO:0016301	Function	Kinase activity	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0034614	Process	Cellular response to reactive oxygen species	IDA	34048572
GO:0038095	Process	Fc-epsilon receptor signaling pathway	IEA
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0043488	Process	Regulation of mRNA stability	IDA	34048572
GO:0046686	Process	Response to cadmium ion	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0061157	Process	MRNA destabilization	IDA	34048572
GO:0061833	Process	Protein localization to tricellular tight junction	IEA
GO:0071803	Process	Positive regulation of podosome assembly	IEA
GO:0090398	Process	Cellular senescence	IEA
GO:0090398	Process	Cellular senescence	TAS
GO:0090594	Process	Inflammatory response to wounding	IDA	27830702
GO:0090594	Process	Inflammatory response to wounding	IDA	27830702
GO:0090594	Process	Inflammatory response to wounding	IEA
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IDA	8654373
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IEA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

Other IDs

• MIM: 602896
• HGNC: 6886
• e!Ensembl: ENSG00000050748

Protein

• UniProt ID: P45984
• Protein name: Mitogen-activated protein kinase 9 (MAP kinase 9) (MAPK 9) (EC 2.7.11.24) (JNK-55) (Stress-activated protein kinase 1a) (SAPK1a) (Stress-activated protein kinase JNK2) (c-Jun N-terminal kinase 2)
• Protein function: Serine/threonine-protein kinase involved in various processes such as cell proliferation, differentiation, migration, transformation and programmed cell death (PubMed:10376527, PubMed:15805466, PubMed:17525747, PubMed:19675674, PubMed:20595622,
• PDB: 3E7O, 3NPC, 7CML, 7N8T, 8ELC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	26 → 321	Protein kinase domain	Domain

• Sequence:

  MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
  FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
  MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
  MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
  LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
  MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
  MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
  EGCR

• Sequence length: 424

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIGEMINAL NEURALGIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of large intestine	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27338053		★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander disease	Pubtator	17038307	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	15659232, 21811019	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	9413280		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29160414		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	12928630	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28951226		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	21135226		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17530707	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22183962	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	25863981		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28951226		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29352041, 29598867		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32510852	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	14586401, 29344219		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28846829		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	24098519		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	17047065		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12359245, 14724588, 20878129, 22217202, 28915613		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17846503, 19133231, 32947764, 36656864	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	35808901	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12508342	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18847500, 22583868, 24135379, 27492456, 34559939	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19715608	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28846829		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10022881		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29138180		★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	28789951		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17483440		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28098247, 28383667		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19352384		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15655348		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22158036, 25205654, 28383667		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19290007, 26043078, 28068431, 29451183, 33076720	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	19715608		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11549352		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24626183		★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	34962918	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	20952496		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	20952496	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23110196	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29710525		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	12508342, 36588538	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	29899326		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17047065, 25351964, 9162025		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	9162025	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25351964, 9162025		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18281515, 26418950	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37005756	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	10075725	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11549352		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	30888230, 31149782		★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	19715608	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	16818881		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28951226, 29118187, 29718758		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	23273084		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10212278, 12213726	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27263528	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	23651848	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	8524841		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	19339050, 9858570	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11698483	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10445852, 18847500, 19033664, 19041150, 19270500, 21391741		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10445852		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26362062	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22966240, 26090483	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14724588, 20878129, 22217202, 28915613		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31767833		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11676474, 15897971, 23900581		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29237470		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28846829		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20878129, 24692673, 27263528, 28383667, 31130919		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19352384		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14724588		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31063355		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29721509		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	21266669	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	32502840	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	23045269		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23045269, 26689580, 36289430, 8978296, 9639523	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	17094012, 17949234		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15262983, 22217202, 23045269, 25205654, 25724684, 30003914		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	22249269		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	11382771		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12710931, 19385049		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	23171849	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23171849		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29344219, 29472856		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan syndrome	Pubtator	32514133	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16818881, 28165482, 28180059, 31149833		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23110196	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	11212179, 26982743	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31505816	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23634944	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31767833		★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	23273084		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	15658002, 15977985		★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	29118187		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11676474, 15897971, 23900581		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10839298, 12633850, 25971429	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	30136020		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17483440	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17530707		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	30157947	Stimulate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	37587067	Associate	★☆☆☆☆ Found in Text Mining only
Secondary Trigeminal Neuralgia	Trigeminal neuralgia	CTD_human_DG	27093858		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	15658002, 15977985		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	9092556		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	9092556	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17908987		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33227411, 35854245, 37691922	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29237470		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	15658002, 15977985		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35546566	Associate	★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	CTD_human_DG	27093858		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Trigeminal Neuralgia, Idiopathic	Trigeminal neuralgia	CTD_human_DG	27093858		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27941886, 30442712		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30442712	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28383667		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28846829	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	28951226		★☆☆☆☆ Found in Text Mining only
WHIM syndrome	Whim syndrome	Pubtator	33485325	Associate	★☆☆☆☆ Found in Text Mining only