MAPK3 (mitogen-activated protein kinase 3)

Gene

• Entrez ID: 5595
• Gene name: Mitogen-activated protein kinase 3
• Gene symbol: MAPK3
• Synonyms (NCBI Gene): ERK-1, ERK1, ERT2, HS44KDAP, HUMKER1A, P44ERK1, P44MAPK, PRKM3, p44-ERK1, p44-MAPK
• Chromosome: 16
• Chromosome location: 16p11.2
• Summary: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22465663
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22465663
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22465663
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22465663
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22465663
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22465663
MIRT047369	hsa-miR-34a-5p	CLASH	23622248
MIRT042561	hsa-miR-423-3p	CLASH	23622248
MIRT036229	hsa-miR-320b	CLASH	23622248
MIRT732137	hsa-miR-550a-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	27462780
MIRT732137	hsa-miR-550a-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	27462780
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, qRT-PCR, Western blot	25622783
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, qRT-PCR, Western blot	25622783
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, qRT-PCR, Western blot	25622783
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, qRT-PCR, Western blot	25622783
MIRT006217	hsa-miR-483-5p	Western blotting, qRT-PCR	33915734
MIRT734389	hsa-miR-497-5p	qRT-PCR	34185228
MIRT734895	hsa-miR-362-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33459949
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, Microarray, qRT-PCR	22465663
MIRT734389	hsa-miR-497-5p	qRT-PCR	34185228
MIRT1130862	hsa-miR-1207-5p	CLIP-seq
MIRT1130863	hsa-miR-125a-5p	CLIP-seq
MIRT1130864	hsa-miR-125b	CLIP-seq
MIRT1130865	hsa-miR-1273f	CLIP-seq
MIRT1130866	hsa-miR-128	CLIP-seq
MIRT1130867	hsa-miR-1285	CLIP-seq
MIRT1130868	hsa-miR-1291	CLIP-seq
MIRT1130869	hsa-miR-132	CLIP-seq
MIRT1130870	hsa-miR-1321	CLIP-seq
MIRT1130871	hsa-miR-143	CLIP-seq
MIRT1130872	hsa-miR-15a	CLIP-seq
MIRT1130873	hsa-miR-15b	CLIP-seq
MIRT1130874	hsa-miR-16	CLIP-seq
MIRT1130875	hsa-miR-1827	CLIP-seq
MIRT1130876	hsa-miR-1908	CLIP-seq
MIRT1130877	hsa-miR-1909	CLIP-seq
MIRT1130878	hsa-miR-1913	CLIP-seq
MIRT1130879	hsa-miR-195	CLIP-seq
MIRT1130880	hsa-miR-205	CLIP-seq
MIRT1130881	hsa-miR-2110	CLIP-seq
MIRT1130882	hsa-miR-2114	CLIP-seq
MIRT1130883	hsa-miR-212	CLIP-seq
MIRT1130884	hsa-miR-3127-5p	CLIP-seq
MIRT1130885	hsa-miR-3162-3p	CLIP-seq
MIRT1130886	hsa-miR-3170	CLIP-seq
MIRT1130887	hsa-miR-3180-5p	CLIP-seq
MIRT1130888	hsa-miR-3184	CLIP-seq
MIRT1130889	hsa-miR-3187-5p	CLIP-seq
MIRT1130890	hsa-miR-324-3p	CLIP-seq
MIRT1130891	hsa-miR-328	CLIP-seq
MIRT1130892	hsa-miR-3612	CLIP-seq
MIRT1130893	hsa-miR-3622b-5p	CLIP-seq
MIRT1130894	hsa-miR-3689d	CLIP-seq
MIRT1130895	hsa-miR-423-5p	CLIP-seq
MIRT1130896	hsa-miR-424	CLIP-seq
MIRT1130897	hsa-miR-4263	CLIP-seq
MIRT1130898	hsa-miR-4270	CLIP-seq
MIRT1130899	hsa-miR-4271	CLIP-seq
MIRT1130900	hsa-miR-4319	CLIP-seq
MIRT1130901	hsa-miR-4326	CLIP-seq
MIRT1130902	hsa-miR-4441	CLIP-seq
MIRT1130903	hsa-miR-4459	CLIP-seq
MIRT1130904	hsa-miR-4463	CLIP-seq
MIRT1130905	hsa-miR-4492	CLIP-seq
MIRT1130906	hsa-miR-4498	CLIP-seq
MIRT1130907	hsa-miR-4505	CLIP-seq
MIRT1130908	hsa-miR-4514	CLIP-seq
MIRT1130909	hsa-miR-4667-5p	CLIP-seq
MIRT1130910	hsa-miR-4688	CLIP-seq
MIRT1130911	hsa-miR-4692	CLIP-seq
MIRT1130912	hsa-miR-4695-5p	CLIP-seq
MIRT1130913	hsa-miR-4700-5p	CLIP-seq
MIRT1130914	hsa-miR-4708-5p	CLIP-seq
MIRT1130915	hsa-miR-4722-5p	CLIP-seq
MIRT1130916	hsa-miR-4725-3p	CLIP-seq
MIRT1130917	hsa-miR-4731-5p	CLIP-seq
MIRT1130918	hsa-miR-4736	CLIP-seq
MIRT1130919	hsa-miR-4739	CLIP-seq
MIRT1130920	hsa-miR-4747-5p	CLIP-seq
MIRT1130921	hsa-miR-4756-5p	CLIP-seq
MIRT1130922	hsa-miR-4763-3p	CLIP-seq
MIRT1130923	hsa-miR-4770	CLIP-seq
MIRT1130924	hsa-miR-486-3p	CLIP-seq
MIRT1130925	hsa-miR-497	CLIP-seq
MIRT1130926	hsa-miR-503	CLIP-seq
MIRT1130927	hsa-miR-510	CLIP-seq
MIRT1130928	hsa-miR-512-5p	CLIP-seq
MIRT1130929	hsa-miR-520a-5p	CLIP-seq
MIRT1130930	hsa-miR-525-5p	CLIP-seq
MIRT1130931	hsa-miR-548ag	CLIP-seq
MIRT1130932	hsa-miR-548ai	CLIP-seq
MIRT1130933	hsa-miR-576-5p	CLIP-seq
MIRT1130934	hsa-miR-612	CLIP-seq
MIRT1130935	hsa-miR-622	CLIP-seq
MIRT1130936	hsa-miR-650	CLIP-seq
MIRT1130937	hsa-miR-656	CLIP-seq
MIRT1130938	hsa-miR-663	CLIP-seq
MIRT1130939	hsa-miR-762	CLIP-seq
MIRT1130940	hsa-miR-938	CLIP-seq
MIRT1130941	hsa-miR-940	CLIP-seq
MIRT2037338	hsa-miR-1	CLIP-seq
MIRT1130862	hsa-miR-1207-5p	CLIP-seq
MIRT1130866	hsa-miR-128	CLIP-seq
MIRT1130867	hsa-miR-1285	CLIP-seq
MIRT1130869	hsa-miR-132	CLIP-seq
MIRT1130870	hsa-miR-1321	CLIP-seq
MIRT2037339	hsa-miR-1587	CLIP-seq
MIRT1130872	hsa-miR-15a	CLIP-seq
MIRT1130873	hsa-miR-15b	CLIP-seq
MIRT1130874	hsa-miR-16	CLIP-seq
MIRT1130875	hsa-miR-1827	CLIP-seq
MIRT1130876	hsa-miR-1908	CLIP-seq
MIRT1130877	hsa-miR-1909	CLIP-seq
MIRT2037340	hsa-miR-1915	CLIP-seq
MIRT1130879	hsa-miR-195	CLIP-seq
MIRT1130880	hsa-miR-205	CLIP-seq
MIRT2037341	hsa-miR-206	CLIP-seq
MIRT1130883	hsa-miR-212	CLIP-seq
MIRT1130884	hsa-miR-3127-5p	CLIP-seq
MIRT1130888	hsa-miR-3184	CLIP-seq
MIRT1130889	hsa-miR-3187-5p	CLIP-seq
MIRT2037342	hsa-miR-3545-3p	CLIP-seq
MIRT1130892	hsa-miR-3612	CLIP-seq
MIRT2037343	hsa-miR-3672	CLIP-seq
MIRT2037344	hsa-miR-3675-3p	CLIP-seq
MIRT2037345	hsa-miR-378g	CLIP-seq
MIRT1130895	hsa-miR-423-5p	CLIP-seq
MIRT1130896	hsa-miR-424	CLIP-seq
MIRT1130897	hsa-miR-4263	CLIP-seq
MIRT1130898	hsa-miR-4270	CLIP-seq
MIRT1130901	hsa-miR-4326	CLIP-seq
MIRT1130902	hsa-miR-4441	CLIP-seq
MIRT1130903	hsa-miR-4459	CLIP-seq
MIRT2037346	hsa-miR-4480	CLIP-seq
MIRT1130905	hsa-miR-4492	CLIP-seq
MIRT1130906	hsa-miR-4498	CLIP-seq
MIRT1130907	hsa-miR-4505	CLIP-seq
MIRT1130908	hsa-miR-4514	CLIP-seq
MIRT2037347	hsa-miR-4521	CLIP-seq
MIRT2037348	hsa-miR-4645-5p	CLIP-seq
MIRT2037349	hsa-miR-4656	CLIP-seq
MIRT2037350	hsa-miR-4673	CLIP-seq
MIRT2037351	hsa-miR-4675	CLIP-seq
MIRT1130910	hsa-miR-4688	CLIP-seq
MIRT1130911	hsa-miR-4692	CLIP-seq
MIRT1130912	hsa-miR-4695-5p	CLIP-seq
MIRT1130915	hsa-miR-4722-5p	CLIP-seq
MIRT1130918	hsa-miR-4736	CLIP-seq
MIRT1130919	hsa-miR-4739	CLIP-seq
MIRT2037352	hsa-miR-4741	CLIP-seq
MIRT1130921	hsa-miR-4756-5p	CLIP-seq
MIRT1130922	hsa-miR-4763-3p	CLIP-seq
MIRT1130924	hsa-miR-486-3p	CLIP-seq
MIRT1130925	hsa-miR-497	CLIP-seq
MIRT1130926	hsa-miR-503	CLIP-seq
MIRT1130933	hsa-miR-576-5p	CLIP-seq
MIRT1130934	hsa-miR-612	CLIP-seq
MIRT2037353	hsa-miR-613	CLIP-seq
MIRT1130935	hsa-miR-622	CLIP-seq
MIRT2037354	hsa-miR-642b	CLIP-seq
MIRT1130936	hsa-miR-650	CLIP-seq
MIRT1130937	hsa-miR-656	CLIP-seq
MIRT1130938	hsa-miR-663	CLIP-seq
MIRT1130939	hsa-miR-762	CLIP-seq
MIRT1130941	hsa-miR-940	CLIP-seq
MIRT1130863	hsa-miR-125a-5p	CLIP-seq
MIRT1130864	hsa-miR-125b	CLIP-seq
MIRT1130868	hsa-miR-1291	CLIP-seq
MIRT1130875	hsa-miR-1827	CLIP-seq
MIRT2037340	hsa-miR-1915	CLIP-seq
MIRT2267262	hsa-miR-2467-3p	CLIP-seq
MIRT1130891	hsa-miR-328	CLIP-seq
MIRT1130892	hsa-miR-3612	CLIP-seq
MIRT2267263	hsa-miR-3678-3p	CLIP-seq
MIRT1130900	hsa-miR-4319	CLIP-seq
MIRT1130903	hsa-miR-4459	CLIP-seq
MIRT2037348	hsa-miR-4645-5p	CLIP-seq
MIRT2037350	hsa-miR-4673	CLIP-seq
MIRT1130912	hsa-miR-4695-5p	CLIP-seq
MIRT1130915	hsa-miR-4722-5p	CLIP-seq
MIRT1130918	hsa-miR-4736	CLIP-seq
MIRT2267264	hsa-miR-4756-3p	CLIP-seq
MIRT1130924	hsa-miR-486-3p	CLIP-seq
MIRT1130936	hsa-miR-650	CLIP-seq
MIRT2267265	hsa-miR-654-3p	CLIP-seq
MIRT1130941	hsa-miR-940	CLIP-seq
MIRT1130872	hsa-miR-15a	CLIP-seq
MIRT1130873	hsa-miR-15b	CLIP-seq
MIRT1130874	hsa-miR-16	CLIP-seq
MIRT1130879	hsa-miR-195	CLIP-seq
MIRT1130887	hsa-miR-3180-5p	CLIP-seq
MIRT1130896	hsa-miR-424	CLIP-seq
MIRT1130925	hsa-miR-497	CLIP-seq
MIRT1130926	hsa-miR-503	CLIP-seq
MIRT1130929	hsa-miR-520a-5p	CLIP-seq
MIRT1130930	hsa-miR-525-5p	CLIP-seq
MIRT1130887	hsa-miR-3180-5p	CLIP-seq
MIRT1130929	hsa-miR-520a-5p	CLIP-seq
MIRT1130930	hsa-miR-525-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TWIST1	Activation	23222305

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IDA	28890335
GO:0000165	Process	MAPK cascade	IDA	24854121
GO:0000165	Process	MAPK cascade	IEA
GO:0000165	Process	MAPK cascade	NAS	20018936
GO:0000166	Function	Nucleotide binding	IEA
GO:0001784	Function	Phosphotyrosine residue binding	IEA
GO:0002841	Process	Negative regulation of T cell mediated immune response to tumor cell	IDA	37208329, 38377992
GO:0002841	Process	Negative regulation of T cell mediated immune response to tumor cell	IDA	37208329
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	18391015, 35216969
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004707	Function	MAP kinase activity	IDA	8388392
GO:0004707	Function	MAP kinase activity	IEA
GO:0004707	Function	MAP kinase activity	NAS	7687743
GO:0005515	Function	Protein binding	IPI	10066421, 10419510, 10617468, 10747973, 11238443, 12840032, 15616583, 15950189, 16291755, 18794356, 19167335, 19197339, 19494114, 19564905, 20347885, 20622900, 21900206, 22307056, 23397142, 23452857, 23602568, 24606918, 24722188, 24825908, 25066297, 25241761, 25852190, 26496610, 278
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	19565474
GO:0005635	Component	Nuclear envelope	IDA	20455999
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	37208329
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	19565474
GO:0005769	Component	Early endosome	IEA
GO:0005769	Component	Early endosome	TAS	19565474
GO:0005770	Component	Late endosome	IEA
GO:0005770	Component	Late endosome	TAS	19565474
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	TAS	19565474
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS	19565474
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	TAS	19565474
GO:0005886	Component	Plasma membrane	ISS
GO:0005901	Component	Caveola	IEA
GO:0005901	Component	Caveola	ISS
GO:0005901	Component	Caveola	TAS	19565474
GO:0005925	Component	Focal adhesion	IEA
GO:0005925	Component	Focal adhesion	TAS	19565474
GO:0005929	Component	Cilium	IDA
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006468	Process	Protein phosphorylation	IDA	7687743
GO:0006915	Process	Apoptotic process	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	24854121
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010507	Process	Negative regulation of autophagy	IDA	32561715
GO:0010508	Process	Positive regulation of autophagy	IDA	22017875, 22017876
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IEA
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IGI	26754294
GO:0014032	Process	Neural crest cell development	IEA
GO:0014044	Process	Schwann cell development	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016310	Process	Phosphorylation	IDA	15950189
GO:0016740	Function	Transferase activity	IEA
GO:0019233	Process	Sensory perception of pain	IEA
GO:0019902	Function	Phosphatase binding	IEA
GO:0019902	Function	Phosphatase binding	IPI	19494114
GO:0030278	Process	Regulation of ossification	IEA
GO:0030509	Process	BMP signaling pathway	IMP	19664780
GO:0030641	Process	Regulation of cellular pH	IEA
GO:0030878	Process	Thyroid gland development	IEA
GO:0031143	Component	Pseudopodium	IEA
GO:0031281	Process	Positive regulation of cyclase activity	IMP	22027397
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0031669	Process	Cellular response to nutrient levels	IDA	32561715
GO:0032206	Process	Positive regulation of telomere maintenance	IEA
GO:0032206	Process	Positive regulation of telomere maintenance	IMP	21531765
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	37534934
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032872	Process	Regulation of stress-activated MAPK cascade	IEA
GO:0032872	Process	Regulation of stress-activated MAPK cascade	TAS	19565474
GO:0034198	Process	Cellular response to amino acid starvation	IDA	11096076
GO:0034198	Process	Cellular response to amino acid starvation	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0036064	Component	Ciliary basal body	IDA
GO:0038083	Process	Peptidyl-tyrosine autophosphorylation	IDA	8388392
GO:0038133	Process	ERBB2-ERBB3 signaling pathway	IEA
GO:0038202	Process	TORC1 signaling	IDA	12087098
GO:0042473	Process	Outer ear morphogenesis	IEA
GO:0042552	Process	Myelination	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042770	Process	Signal transduction in response to DNA damage	IDA	17560175
GO:0042802	Function	Identical protein binding	IPI	16627622, 22307056
GO:0043330	Process	Response to exogenous dsRNA	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20018936
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IEA
GO:0048538	Process	Thymus development	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050821	Process	Protein stabilization	IDA	35216969
GO:0050868	Process	Negative regulation of T cell activation	IDA	38377992
GO:0051216	Process	Cartilage development	IEA
GO:0051403	Process	Stress-activated MAPK cascade	IDA	11096076
GO:0051403	Process	Stress-activated MAPK cascade	IEA
GO:0051493	Process	Regulation of cytoskeleton organization	IEA
GO:0051493	Process	Regulation of cytoskeleton organization	TAS	19565474
GO:0060020	Process	Bergmann glial cell differentiation	IEA
GO:0060324	Process	Face development	IEA
GO:0060425	Process	Lung morphogenesis	IEA
GO:0060440	Process	Trachea formation	IEA
GO:0061308	Process	Cardiac neural crest cell development involved in heart development	IEA
GO:0061514	Process	Interleukin-34-mediated signaling pathway	IGI	26754294
GO:0070161	Component	Anchoring junction	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	TAS	36354136
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	19664780
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IMP	20018936
GO:0070849	Process	Response to epidermal growth factor	IDA	18794356, 21968647
GO:0070849	Process	Response to epidermal growth factor	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0072584	Process	Caveolin-mediated endocytosis	IEA
GO:0072584	Process	Caveolin-mediated endocytosis	TAS	19565474
GO:0090170	Process	Regulation of Golgi inheritance	IEA
GO:0090170	Process	Regulation of Golgi inheritance	TAS	19565474
GO:0090370	Process	Negative regulation of cholesterol efflux	IEA
GO:0098792	Process	Xenophagy	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0120041	Process	Positive regulation of macrophage proliferation	IEA
GO:0120041	Process	Positive regulation of macrophage proliferation	IGI	26754294
GO:0140297	Function	DNA-binding transcription factor binding	IPI	35939714
GO:0150078	Process	Positive regulation of neuroinflammatory response	IDA	24854121
GO:0150078	Process	Positive regulation of neuroinflammatory response	ISS
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	22017875, 22017876, 35216969
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	35216969
GO:1904417	Process	Positive regulation of xenophagy	IEA
GO:2000641	Process	Regulation of early endosome to late endosome transport	IEA
GO:2000641	Process	Regulation of early endosome to late endosome transport	TAS	19565474

Other IDs

• MIM: 601795
• HGNC: 6877
• e!Ensembl: ENSG00000102882

Protein

• UniProt ID: P27361
• Protein name: Mitogen-activated protein kinase 3 (MAP kinase 3) (MAPK 3) (EC 2.7.11.24) (ERT2) (Extracellular signal-regulated kinase 1) (ERK-1) (Insulin-stimulated MAP2 kinase) (MAP kinase isoform p44) (p44-MAPK) (Microtubule-associated protein 2 kinase) (p44-ERK1)
• Protein function: Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway (PubMed:34497368). MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also i
• PDB: 2ZOQ, 4QTB, 6GES
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	42 → 330	Protein kinase domain	Domain

• Sequence:

  MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
  DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI
  VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
  KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
  NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
  SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL
  KELIFQETARFQPGVLEAP

• Sequence length: 379

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATROPHY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEROID LIPOFUSCINOSIS, NEURONAL, 6	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEROID LIPOFUSCINOSIS, NEURONAL, 6A	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DISABILITIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, FEMALE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE NEURONAL CEROID LIPOFUSCINOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-INFANTILE NEURONAL CEROID LIPOFUSCINOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAPK3-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURONAL CEROID CIPOFUSCINOSIS TYPE 6	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURONAL CEROID-LIPOFUSCINOSES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR SARCOIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIGEMINAL NEURALGIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Achondroplasia	Achondroplasia	BEFREE	20922792		★☆☆☆☆ Found in Text Mining only
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	20501680		★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	LHGDN	17686614		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	31545282		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27758712, 30537478, 31465316		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	20164150, 29115618, 29917183		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16574793, 17504381, 18715846		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	25280968		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	21993963		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26705127, 28490462, 30069312, 31807522		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	LHGDN	19082454		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	26867566		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	22115830		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	30656694, 31208372		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	35500219	Associate	★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	20739640		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30537478		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	27282353, 29352142, 31406503		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	16140928, 22107829		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	11544480		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	29038159, 29486466, 31254924		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	27840956		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19233276, 33915734, 37406134, 40533815	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	15200485		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	22708832, 26293690, 29729668, 30572643		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	21706176		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	29366902, 30416651		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	25347569		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	36334505	Stimulate	★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	34185228	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	34239024	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28720574, 29415987, 30423298		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28158734, 31522857		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28158734, 31522857		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	23558220	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	25767191	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	23558220, 26974158, 29348704, 30371171		★☆☆☆☆ Found in Text Mining only
Aortic Rupture	Aortic Rupture	BEFREE	31639107		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	23585898		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18802016, 23991041, 25348362, 25409743, 27998006, 28007744, 28637660, 29660655, 30439364		★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	32703450	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12937131, 18416822, 20185962, 24643522, 30915733, 38272919	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17127048, 22262639, 31266368, 31675376		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	31266368, 36675122, 37336194	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	12529254, 20423999, 31433983		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18802016, 23991041, 25348362, 25409743, 27998006, 28007744, 28637660, 29660655, 30439364		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	35202001	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	10807475, 28011270, 29183725, 31606204		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	10807475	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	33706714	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Septal Defects	Atrial Septal Defect	BEFREE	29178881		★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	29115618		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	22518834	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorder	Autism	Pubtator	35665681, 36401485	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28196412		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	21595826, 21848643, 22884480, 24631207		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	21848643	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	30559488		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27256374		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	29339359	Associate	★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	30925093		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	30171922		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19407332, 21037114, 25885794, 28588729, 28814571, 28901509, 28963051, 29344202, 30869573, 30986204		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	22744336	Associate	★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	30776390		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	12354421		★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	31047984		★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	37108591	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	30723921		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	19407332		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	18448488		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	19424573, 22560878, 23698120, 25194568, 27564099, 27922670, 28012925, 28109084, 31032946, 31341011		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	17901229		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Brain ischemia	Pubtator	25418580	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	10949153, 11897507, 15592521, 15672868, 17664038, 18372913, 18437204, 18710790, 18767025, 20013881, 20112503, 20889557, 21499305, 21643005, 21904903, 22096574, 22479189, 22761812, 23013158, 23722303, 23727359, 23786877, 24316750, 24368600, 24526731, 25066297, 25909173, 26135903, 27316791, 27462780, 27791265, 27876502, 28069875, 28276317, 28370734, 28415597, 28415749, 28709031, 28747926, 28766690, 29218545, 29257221, 30194979, 30371731, 30560942, 31338535, 31496803, 31535410, 31778242, 31848326		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11960991, 15280923, 15603589, 15928662, 17392272, 17897439, 18225535, 19833733, 20112503, 20551949, 20554528, 20837468, 20889557, 20920193, 21643005, 21726627, 22117074, 22260435, 22494620, 23013158, 23083134, 23289893, 23292247, 23380370, 23558942, 24368600, 24637719, 24727858, 25012653, 25066297, 25733818, 25846733, 25909173, 26263881, 26458823, 26540344, 26577839, 28276317, 28370734, 28911625, 29287594, 29339359, 29743588, 31017268, 31322183, 31605603, 32378540, 33066575, 34136934, 37664933	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	29783779		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	27282353		★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	35808901	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Head	Neoplasm of head	CTD_human_DG	15342401		★☆☆☆☆ Found in Text Mining only
Cancer of Neck	Neck Cancer	CTD_human_DG	15342401		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18166657, 18823380, 21076047, 24788939, 25120769, 25550802, 26701206, 29049217, 30577849, 34185141, 34497368	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	20407018, 22965070	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16648865, 26232338, 28501331		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	19457236, 21960346	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	17591960, 25885343	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	29215790	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	23083134	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20930381, 22930530, 23112878, 25115442, 25514221, 27092498, 27468214, 28058860, 28375585, 28492136, 29377347, 31257493, 32398965, 32557953, 32977498, 33168027, 33522955, 33628103, 34639072, 34897107, 35038357, 35196258, 35725908, 36345477, 36613521, 36902429, 37243268, 37875967, 39346898, 9223425	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	18166657, 19457236	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	12937136	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	19404844, 19424573, 22560878, 23698120, 25194568, 27564099, 27922670, 28012925, 28109084, 31032946, 31341011		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	27456359		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17715378, 18927282, 19836351, 20855443, 21050181, 21703428, 22564243, 23806693, 25370835, 26046675, 26166818, 28709031, 29073620, 29467859, 29858603, 31613681		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	22160930, 26880586, 28720574, 30803373, 35699794	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	11731569	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18787400, 21947243, 24334253, 30048489, 31097685, 32009115, 32377748, 32547313, 36374334, 37373509, 37445722	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	27456359	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11520272, 15160999, 20103886, 21960346, 25280968, 31049937, 31053522, 36922519, 37347115	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28438789	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	20233865, 30827262		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10353733, 24816687, 25576358, 25911324, 26501422, 27780136, 30527804		★☆☆☆☆ Found in Text Mining only
Cardiofaciocutaneous syndrome	Cardiofaciocutaneous syndrome	Pubtator	29158583	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	10620750		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	BEFREE	22068161, 23933734, 27131347, 28768908, 31794718		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	28256566	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	10620750		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	20155832	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Alcoholic	Cardiomyopathy	BEFREE	31049135, 31498445		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	27696308, 27941647, 28533215		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27731935, 28587412, 28839270, 29115618		★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	30927912		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	28904737, 29436594, 31656158		★☆☆☆☆ Found in Text Mining only
Central visual impairment	Central Visual Impairment	BEFREE	19560950, 31203288		★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome 1	Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome	BEFREE	28643798		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28183451, 29074416, 29425910, 30245466, 31298390, 31431671		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	33778069, 35140708, 38013375	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28469561, 29473447, 29476448, 31002912		★☆☆☆☆ Found in Text Mining only
CEROID LIPOFUSCINOSIS, NEURONAL, 6	Neuronal ceroid lipofuscinosis	CTD_human_DG	23516525		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
cervical cancer	Cervical Cancer	BEFREE	27888104, 28390112, 28703907, 31081078, 31830929		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	17079005, 27888104, 28390112, 28703907, 31081078, 31830929		★☆☆☆☆ Found in Text Mining only
Child Development Deviations	Development Disorder	CTD_human_DG	30559488		★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Specific	Development Disorder	CTD_human_DG	30559488		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30537478		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	29163809		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	11544480		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	16794828, 17294242, 17461449		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	16794828, 17294242		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	17294242, 25815516, 29235470, 30305612	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	30819129		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	35196362	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	28789951		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholesteatoma	Cholesteatoma	BEFREE	15880942, 16639284		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	LHGDN	15880942		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	24384722		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	24472657	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	25755752	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	23583402, 27171670		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29374468		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11023495, 19549911, 20661426, 22086413, 23460614, 25804768		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	28260027, 29946821		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17906365, 27887617, 29201166, 30069319, 30468094, 30551456		★☆☆☆☆ Found in Text Mining only
Chronic venous insufficiency	Venous Insufficiency	BEFREE	19560950		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	31616061		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	28440493, 29540737		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	17321721		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	27470063		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	36961195	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	25772234		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	34733451, 39328405	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17385215, 18805444, 22684547, 22948716, 23233043, 24025253, 25405740, 26029998, 26804170, 27121327, 28145888, 29857489, 30716361		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15078890, 15655348, 17478078		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	16886596, 31366902	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	31096733		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17149612, 18806830, 19014680, 19372556, 19686845, 20808308, 21826244, 22731636, 23585898, 24186357, 24189753, 24312276, 25917796, 26404261, 26718987, 27036313, 27409167, 29084209, 29085445, 29552187, 29731863, 29872506, 29915160, 30333251, 30577849, 31129138, 31190890, 31786845		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10323886	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10993892, 14564515, 15078890, 17385215, 17848589, 18805444, 19017493, 19290007, 19372556, 19686845, 19930715, 20164542, 20413844, 20808308, 21826244, 22731636, 23325601, 23363659, 24069372, 24265293, 24312276, 24940619, 25561793, 26056802, 26096612, 26804170, 26879318, 27086143, 27562229, 27607135, 27742576, 28970726, 29084209, 29368606, 30577849, 30985981, 31435638, 31786845, 32107843, 33011740, 33016643, 33564344, 33662786, 34109430, 34638550, 34919787, 35091088, 35545369, 35595748, 36030982, 36526622, 36691407, 36806631, 36831331	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17149612		★☆☆☆☆ Found in Text Mining only
Complex craniosynostosis	Craniosynostosis	BEFREE	23354439		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	30723921		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	17294242, 21871105, 24053380		★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	Pubtator	35211808	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	17641779		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	26392309		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27409295, 27941647		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21947243, 25241253, 26487278, 26909952, 28624320, 30048489		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	27787719, 29250160		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29250160		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	17641779, 29250160		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	26636514	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	16452469, 20228845, 27166257		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	20952496, 25134464, 33050003	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	27349634		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	18223264, 20155832, 26352263, 28666466, 28849229, 29104478, 29339024, 30144066		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	25772234		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30390010		★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	26907088		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	11331420, 28529071, 29427595, 29772537, 29849577		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	17712345, 17889834, 19424057, 20657013, 21368416		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis	Dermatitis	BEFREE	15814736		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	34678092	Associate	★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	27676325		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	CTD_human_DG	30559488		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Gestational	Gestational diabetes	Pubtator	28400911, 34912302	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26686228, 29295576, 29760016, 30978700		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36623448	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19581418, 23110196, 26269521, 28934129, 35712257, 36937538	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30446227		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	26742527, 28458023, 28840511, 29735607, 29760016		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	30978700		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	27696308, 27941647, 28533215		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	24488174, 27145370, 29129692, 30307163		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	29552083		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	17622743		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29104476, 29488353, 31365278, 31566891		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	35574010	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27282353, 29352142, 29496671, 31406503		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	29416002		★☆☆☆☆ Found in Text Mining only
Distal Spinal Muscular Atrophy	Distal Spinal Muscular Atrophy	BEFREE	24755273		★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	30925093		★☆☆☆☆ Found in Text Mining only
Dyschromatosis universalis hereditaria	Dyschromatosis Universalis Hereditaria	BEFREE	28382689		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	30337665		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	35899893	Associate	★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	30071860		★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	23157623		★☆☆☆☆ Found in Text Mining only
Empty follicle syndrome	Empty Follicle Syndrome	BEFREE	17007665		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	23419500, 24811094, 30445932		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	17388789, 18852162, 25068805, 25377472, 25879875, 28336232, 29081408, 30445932, 30719151		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	31452406		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	17388789, 19154413, 21408143, 21720253, 24811094, 24817931, 26033187, 27542208, 29081408, 30445932, 31452406, 34174908, 34712201	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	18559923		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	19589865, 24133580, 29779473, 30195499, 30468519, 30578826		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	19589865, 24133578, 28333195	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	21819482		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	36591238	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex	Epidermolysis bullosa	Pubtator	34643242	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Idiopathic Generalized	Epilepsy	Pubtator	26537625	Inhibit	★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	28747926, 30319256		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24816687, 25576358, 25911324		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23812217, 28193907, 30499613		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	18426913		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	22938416, 25550802, 25730371, 30758105, 36555705	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	23812217, 28193907, 30499613		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	19164283, 24966948, 25915860, 29620226, 33311557, 36813090, 36848349	Associate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	27143420		★☆☆☆☆ Found in Text Mining only
Familial Hypophosphatemic Rickets	Hypophosphatemic rickets	Pubtator	25420019	Associate	★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	18253818		★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Medullary thyroid carcinoma	BEFREE	17209045		★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	21037114	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	27098723	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30481403		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28623179, 31258646, 31364649		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	27998643, 31377057		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	11889192		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	28218269		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	25624003		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	27009073, 28285962, 28521485		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	34118139	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	17724739		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	25333257	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	27469332	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	15975850, 31626691		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11115541, 11234878, 12165859, 16012865, 17549698, 18410277, 19941816, 22745588, 23232806, 24866280, 25056222, 28000106, 28069875, 28341744, 28393231, 28922853, 29088769, 30082913, 31433983, 31467175, 31703057, 31776900		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	11741977, 18410277		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20201406, 20392929, 20823154, 22497886, 24587385, 25793261, 28341744, 28797294, 31467175, 32055849, 32926734, 35121903, 35807435, 37258577	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11115541, 11234878, 12165859, 16012865, 17549698, 18410277, 19941816, 22745588, 23232806, 24866280, 24951116, 25056222, 28000106, 28069875, 28341744, 28393231, 28922853, 29088769, 30082913, 30986607, 31433983, 31467175, 31703057, 31776900		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	16563234, 18239851, 18281515, 20461251, 22211103, 22465663, 23652300, 23865743, 24489888, 28484053, 28620155, 29286066, 32753475	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	16814421		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19941816, 24370825, 28469970, 28484053, 29115634, 29128363, 29286066, 29480405, 30361508, 30745840, 30946839		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30225541	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	25782674	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	36588134	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28442634, 31377057		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	31254924		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	36727399	Associate	★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	15243131		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33658982	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	CTD_human_DG	15342401		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head Neoplasms	Head Neoplasms	CTD_human_DG	15342401		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	17885560	Inhibit	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27409295, 27941647		★☆☆☆☆ Found in Text Mining only
Heart Failure Systolic	Heart failure	Pubtator	36303443	Associate	★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	25583406		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	17351113	Associate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	21638128		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	31511432		★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	29339359	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	17003101		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	24769368		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	26951238		★☆☆☆☆ Found in Text Mining only
Hereditary pyropoikilocytosis	Hereditary pyropoikilocytosis	BEFREE	22643351		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	31024255		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	16140928, 22107829		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	26011179	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	29890224		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	22162761, 26010611, 27606810, 31150695	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29062272, 31150695, 31487015		★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	34911614	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension, Renovascular	Hypertension	BEFREE	28210225		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28987634, 29494287, 29701904, 30144156, 30431106, 30599901, 30925093		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	21339640, 31722741		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	16920889	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	BEFREE	30648910		★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	29471671		★☆☆☆☆ Found in Text Mining only
Hypothalamic hamartomas	Hypothalamic Hamartomas	BEFREE	25307426		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	29221723, 30403603, 30542605, 31078153		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	15220111, 15987743, 26785721, 34200497	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17099219, 17387271, 25166211, 25411969, 25583406, 26572277, 27486656, 30778913, 32206064	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	30576231		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	23893408, 26248159, 28428963, 30274147, 31200778		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	17331965, 26138239, 30810067, 34831059	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	21037114		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	25782674, 29179182		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27470063, 27822668, 30875947		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26636514		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26636514	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	15814736		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	32651353	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	29421520		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	27270637, 28087442, 30446227		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	27635110, 33251629, 34805401	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30446227		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	16288056		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	28959141		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	35643225	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	28256566, 30844643		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28978811, 29895489, 30144062, 30794438, 31127971		★☆☆☆☆ Found in Text Mining only
Juvenile Neuronal Ceroid Lipofuscinosis	Neuronal Ceroid Lipofuscinosis	BEFREE	30621751		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ketosis	Ketosis	BEFREE	31179571		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	16140928, 21741362, 22107829		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28497232, 31191310		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	30212930	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30450602, 30728344, 31504777, 31639165		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	CTD_human_DG	21813464		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	21330408, 31002126, 31672701, 37047552	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	30706572		★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	BEFREE	30776390		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	29796842		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	18853184	Associate	★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	LEOPARD Syndrome	BEFREE	24935154, 31722741		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	15967991	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15860672, 22562245, 27758712, 29550383, 29917183		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15860672, 19298651, 19773546, 22016818, 29917183	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	18563362		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	29917183	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11238126, 11698483, 16446383, 18931459, 20810927, 23474756, 27417454, 29207054, 30651113, 32102969, 36509141, 39273530	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	20164150, 29917183	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21233840, 27417454, 31819100		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	28785594		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	24931737, 26447615		★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple Symmetrical	Lipomatosis	BEFREE	26148871		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	33114687	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19816936, 20020490, 22363545, 24141559, 24199952, 25560488, 26124051, 26190376, 26499944, 26767647, 26951515, 27175589, 27623945, 27919788, 28058860, 28077802, 28375585, 28492136, 28675698, 28771223, 29296185, 29377347, 29394494, 29436591, 29714074, 29729697, 29765550, 29866133, 30109780, 30111352, 30293685, 30519270, 30582951, 30771435, 30923463, 31004883, 31114342, 31257493, 31625123, 31702093, 31748280, 31849449		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	24682220	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	18521085		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	21645924		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26572277	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	11884234, 12083368		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	16648865, 19305150, 22132110, 22591718, 23226337, 24108744, 26498639, 26968871, 28400509, 28487957, 28592245, 30022688, 30842489, 31613681, 33313952, 34205482, 35015757, 35226448	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	18559520, 25176343, 28400509, 29733528		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22966240, 36075396	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30991045		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	36335193	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	14997206, 23083134, 24682903, 24966948, 25120769	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	21904903, 26992854		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	27758712		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	17016429		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18494816, 19363496, 21741362, 28049729		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20117835	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	16835385	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	15466208		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	18494816, 31622598		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	28045574	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	25075716		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	27256374		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	CTD_human_DG	15342401		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	17949899		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	31433983		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10949153, 11897507, 15592521, 15672868, 17664038, 18437204, 18710790, 18767025, 19833733, 20013881, 20112503, 20889557, 21499305, 21643005, 21904903, 22096574, 22479189, 22761812, 23013158, 23722303, 23727359, 23786877, 23900300, 24316750, 24368600, 24526731, 25066297, 25909173, 26135903, 27316791, 27462780, 27791265, 27876502, 28069875, 28276317, 28370734, 28415597, 28415749, 28709031, 28747926, 28766690, 29218545, 29257221, 30194979, 30371731, 31338535, 31496803, 31535410, 31778242, 31848326		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	17388789, 25068805, 25377472, 25879875, 28336232, 30445932, 30719151		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23812217, 28193907, 30499613		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	26992854, 27009073, 28285962		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	24746703, 25333257, 28197363		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CTD_human_DG	21813464		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	28098907		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	27456359		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26951515, 28349379, 28731137, 29678550		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	11884234, 12083368		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17715378, 18927282, 19836351, 20855443, 21050181, 21703428, 22564243, 23806693, 25370835, 26046675, 26166818, 28709031, 29073620, 29467859, 29858603, 31613681		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	24931737, 26447615		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10353733, 19018267, 23820584, 26501422, 27780136, 30527804		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	16211241		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20858281, 21678462, 23653113, 25880226, 26785721, 27654574, 28254412, 29415987, 29665121, 29719293, 31133044, 31242404, 31612027		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15897236, 18253818, 20564425, 22705563, 23701950, 23788635, 24619413, 24796332, 26134113, 26983806, 27176648, 27431052, 27692847, 27908592, 28213961, 28422286, 28440432, 29629558, 30543885, 30937635		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	24763052		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	BEFREE	28401485		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12204060, 20804754, 22672288, 22781708, 23353818, 23402999, 23589069, 23922976, 25652124, 25698539, 26018507, 26771235, 27542217, 28269747, 29743885, 29917165, 30011079, 30881033, 31151422		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	17003101		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	28715683		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	19424573, 22560878, 23698120, 25194568, 25482142, 27564099, 27922670, 28012925, 28109084, 31032946, 31341011		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15168733, 15243131, 16904205, 17308092, 18951930, 19157634, 19941816, 21810436, 22068161, 22089954, 23010686, 23012423, 23083134, 23603816, 23644655, 24030148, 24342355, 24692673, 24717435, 25732306, 25769727, 26232338, 26718740, 26733160, 27841865, 27924567, 28013489, 28420180, 28445541, 28481292, 28490462, 28521485, 28687621, 28830458, 28939558, 29085445, 29097608, 29257221, 29259132, 29328451, 29454854, 29614094, 29754473, 29915160, 30039885, 30241478, 30249660, 30605831, 30661200, 30791957, 30899445, 30923463, 31054160, 31097690, 31126017, 31300295, 31452406, 31671605, 31717402		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	23292448, 25109740		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27888104, 28390112, 28703907, 31081078, 31830929		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17385215, 18805444, 22684547, 23233043, 24025253, 25405740, 26029998, 26804170, 27121327, 28145888, 29857489, 30716361		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11960991, 12408764, 15173068, 16705745, 18224451, 18710790		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25482303, 28787571, 29371916		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	28533307		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	25767191	Associate	★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	29765495, 31284709		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	31352037		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	11544480		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	19594892, 20811766, 28440450, 32818841, 35593307	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11415463, 11997078, 12821662, 15145934, 15210734, 15987743, 16098043, 16254105, 16452469, 17508026, 18616526, 19188183, 19401689, 20149136, 20818433, 22277029, 22356677, 22832492, 23222305, 23490205, 24466036, 25026375, 25184134, 25224575, 25320010, 25339196, 25695333, 26084293, 26588333, 26717964, 28067893, 29180761, 29214525, 30611716, 32938713, 33707308, 35189148, 36293123, 36361539, 37160873	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15721302		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16452469, 19401689, 19536148, 19738072, 19747926, 22653968, 23603816, 24121492, 25026375, 25320010, 25433395, 26684394, 27166257, 28068326, 29180761, 29255136, 29276966, 29483645, 30634993, 30804427, 30833419, 31270153, 31456643, 31668370		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	16452469	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	12664615, 17108064, 18688857, 28482067		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	17108064	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	11331420, 28529071, 29427595, 29772537, 29849577		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	15833803, 17712345, 17889834, 20657013, 21368416		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	Pubtator	19551156, 21454801, 35319795	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	21159167, 21710492, 29209316		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	18096084	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	18802016		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	29737325		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	24161842	Associate	★☆☆☆☆ Found in Text Mining only
Motion Sickness	Motion Sickness	BEFREE	29436382		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25091805, 26447615, 34318593	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	28925469		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	LHGDN	12937136		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11986233, 21541441, 27581518, 28557972, 30353128, 35082402, 35216969, 36289430	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12209879, 21148814, 24101133, 25726084, 27016275, 28557972, 29109769, 29482577, 30353128		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	34284104, 36759259	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	36814107	Associate	★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	30977499		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	16272363		★☆☆☆☆ Found in Text Mining only
Myasthenic Syndromes Congenital	Myasthenic syndrome	Pubtator	16272363	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	11583024, 12529294		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	31809872		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	11861273, 20823131	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	29917183		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	23518796, 29207054		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	17440089	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	10620750		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19910580, 28039938, 28964663, 30367841, 31218464		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	36072560	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	27787719, 29312582		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	12070303		★☆☆☆☆ Found in Text Mining only
Myofibrillar Myopathy	Myofibrillar myopathy	Pubtator	34830320	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	25214430, 28915272	Associate	★☆☆☆☆ Found in Text Mining only
Myxoma of heart	Myxoma Of Heart	BEFREE	26134542, 26156800		★☆☆☆☆ Found in Text Mining only
Myxoma of the Endocardium	Myxoma Of The Endocardium	BEFREE	26134542, 26156800		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	24609540, 36447209	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	17458518, 26407680, 28946771, 30590314		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23987636, 24806432, 24933637, 26617707, 31634779, 33096744, 33760180, 35864158	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	10929762, 29070520	Associate	★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	CTD_human_DG	15342401		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10508858, 11279018, 11520272, 11916237, 12204060, 14612509, 15342383, 15677629, 16166331, 16496387, 17079005, 17108064, 17108114, 17308092, 17384145, 18071319, 18354082, 18472963, 18566996, 18762810, 19018267, 19404844, 19620247, 19816934, 20447568, 20824047, 20841483, 20858281, 21079800, 21123950, 21159167, 21245089, 21321384, 21673068, 21710492, 21937212, 21960346, 22089115, 22179790, 22532587, 22535643, 23083134, 23402999, 23660627, 23804705, 23812217, 23917378, 24189753, 24366394, 24422853, 24526731, 24682903, 24811485, 24874276, 25214430, 25349966, 25368326, 25405740, 25429733, 25576921, 25596700, 25773924, 25986726, 26102031, 26242263, 26242269, 26497853, 26658610, 26846663, 26933804, 26951515, 27166257, 27256374, 27282353, 27323830, 27358402, 27456359, 27612430, 27694893, 28073681, 28090628, 28151720, 28178600, 28415597, 28482067, 28572744, 28687621, 28851363, 28863346, 28934742, 28959141, 29097608, 29152665, 29212025, 29286066, 29307835, 29327713, 29344173, 29371946, 29635803, 29731863, 29733511, 29872506, 29906487, 30034397, 30271483, 30275173, 30333251, 30475204, 30573978, 30804427, 30920400, 30935067, 31048689, 31270153, 31340679, 31467175, 31616061, 31617551, 31690270, 31729060		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	31504777		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	21123950, 30649196		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	34873575	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	35514316	Stimulate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30344477, 30983972		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	18593924, 28692055		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	15485492, 20490331, 22192458, 22342995, 22948716, 26384788, 30359286, 32336043, 33619241, 35742955	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17204142, 22948716, 23108190, 28000163, 28687621, 28717423, 28890319, 29156825, 30365123, 30545920, 30755485, 31262884, 9275096		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28495385, 28578486, 30562988		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	28489286		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	23144792		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	25109740	Associate	★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30094097		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	21645924		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	23792031		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12181740, 12626353, 19617897, 19671683, 19799875, 20042515, 21810436, 22089115, 23012423, 23291718, 23959478, 24535036, 25370835, 25596700, 25662161, 26104294, 26567590, 26884842, 27712586, 28073681, 28243327, 28377453, 28900483, 30565694, 30910577, 30920400, 31093311, 31205560, 31300295, 31397118, 31710489		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	30481403		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	30111373		★☆☆☆☆ Found in Text Mining only
Nonketotic Hyperglycinemia	Nonketotic Hyperglycinemia	BEFREE	28050793		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan Syndrome	BEFREE	17641779, 19017799		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan syndrome	Pubtator	32514133	Associate	★☆☆☆☆ Found in Text Mining only
NOONAN SYNDROME 3	Noonan Syndrome	BEFREE	31167915		★☆☆☆☆ Found in Text Mining only
Noonan-Like Syndrome With Loose Anagen Hair	Noonan-Like Syndrome With Loose Anagen Hair	BEFREE	25137548		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23110196, 25332687, 31412932, 35937803	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	25332687, 25683673, 28302472, 29062272, 31412932		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Morbid	Obesity	Pubtator	33621651	Associate	★☆☆☆☆ Found in Text Mining only
Odontogenic Tumors	Odontogenic Tumor	BEFREE	15200485, 30643167		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	20889557, 23686416, 26458823, 30941654		★☆☆☆☆ Found in Text Mining only
Ophthalmoplegia Chronic Progressive External	Progressive external ophthalmoplegia	Pubtator	19477272	Associate	★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	26561393	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	17129375, 18416822, 19302240, 20155832, 26352263, 26982743, 29339024, 33926561	Associate	★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis imperfecta	Pubtator	33228694	Associate	★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	Pubtator	33396517	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	LHGDN	18079194, 18433299		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	18433299, 37971455	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29256352		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	18433299		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	17513610		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	21622131, 22179790, 25146150, 30942624, 36047196	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22179790, 23262982, 23314357, 23507142, 23528710, 25106434, 25146150, 26035796, 26933804, 27171502, 27832629, 28924379, 29137241, 29345412, 29410403, 29733528, 30662872, 30942624, 31637737, 31695502		★☆☆☆☆ Found in Text Mining only
Osteosclerosis	Osteosclerosis	BEFREE	21961044		★☆☆☆☆ Found in Text Mining only
Otofaciocervical Syndrome	Otofaciocervical syndrome	Pubtator	26561393	Associate	★☆☆☆☆ Found in Text Mining only
Otosclerosis	Otosclerosis	BEFREE	23770690		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	10353733		★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	31713081		★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	31121086		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15243131, 17341442		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	16211241		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26501422, 27780136, 30527804		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23158473, 23236423, 23820584, 24662131, 26617770, 27458161, 30106144, 32102425, 32495860, 32796926, 33921111, 34027641, 35008474, 35621926, 37420173	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	29635803		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20858281, 21678462, 23653113, 25880226, 26102031, 26785721, 27654574, 28254412, 29415987, 29665121, 29719293, 31133044, 31242404, 31612027		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28315433, 30042387, 30423298, 30803373		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	16209712		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	31133044		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16209712, 18571585, 20551957, 21678462, 22472349, 24294133, 25880226, 26785721, 29049217, 30942624, 31948053, 36017891	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	11889192, 21191179, 22535643, 23544999, 29721041, 30065097, 30609134		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	17890097, 18594198, 29960099, 30513525		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	18594198		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	29737911, 31116709		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	29737911, 31116709	Associate	★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	26138525		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	30355945	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Peripheral vascular disease	Pubtator	38206683	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	15698454		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	30656694		★☆☆☆☆ Found in Text Mining only
Phosphate Diabetes	Phosphate Diabetes	BEFREE	22647968		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	25624003		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	25617851		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	Pubtator	8808768	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	19414528, 26459919, 28914097, 30348693, 31452406		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31452406, 35768803, 37565925	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	28260027, 29946821, 31824842		★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	16515552		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	31548435		★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	26010611		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	27758712, 31465316		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30390010		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	30571852, 31369569		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	17408653, 26010611		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15897236, 18253818, 19242540, 20564425, 22705563, 23701950, 23788635, 24619413, 24796332, 26134113, 26983806, 27176648, 27431052, 27692847, 27908592, 28213961, 28422286, 28440432, 29629558, 30338032, 30543885, 30937635		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	21081304	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17068343, 17695723		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17178731, 18787043, 18922979, 20979115, 21076047, 21081304, 21871886, 23424616, 24619413, 24982891, 25481381, 25592066, 26257301, 26983806, 28252001, 28866365, 28876465, 29028100, 29629558, 29749458, 30804427, 31983129, 32264916, 32822124, 32851058, 32894540, 35194188, 35303200, 36060138	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	24763052		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	28830537		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
prostatitis	Prostatitis	BEFREE	31376214		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	18830271		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	28239238, 29537306, 30019485, 30219085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychotic disorders	Pubtator	29945223	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	21498912, 28428963	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31200778		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22518834	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29874112	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	21730072		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22451267, 29620190, 30651853		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	20808308, 23859041, 27632701		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	31112136		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	28098907		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25241253, 26487278, 26909952, 30048489		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	27145370, 28508124, 28992288, 31127625		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	31014133		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	22848708	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	21617868, 29109039, 30191630		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	22457763	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyoma	Rhabdomyoma	Pubtator	26247533	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	21220498		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16778989, 19680656, 20072851, 22342385, 28239238, 30342345, 30915733, 31112136		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	12937136	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24058690, 25273173		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	34321458	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	40628996	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	18406625, 25048004		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	25048004, 25075716, 27402753, 28283227		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	36114287, 37418754	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	29720235	Associate	★☆☆☆☆ Found in Text Mining only
Secondary Trigeminal Neuralgia	Trigeminal neuralgia	CTD_human_DG	27093858		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	CTD_human_DG	15489642		★☆☆☆☆ Found in Text Mining only
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	22187378		★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	19654300		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	27166257, 30481683		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	30778913, 34239024	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	17321721		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	36748964	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	17322284, 17678621, 18093694, 23783141, 27456359		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	15613460, 23651505, 36931608	Associate	★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	31201369		★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	23275616		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11520272, 16283431, 19046792, 20121928, 22828925, 31828562		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17686614, 17879163, 18284542		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	21401805		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22992863, 23814025, 25358597, 29620226, 29906487, 30410598, 30893904		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18472963, 19331166, 23146907, 24565984, 24669014, 24682903, 30893332, 34445346, 36672272, 36929425, 39215239	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	21960346, 27670699, 31209059		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	27907906		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	22245045, 25192874, 25270024, 28893247, 30132555, 31798724		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	24682903		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28479396, 28535499, 28601633, 29930499, 31683954		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20804754, 22672288, 22781708, 23353818, 23402999, 23589069, 23922976, 25652124, 25698539, 26018507, 26771235, 27542217, 28269747, 29743885, 29917165, 30881033, 31151422		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12204060, 15655810, 17387271, 19858308, 20804754, 24946088, 25432133, 26242263, 27039174, 28012218, 28109082, 28252644, 28460635, 28627240, 30015980, 31151422, 31378887, 31659258, 33384550, 35169855, 35672352, 37037864, 37794689	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	17003101		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18570890, 19020743		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30382533		★☆☆☆☆ Found in Text Mining only
Subfertility, Female	Subfertility	CTD_human_DG	21177758		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	18804898		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	15814652, 28350009		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	16081426		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	19851777, 22033526, 30033591		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	30510582		★☆☆☆☆ Found in Text Mining only
Thanatophoric dysplasia, type 2	Thanatophoric Dysplasia	BEFREE	29242050		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	29666579		★☆☆☆☆ Found in Text Mining only
Thymus Hyperplasia	Thymus Hyperplasia	BEFREE	28299711		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	28938449		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	21191179, 25499223, 35464760	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25269412, 28715683		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	28715683		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	18021179, 27342319, 34911834, 35464760, 37219859	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	19404844		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	CTD_human_DG	27093858		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	28710025, 30772439		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Trigeminal Neuralgia, Idiopathic	Trigeminal neuralgia	CTD_human_DG	27093858		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24637719, 27038254, 29792166, 29936177, 33946884, 34185141, 37551997	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24874276, 25153718, 25959272, 27038254, 27528706, 28844713, 29257221, 29792166, 29936177, 30628773, 31406104		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	21767323	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	26738854, 28646232		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28260017		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Undifferentiated carcinoma	Carcinoma	BEFREE	21960346		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	25075716		★☆☆☆☆ Found in Text Mining only
Upper Aerodigestive Tract Neoplasms	Upper Aerodigestive Tract Neoplasms	CTD_human_DG	15342401		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18472007, 20473523, 23698120, 25132950, 26823699, 32865871	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Incontinence Stress	Stress urinary incontinence	Pubtator	23867452	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	17079005		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	11731569, 25120769, 25124631, 26156805, 26701206, 29267213, 31081078, 31424656, 31922210, 36645157, 37754347, 38537385	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	21150164, 31564832		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	15145934, 22253748, 22653968, 24551032, 25166211, 31173078, 31736361	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	16452469, 27166257, 30770563, 31173078		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	23401649		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	23401649	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	28427390	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	36937538	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin K Deficiency	Vitamin k deficiency	Pubtator	17699110	Associate	★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	15988409, 24788939	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	25748087	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	29496671		★☆☆☆☆ Found in Text Mining only
WHIM syndrome	Whim syndrome	Pubtator	19956569, 33485325	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	23922674	Associate	★☆☆☆☆ Found in Text Mining only