MAPK8 (mitogen-activated protein kinase 8)

Gene

• Entrez ID: 5599
• Gene name: Mitogen-activated protein kinase 8
• Gene symbol: MAPK8
• Synonyms (NCBI Gene): JNK, JNK-46, JNK1, JNK1A2, JNK21B1/2, PRKM8, SAPK1, SAPK1c
• Chromosome: 10
• Chromosome location: 10q11.22
• Summary: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003985	hsa-miR-199a-3p	Western blot	18456660
MIRT005427	hsa-miR-214-3p	GFP reporter assay, Microarray, qRT-PCR, Western blot	19859982
MIRT005427	hsa-miR-214-3p	GFP reporter assay, Microarray, qRT-PCR, Western blot	19859982
MIRT016104	hsa-miR-421	Sequencing	20371350
MIRT016510	hsa-miR-193b-3p	Microarray	20304954
MIRT021289	hsa-miR-125a-5p	Sequencing	20371350
MIRT021678	hsa-miR-140-3p	Sequencing	20371350
MIRT005427	hsa-miR-214-3p	Reporter assay;qRT-PCR;Microarray;Other	19859982
MIRT025602	hsa-miR-10a-5p	Sequencing	20371350
MIRT028235	hsa-miR-33a-5p	Sequencing	20371350
MIRT016104	hsa-miR-421	CLASH	23622248
MIRT037323	hsa-miR-877-5p	CLASH	23622248
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT566821	hsa-miR-4282	PAR-CLIP	20371350
MIRT473694	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT536128	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT566820	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT566819	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT566818	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT566817	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT566816	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT566815	hsa-miR-548aw	PAR-CLIP	20371350
MIRT473699	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT473698	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT473697	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT473696	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT473695	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT473693	hsa-miR-193a-3p	PAR-CLIP	21572407
MIRT016510	hsa-miR-193b-3p	PAR-CLIP	21572407
MIRT473692	hsa-miR-892b	PAR-CLIP	21572407
MIRT473691	hsa-miR-4280	PAR-CLIP	21572407
MIRT473690	hsa-miR-3190-5p	PAR-CLIP	21572407
MIRT473689	hsa-miR-3926	PAR-CLIP	21572407
MIRT473688	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT473687	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT473686	hsa-miR-548s	PAR-CLIP	21572407
MIRT473685	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT441786	hsa-miR-3662	PAR-CLIP	22012620
MIRT441785	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT536130	hsa-miR-590-3p	PAR-CLIP	22012620
MIRT536129	hsa-miR-888-5p	PAR-CLIP	22012620
MIRT536128	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT536127	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT536126	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT536125	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT441784	hsa-miR-4480	PAR-CLIP	22012620
MIRT536124	hsa-miR-4775	PAR-CLIP	22012620
MIRT536123	hsa-miR-7703	PAR-CLIP	22012620
MIRT536122	hsa-miR-4325	PAR-CLIP	22012620
MIRT536121	hsa-miR-450b-5p	PAR-CLIP	22012620
MIRT536120	hsa-miR-507	PAR-CLIP	22012620
MIRT536119	hsa-miR-557	PAR-CLIP	22012620
MIRT501958	hsa-miR-3680-3p	PAR-CLIP	22012620
MIRT501966	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT501967	hsa-miR-33b-5p	PAR-CLIP	24398324
MIRT028235	hsa-miR-33a-5p	PAR-CLIP	24398324
MIRT501966	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT501965	hsa-miR-126-5p	PAR-CLIP	24398324
MIRT501964	hsa-miR-664a-3p	PAR-CLIP	24398324
MIRT501962	hsa-miR-8060	PAR-CLIP	24398324
MIRT501963	hsa-miR-496	PAR-CLIP	24398324
MIRT501961	hsa-miR-4795-3p	PAR-CLIP	24398324
MIRT501960	hsa-miR-7154-5p	PAR-CLIP	24398324
MIRT501959	hsa-miR-433-3p	PAR-CLIP	24398324
MIRT501958	hsa-miR-3680-3p	PAR-CLIP	24398324
MIRT473699	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT473698	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT473697	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT473696	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT473695	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT473694	hsa-miR-497-3p	PAR-CLIP	23592263
MIRT473693	hsa-miR-193a-3p	PAR-CLIP	23592263
MIRT016510	hsa-miR-193b-3p	PAR-CLIP	23592263
MIRT473692	hsa-miR-892b	PAR-CLIP	23592263
MIRT473691	hsa-miR-4280	PAR-CLIP	23592263
MIRT473690	hsa-miR-3190-5p	PAR-CLIP	23592263
MIRT473689	hsa-miR-3926	PAR-CLIP	23592263
MIRT473688	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT473687	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT473686	hsa-miR-548s	PAR-CLIP	23592263
MIRT473685	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT441786	hsa-miR-3662	PAR-CLIP	22100165
MIRT441785	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT441783	hsa-miR-3163	PAR-CLIP	22100165
MIRT441784	hsa-miR-4480	PAR-CLIP	22100165
MIRT736095	hsa-miR-141-3p	qRT-PCR	33133155
MIRT566821	hsa-miR-4282	PAR-CLIP	20371350
MIRT473694	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT536128	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT566820	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT566819	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT566818	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT566817	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT566816	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT566815	hsa-miR-548aw	PAR-CLIP	20371350
MIRT473699	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT473698	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT473697	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT473696	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT473695	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT473693	hsa-miR-193a-3p	PAR-CLIP	21572407
MIRT016510	hsa-miR-193b-3p	PAR-CLIP	21572407
MIRT473692	hsa-miR-892b	PAR-CLIP	21572407
MIRT473691	hsa-miR-4280	PAR-CLIP	21572407
MIRT473690	hsa-miR-3190-5p	PAR-CLIP	21572407
MIRT473689	hsa-miR-3926	PAR-CLIP	21572407
MIRT473688	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT473687	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT473686	hsa-miR-548s	PAR-CLIP	21572407
MIRT473685	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT441786	hsa-miR-3662	PAR-CLIP	22012620
MIRT441785	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT536130	hsa-miR-590-3p	PAR-CLIP	22012620
MIRT536129	hsa-miR-888-5p	PAR-CLIP	22012620
MIRT536128	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT536127	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT536126	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT536125	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT441784	hsa-miR-4480	PAR-CLIP	22012620
MIRT536124	hsa-miR-4775	PAR-CLIP	22012620
MIRT536123	hsa-miR-7703	PAR-CLIP	22012620
MIRT536122	hsa-miR-4325	PAR-CLIP	22012620
MIRT536121	hsa-miR-450b-5p	PAR-CLIP	22012620
MIRT536120	hsa-miR-507	PAR-CLIP	22012620
MIRT536119	hsa-miR-557	PAR-CLIP	22012620
MIRT501958	hsa-miR-3680-3p	PAR-CLIP	22012620
MIRT501966	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT501967	hsa-miR-33b-5p	PAR-CLIP	24398324
MIRT028235	hsa-miR-33a-5p	PAR-CLIP	24398324
MIRT501966	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT501965	hsa-miR-126-5p	PAR-CLIP	24398324
MIRT501964	hsa-miR-664a-3p	PAR-CLIP	24398324
MIRT501962	hsa-miR-8060	PAR-CLIP	24398324
MIRT501963	hsa-miR-496	PAR-CLIP	24398324
MIRT501961	hsa-miR-4795-3p	PAR-CLIP	24398324
MIRT501960	hsa-miR-7154-5p	PAR-CLIP	24398324
MIRT501959	hsa-miR-433-3p	PAR-CLIP	24398324
MIRT501958	hsa-miR-3680-3p	PAR-CLIP	24398324
MIRT473699	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT473698	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT473697	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT473696	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT473695	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT473694	hsa-miR-497-3p	PAR-CLIP	23592263
MIRT473693	hsa-miR-193a-3p	PAR-CLIP	23592263
MIRT016510	hsa-miR-193b-3p	PAR-CLIP	23592263
MIRT473692	hsa-miR-892b	PAR-CLIP	23592263
MIRT473691	hsa-miR-4280	PAR-CLIP	23592263
MIRT473690	hsa-miR-3190-5p	PAR-CLIP	23592263
MIRT473689	hsa-miR-3926	PAR-CLIP	23592263
MIRT473688	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT473687	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT473686	hsa-miR-548s	PAR-CLIP	23592263
MIRT473685	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT441786	hsa-miR-3662	PAR-CLIP	22100165
MIRT441785	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT441783	hsa-miR-3163	PAR-CLIP	22100165
MIRT441784	hsa-miR-4480	PAR-CLIP	22100165
MIRT473699	hsa-miR-30a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35001794
MIRT2037380	hsa-miR-1244	CLIP-seq
MIRT2037381	hsa-miR-3168	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Unknown	20800677
E2F3	Unknown	20800677
HSF2	Repression	11557063
JUN	Activation	19324081
JUN	Unknown	16397260

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IDA	15850461
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	14967141, 15850461, 20027304, 21095239, 22966201, 27568560, 28943315, 34048572
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004705	Function	JUN kinase activity	IBA
GO:0004705	Function	JUN kinase activity	IDA	8654373, 21095239
GO:0004705	Function	JUN kinase activity	ISS
GO:0004705	Function	JUN kinase activity	TAS
GO:0004707	Function	MAP kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	10393177, 10490659, 10747973, 10856240, 11517249, 15334056, 15894542, 16291755, 16533805, 16840345, 16982329, 18003900, 18286207, 19234442, 19527717, 21900206, 22966201, 23602568, 25284480, 27043084, 27880917, 32296183, 32707033, 33961781, 35271311, 36935496
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	20027304, 30878395
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006302	Process	Double-strand break repair	IDA	27568560, 28190768, 32028527
GO:0006468	Process	Protein phosphorylation	IMP	22441692
GO:0006979	Process	Response to oxidative stress	IDA	22966201
GO:0007254	Process	JNK cascade	IBA
GO:0007254	Process	JNK cascade	IDA	8654373
GO:0007258	Process	JUN phosphorylation	IDA	14967141
GO:0007258	Process	JUN phosphorylation	IDA	21095239
GO:0009411	Process	Response to UV	IDA	14967141
GO:0009612	Process	Response to mechanical stimulus	IBA
GO:0010628	Process	Positive regulation of gene expression	IMP	22065586
GO:0016241	Process	Regulation of macroautophagy	TAS	26546165
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	21095239, 22966201
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	21095239
GO:0019899	Function	Enzyme binding	IPI	14615289
GO:0019903	Function	Protein phosphatase binding	IPI	11489891
GO:0030424	Component	Axon	ISS	22683681
GO:0031281	Process	Positive regulation of cyclase activity	IMP	22027397
GO:0031343	Process	Positive regulation of cell killing	TAS
GO:0032091	Process	Negative regulation of protein binding	IDA	21095239
GO:0032880	Process	Regulation of protein localization	IDA	20027304
GO:0034198	Process	Cellular response to amino acid starvation	IDA	11096076
GO:0034599	Process	Cellular response to oxidative stress	IDA	27568560
GO:0034614	Process	Cellular response to reactive oxygen species	IDA	34048572
GO:0035033	Function	Histone deacetylase regulator activity	IMP	20027304
GO:0038095	Process	Fc-epsilon receptor signaling pathway	IEA
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042826	Function	Histone deacetylase binding	IPI	20027304
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	TAS
GO:0043066	Process	Negative regulation of apoptotic process	IDA	14967141
GO:0043066	Process	Negative regulation of apoptotic process	IDA	21095239
GO:0043488	Process	Regulation of mRNA stability	IDA	34048572
GO:0044546	Process	NLRP3 inflammasome complex assembly	IDA	35114687, 35254907
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0051247	Process	Positive regulation of protein metabolic process	IMP	22027397
GO:0051403	Process	Stress-activated MAPK cascade	IDA	11096076
GO:0061157	Process	MRNA destabilization	IDA	34048572
GO:0070212	Process	Protein poly-ADP-ribosylation	IDA	28190768
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	23776175
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0090398	Process	Cellular senescence	IEA
GO:0090398	Process	Cellular senescence	TAS
GO:0097009	Process	Energy homeostasis	ISS
GO:0097009	Process	Energy homeostasis	ISS
GO:0097441	Component	Basal dendrite	ISS	22683681
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0120283	Function	Protein serine/threonine kinase binding	IPI	11865055
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IDA	28943315
GO:1903749	Process	Positive regulation of establishment of protein localization to mitochondrion	TAS
GO:1990166	Process	Protein localization to site of double-strand break	IDA	27568560

Other IDs

• MIM: 601158
• HGNC: 6881
• e!Ensembl: ENSG00000107643

Protein

• UniProt ID: P45983
• Protein name: Mitogen-activated protein kinase 8 (MAP kinase 8) (MAPK 8) (EC 2.7.11.24) (JNK-46) (Stress-activated protein kinase 1c) (SAPK1c) (Stress-activated protein kinase JNK1) (c-Jun N-terminal kinase 1)
• Protein function: Serine/threonine-protein kinase involved in various processes such as cell proliferation, differentiation, migration, transformation and programmed cell death. Extracellular stimuli such as pro-inflammatory cytokines or physical stress stimulate
• PDB: 1UKH, 1UKI, 2G01, 2GMX, 2H96, 2NO3, 2XRW, 2XS0, 3ELJ, 3O17, 3O2M, 3PZE, 3V3V, 3VUD, 3VUG, 3VUH, 3VUI, 3VUK, 3VUL, 3VUM, 4AWI, 4E73, 4G1W, 4HYS, 4HYU, 4IZY, 4L7F, 4QTD, 4UX9, 4YR8, 5LW1, 6F5E, 6ZR5, 8PT8, 8PT9, 8PTA, 8R5E, 8X5M, 9FT9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	26 → 321	Protein kinase domain	Domain

• Sequence:

  MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
  FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
  MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
  MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
  LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
  MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
  MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA
  GPLGCCR

• Sequence length: 427

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER FAILURE, ACUTE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAPK8-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIGEMINAL NEURALGIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	BEFREE	28377308		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	29236323		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	19966288		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	23067223		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	24842373, 28518151, 28765039		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29349553, 29912856, 30552706		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	25542232		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	28938583		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27685632, 28068320, 28099944, 28606921, 28618937		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	24395444		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	26049416, 29467273, 30945380		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	30656694		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	30298517		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	37974207	Associate	★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23067223		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	21775132, 30447254		★☆☆☆☆ Found in Text Mining only
Adult-onset citrullinemia type 2	Citrullinemia	BEFREE	25533124		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	23341606		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	23064787, 31325906		★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander disease	Pubtator	17038307	Associate	★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	19478459		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	12917434, 19162185, 21811019, 27106634, 40074652	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	23095849, 26924229, 37236204	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	24346217	Inhibit	★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	30233281		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	22708832, 24966375, 28669260		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28366453, 9413280		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	28366453, 37386082	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	29985130		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	24515990	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Diamond-Blackfan	Anemia	BEFREE	26258650		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	24515990		★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	Pubtator	40570009	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26979711, 31243599		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	27843149, 28194007		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	27843149, 28194007		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	17478756	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	28875468		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	18502079	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	16311603, 22316675, 24225494, 24337353, 28433630, 29290496		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	28437005		★☆☆☆☆ Found in Text Mining only
Apert syndrome	Apert Syndrome	BEFREE	22048896		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	23064787, 31325906		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	22762513, 28345767, 29136772, 29746866, 31384309		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	11991745, 15642137, 21135226		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	13130464	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	21953337	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16802349, 16936264, 17530707, 18713996, 20185962, 20878914, 22183962, 29191214, 31022596, 32131874, 32670287, 33426091, 33952303, 35967391, 36934132	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	21953337	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	15642137		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	22205926	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22387292, 26505831, 26517722, 31112061, 31235256		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	10501211, 17971243, 19543395	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17446059, 17971243		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	9830038	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18385538	Inhibit	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	20404041, 21070853	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	22762513, 28345767, 29136772, 29746866, 31384309		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	21935439	Associate	★☆☆☆☆ Found in Text Mining only
Autonomic Nervous System Diseases	Autonomic nervous system disease	Pubtator	12058026	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23933736, 27871155, 28798154, 29434895, 30070339, 30106128, 30535477, 30813721, 30952729, 31411368		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	30768984		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26312564, 30032449, 30809635, 31587482		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	24098519		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	29436605	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	17255354		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	17255354, 33748269	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	30066915	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	12140754		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	15637069	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10719239, 16002723, 17875734, 18767025, 20482821, 20507565, 20878129, 20944115, 22446103, 22579953, 23652009, 24434780, 25629224, 25976678, 26049416, 27599524, 27899257, 28031536, 28611109, 28681938, 29710529, 29765551, 29856313, 30446635, 30568466, 30809096, 31419957, 9115218		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10618392, 11983707, 16450001, 16684880, 16984917, 17371872, 17846503, 18022396, 19133231, 19543320, 19674193, 19775288, 19819984, 20482821, 20507565, 21719561, 22087220, 22121046, 22446103, 22952942, 23902710, 24019090, 24289581, 25629224, 25781201, 25791820, 26116171, 26607805, 26735495, 27045589, 29207138, 29348172, 30873742, 31766464, 32427938, 32947764, 33066575, 34369076, 34572567, 35234274, 36210461, 36234680, 36550279, 36656864, 37110684, 37400459, 37789226, 38048919, 38412255, 40468448, 40657389, 9813039	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36656864	Inhibit	★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	26916448		★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	BEFREE	28781625		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	20551953, 24787013	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	26515875, 27001263	Associate	★☆☆☆☆ Found in Text Mining only
Capillary malformation (disorder)	Capillary malformation	BEFREE	31784499		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17416736, 17699782, 23922701, 26790956, 27268017, 33749640, 36693850	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23603344		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	21502402	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	35883247	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18620777, 19041150, 19686584, 19835603, 20632440, 20856226, 22323130, 23035214, 23392177, 24135379, 24637780, 25053598, 25091573, 25522777, 26057631, 26095609, 26231035, 26258887, 26517516, 26648552, 26707143, 26718209, 26790956, 26799423, 26884857, 26939902, 26964667, 27046040, 27049263, 27367026, 27431384, 27492456, 28507277, 28584306, 28665449, 28869833, 29445085, 29728125, 29748591, 29749550, 31056532, 31597595, 31786862, 32161315, 32350244, 34559939, 34657150, 35311629, 35866605, 37021545, 37215991	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	40468448	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26312564, 30032449, 30809635, 31587482		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	26001828, 30239172		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10022881, 15705594, 18331824, 18372076, 23054210, 23665907, 24434654, 24452601, 26216446, 27748898, 28099944, 28251885, 28597042, 28782471, 30072581, 30207732, 30644129, 30875659, 30933439, 31557334		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26098087, 28666421, 34638596	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31243599, 33341545	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22493490, 22991494, 24576174, 33151174, 33804101	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37960824	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11792626, 23557251, 23651874, 32521923, 37805058	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10353733, 19616043, 24865582, 28666421		★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	37972803	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30993599, 31244114		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	16381010, 27696308		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28478520		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36012132	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	26254334	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	15357947	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar diseases	Pubtator	25062847	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	28546532	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30472297, 31058815		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29476447		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29501043, 29590661		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29501043, 29590661		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	23067223		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	21775132, 30447254		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24587347, 28535665, 28662515, 30305612, 30850583, 32246704, 33431813	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28662515		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	27501764, 27913845, 31316180		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	31316180	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	28789951		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chondrosarcoma	Chondrosarcoma	Pubtator	12587980, 23892595	Associate	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	27439062		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21750087		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29345249, 30468094		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	27173130		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	29193850		★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	21418516	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	30763583		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	16044158		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29289695, 30217465		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	16838116, 28098247, 29253460		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	23742011	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24118792, 28751935	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19352384, 25113506, 25611974, 26023085, 26637668, 29451183, 29949153, 30219232, 30372822, 30482246		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15655348, 15665513, 16912864, 17478078		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	16449643, 31366902	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	26023085		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	37960824	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10769637, 15774489, 15860507, 21156789, 22852817, 23354547, 23900560, 26701208, 27440078, 28125661, 28367093, 28383667, 30779920, 31011291, 31259992		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16024641, 19290007, 19352384, 19499154, 21524306, 22681760, 22870247, 22922338, 23907464, 24733045, 25124618, 25178491, 26235743, 27216154, 27440078, 27713159, 27926494, 28068431, 28402256, 28606091, 29138007, 29451183, 30035680, 30482246, 31331640, 31506433, 31892852, 31906747, 32167616, 32260423, 32408577, 33355370, 33749640, 33961948, 34418232, 34572494, 35590292, 35758246, 36047191, 36200182, 36581088, 36693850, 36806631, 37530327, 39275334	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18594007		★☆☆☆☆ Found in Text Mining only
Conduction disorder of the heart	Conduction Disorder Of The Heart	BEFREE	14742426		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	31806991		★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	BEFREE	28345781		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11549352, 19707545, 27439062, 28367848		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	31784499		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective tissue disease	Pubtator	31784499	Associate	★☆☆☆☆ Found in Text Mining only
Contracture	Contracture	Pubtator	19214689	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24626183, 27717821, 28381189, 28950257, 29672315, 29763892, 29864454		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Corneal Injuries	Corneal injury	Pubtator	32016117	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18984670		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	18984670		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	35801781, 36184551	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	18984670		★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	16044158		★☆☆☆☆ Found in Text Mining only
Corticobasal Degeneration	Corticobasal degeneration	Pubtator	35976433	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	23073384	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	23073384		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	26215868, 31415355	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	30765731		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	30765731	Stimulate	★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic Neutropenia	BEFREE	31202856		★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	34962918	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	20952496		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24502636, 25091567, 26751999, 26873249, 27907835, 28647559, 29899865, 31205941, 31472053, 31836142		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	31620885		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	27106634	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	11751189, 21669197		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	27916420		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis	Dermatitis	BEFREE	29698775		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	29498756	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	CTD_human_DG	24046278		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	29498756, 30286163		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	28432555, 29264665		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12901952, 16607699, 18263705, 19683471, 20824098, 24985580, 26690976, 27696308, 31015037, 31103701, 31829413		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	36263320	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12901952, 16607699, 18263705, 19683471, 20824098, 24985580, 26690976, 27696308, 28367848, 30947565, 31015037, 31103701, 31829413		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18263705, 25999017, 26800561, 28367848, 30478982	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21931634, 23110196, 27106634, 35712257, 37680885	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31015037		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16607699, 16699725, 18036196, 21694775, 28105758, 28573460, 29129046, 29475461, 29710525, 31411368, 31797011		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	27696308		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	33274236	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	10749885, 28801998, 29890555, 30191967, 30504726		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	31442556		★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Distal myopathy	Pubtator	33602173	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	LHGDN	16381010		★☆☆☆☆ Found in Text Mining only
Dysautonomia Familial	Dysautonomia	Pubtator	12058026	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	29498756, 30286163		★☆☆☆☆ Found in Text Mining only
Eczema, Infantile	Eczema	CTD_human_DG	24046278		★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	19478459		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	24988221	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11720885		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	23411497, 25207642, 30259980, 37164275	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25207642, 29096379, 31636643		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex	Epidermolysis Bullosa Simplex	BEFREE	23528216		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30685843		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28664455, 30685843		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28666421		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	29203189		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30768984		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	23921907	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30768984		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37705202	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	28748534		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	26558630		★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	22832488	Inhibit	★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	18253818		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	30768984		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	12958075		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	12958075	Stimulate	★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	12958075		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP F	Fanconi Anemia	BEFREE	22952942		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	21540183, 24167585		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	26497211	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	30248539	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	27916420, 28595079, 29991872, 30248539, 31384535		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	10086335, 22355661		★☆☆☆☆ Found in Text Mining only
Fibrosis of pancreas	Fibrosis Of Pancreas	BEFREE	29705706		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27989749, 30019838, 30908654		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	29432529		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	27009073		★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	31751591		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	33850461	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	BEFREE	29094779		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	23921907		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28938016, 29899326		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	33707187	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10825181, 11315098, 18249159, 19166930, 21040711, 23448150, 24316756, 25213694, 25351964, 28135339, 29531296, 29556339, 29721785, 29843152, 30119215, 31565489		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17647244, 17699104, 19894226, 24732116, 24967005, 26871431, 28097126, 28487380, 31390836, 32060308, 32065482, 35173528, 35367758, 35814563, 9162025	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18316600		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10825181, 11315098, 18249159, 19166930, 21040711, 23448150, 24316756, 25213694, 25351964, 28135339, 28293765, 29531296, 29556339, 29721785, 29843152, 30119215, 31565489		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	16814421		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18281515, 19583803, 20452983, 25596741, 25792385, 26439036, 27291091, 28449039, 31053160, 31772693, 32003751, 33920356, 34227028, 36291099, 37277492	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	18299661, 19583803, 21573233, 21732139, 22249269, 24699410, 26439036, 27181592, 27291091, 28800785, 29284798, 30020192, 30680690, 30779920, 30963560		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	33043579	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	35172688	Associate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	26310606		★☆☆☆☆ Found in Text Mining only
Glucose Metabolism Disorders	Glucose Metabolism Disorders	BEFREE	31132438		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	23940728	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	9497315	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	32630231	Associate	★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Gray Platelet Syndrome	BEFREE	28450921		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	31548323		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	31548323		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	16044158		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	11592233, 11927016, 22824861, 28522603		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	35673578	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11549352, 19707545, 28367848		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	28367848	Associate	★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	Pubtator	16196383	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	37703866	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	26648552, 32293395, 36916737	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	28931802	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	28935193	Associate	★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	26660341		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	26660341	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	16002723	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	18593901		★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	18543249		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	19525941		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	30709899	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	25541468, 30215691, 31006095, 31206688		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	30110564		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	16818881, 28298335		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	34034759	Associate	★☆☆☆☆ Found in Text Mining only
Hypersomnia	Hypersomnia	BEFREE	29523076		★☆☆☆☆ Found in Text Mining only
Hypertension Portal	Portal hypertension	Pubtator	31934265	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	24515990	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	22363104, 31301303		★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	29506515	Associate	★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	19700418		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	31421247, 9115218		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	9115218	Associate	★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	23273084		★☆☆☆☆ Found in Text Mining only
Hypothalamic hamartomas	Hypothalamic Hamartomas	BEFREE	25307426		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12213726, 23681233, 24477234, 25583406, 26924229, 32377698	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16732616, 20491781, 20559021, 25573199, 27216154, 29843131	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	29696512		★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	26463477		★☆☆☆☆ Found in Text Mining only
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	29709677		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31506947		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	29971001		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	31402304		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22033930, 29289695, 30217465, 31797011, 31809762		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	36497065	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	16465391		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	16838116, 28725226		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35908771	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	12902351, 18263705, 20888662, 22351776, 23651848, 26800561, 33274236, 34034759, 37898813	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	17986714, 23975543, 27688298	Stimulate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	18263705		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	12847144		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	25304312	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	18239167	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	27976455		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	28609656		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	16381010		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	28405919, 30873034		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29580816, 31272760		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	9456251		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	28926773		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	17416736, 27870927		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	29511793		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	11849444, 34962918	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	27226108, 29114233, 31478545		★☆☆☆☆ Found in Text Mining only
Kidney Diseases Cystic	Kidney disease	Pubtator	34962918	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29608549, 31813254		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	19681889, 26573018	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	26001828	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	29506515		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15171819, 15494423, 15964800, 17352239, 21702955, 21887305, 25526629, 25791120, 26472107, 26985944, 33919224, 8524841	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	16972261		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18706445, 19002588, 20836852, 23129057, 27872496, 29632729, 31105999, 8524841		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	17583492, 19339050, 25321472, 25619389	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11698483, 16982329, 20945381, 26043758, 33561558, 35840666	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37960824	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	22328940	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	15637062	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12944913, 16982329, 17054427, 20005259, 24842373, 25542232, 26934650, 28039479, 28473664, 28518151, 28765039, 29609096, 31119897		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	18094581		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28639904, 29568920, 29663662, 30623577		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10488090, 12361705, 18620777, 19033664, 19041150, 19270500, 19664633, 19686584, 20637208, 22323130, 23137540, 23266194, 23751896, 24104553, 25091573, 25173965, 25560488, 26517516, 26648552, 26707143, 26718209, 26790956, 26964667, 27010469, 27392951, 27751820, 28012230, 28012958, 28178378, 28290049, 28668554, 28677801, 28720813, 28801533, 28895405, 28938597, 29408091, 29445085, 29714074, 29766185, 29968959, 30333881, 30519270, 30621754, 30990169, 30996112, 31425749, 31527306, 31597595, 31836141		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18620777		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28783177		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	13130464, 16802349, 32131874	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	21953337	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	21272161	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	25080058	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	CTD_human_DG	17185352		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure, Acute	Liver failure	BEFREE	30264435, 31029706		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	BEFREE	10488090, 12361705, 22323130		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	37542825	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	16946096		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32457348	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12714585, 14965369, 21525012, 22222766, 23681803, 24505400, 26362062, 26560124, 28251885, 28592245, 28618937, 29132432, 30875659, 32277638, 32358059, 33313952, 33360044, 35850313, 36224313	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	15705594	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16307741		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	31572176		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22966240, 24495300, 26090483	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	11106658, 12502848, 19937141, 24915933	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11703825		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	20976278		★☆☆☆☆ Found in Text Mining only
Majeed syndrome	Majeed syndrome	Pubtator	33314777	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30180869		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	16964394		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	11592233, 11927016, 22824861, 28522603		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	19206150		★☆☆☆☆ Found in Text Mining only
Malignant melanoma of choroid	Choroidal melanoma	BEFREE	28529590		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16002723, 17875734, 18767025, 20482821, 20507565, 20878129, 20944115, 21368274, 22446103, 23652009, 24434780, 25629224, 25976678, 26012635, 26049416, 27599524, 27899257, 28031536, 28611109, 28681938, 29710529, 29765551, 29856313, 30446635, 30568466, 30809096, 31419957, 31734829		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	11720885		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30768984		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	27009073		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	19056926		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	19164706		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	26001828, 30239172		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	19033664, 19041150, 19270500, 20885449, 29328482		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15705594, 18331824, 18372076, 24434654, 24452601, 28099944, 28251885, 28597042, 28782471, 30072581, 30207732, 30644129, 30875659, 30933439, 31557334, 31695422		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28639904, 29568920, 29663662, 30623577		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10353733, 24865582		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15767210, 16278378, 18094619, 19194824, 21958460, 23237571, 24947996, 27666165, 29088796, 29758193, 30584464		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11850819, 16238095, 17560336, 22766602, 23129185, 23900581, 24985060, 27431052, 28122633, 28565848, 29896275, 31600936, 9645439		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	18593901		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22293972, 23921907, 26279301, 26291058, 28344324		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31139020		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26312564, 30032449, 30809635, 31587482		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16381010, 17971243, 20110589, 20495362, 20878129, 21148313, 22003962, 22293972, 22766602, 24030148, 24316756, 24395444, 24434780, 24947996, 25456131, 25619750, 26021759, 26095609, 26510914, 28444898, 28457938, 28522603, 28639904, 29150048, 29423673, 29451063, 29636389, 29945964, 30487597, 30605652, 30779920, 31243599, 31281505, 31312395, 31336714, 31428903, 31639019		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	20680410, 30936125		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29501043, 29590661		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19352384, 25113506, 25611974, 26023085, 26637668, 29451183, 29949153, 30219232, 30372822, 30482246		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14724588		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	19206150		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	21775132, 30447254		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16951673, 17304627, 17482134, 22832488, 25137374, 25793618, 25814555, 26808375, 28703746, 32134466, 33430068, 35307409, 36293123, 36982528, 37277447	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17304627, 18989785, 22832488, 23067222, 23624923, 24980831, 25505176, 25814555, 27966446, 28759024, 31063355, 31401046, 31639019		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18541008		★☆☆☆☆ Found in Text Mining only
Melanoma Experimental	Melanoma	Pubtator	12684272	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	26840621		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	11751189, 21669197		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	27916420		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	Pubtator	12707267, 22076560	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	17805054		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	15830375	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	31295022		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	21690090		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	26800561	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	21266669	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	22396222, 31384535		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	19903888		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	24388750		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	28405919		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	15782127, 16141349, 18373696, 19245689, 19270531, 20338993, 26083398, 30374881, 30656603, 32554853, 33097606, 33763168, 34895315, 35342363, 36122664	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25233933, 32502840, 33921647	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12209879, 19282458, 21454451, 22850273, 23045269, 23666852, 29048129, 31777580		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12393500, 12665525, 17032922, 17255354, 17384201, 22276160, 23045269, 26689580, 26724804, 33658484, 36251145, 36289430	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	17255354		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10550297, 20855355, 31698073		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	10550297	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	15970671, 28405919		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	22559819, 25472472	Associate	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	29749399		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	20103647		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	19843577, 29197221	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	25237043, 28726929, 29408518, 29630131		★☆☆☆☆ Found in Text Mining only
Myocardial necrosis	Myocardial necrosis	BEFREE	29408518		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	28499238		★☆☆☆☆ Found in Text Mining only
Nail-Patella Syndrome	Nail-Patella Syndrome	BEFREE	30233679		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	23406595		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	20637487, 21943220, 22727408, 24157866, 25028967, 27859422, 29738439, 31691433, 32196600, 34165177	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	24157866, 25714020, 29519627, 30983163		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	18789327	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	22421439	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	20716917		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	20716917		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10825181, 12185592, 15262983, 15358168, 15705594, 16002723, 16381010, 18620777, 19033664, 19041150, 19478459, 20390427, 20495362, 20944115, 21136598, 21148313, 21775132, 22965873, 23098208, 23196366, 23846687, 23874226, 23912840, 24395444, 24434780, 24654231, 25456131, 25496033, 25596741, 25724684, 25874673, 26023085, 26095609, 26255843, 26575790, 26637668, 26935290, 27034261, 27421653, 27599524, 27713480, 27866828, 28090628, 28099944, 28135100, 28344324, 28402256, 28522603, 28609656, 28611109, 28639904, 28681938, 28837246, 29356020, 29383168, 29428730, 29451063, 29620232, 29710529, 29717031, 29719260, 29856313, 30975087, 31118679, 31485597, 31649333		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	21573233		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	29511793		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis Calcium Oxalate	Nephrolithiasis	Pubtator	37191760	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	23871663, 34873575	Associate	★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	18242171	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29684334		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	22610794		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	14617628, 15993333, 24253178, 26592517, 27732954	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16515547, 24253178, 24556694, 25033461, 27357360, 28831692, 28875231, 30134948		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	28366453, 34962918	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	18540881		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	20110589, 20202476, 26505831, 30496826, 30813721, 31283035		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	30936125		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	Pubtator	16643666	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28216552, 29298863, 30908654		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	14499626, 15194048, 15705594, 17057737, 23456625, 25359574, 25566961, 26503828, 26575790, 26993769, 27164297, 27861856, 28286419, 28886730, 29945964, 30644129, 30849960, 31226632, 31352088, 31551407, 31557334, 31692885		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	27916420, 29298863, 29602237, 31384535		★☆☆☆☆ Found in Text Mining only
Nonketotic Hyperglycinemia	Nonketotic Hyperglycinemia	BEFREE	28050793		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan syndrome	Pubtator	32514133	Associate	★☆☆☆☆ Found in Text Mining only
Norrie disease	Norrie Disease	BEFREE	29575791		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	12902351, 22351776, 23110196, 24895488, 27688298	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16818881, 17050683, 18728164, 19258436, 19351724, 21540183, 22396222, 24358263, 28165482, 28180059, 28602806, 30143607, 31797011		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23975543, 24484739, 25370852, 27481183	Stimulate	★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	BEFREE	23431148		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	24035571	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	12507586, 19302240, 21172926, 21194467, 25091567, 26982743, 32377698, 33097606, 37507717	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	21538317	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	28647559		★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis imperfecta	Pubtator	33850461	Associate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	25635827, 31251836	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	31654668		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30217450, 31103701		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36626454	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	17218775, 17412493, 24025361, 27035222, 27144433, 28244849, 29523223, 30142914, 31505816, 33239866, 36438897	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	18757369, 19330880, 23708932, 27176794, 27453337, 28188923, 29847772, 31105818		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	18757369		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	10353733		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24865582		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10075725, 10531373, 12183452, 12637505, 12785726, 22761939, 22900074, 24602453, 24865582, 25891642, 26261528, 26433471, 28423586, 31770410, 32021086, 35251480, 36122664, 36766725, 37400764	Associate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	16964758, 25655200		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15767210, 16278378, 18094619, 19194824, 21958460, 23237571, 24947996, 27666165, 29088796, 29758193, 30584464		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	24947996, 28837246		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18094619, 19194824, 24512202, 30584464, 31652886, 33098056, 33341545, 34782370, 35383226, 36990335	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25473894	Stimulate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30904818		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15748162, 17095503, 20510502, 29552055, 29904339, 31552910		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	16515547, 28365714, 33253821, 36501032	Associate	★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	30076580		★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	20007702		★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	23273084		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	31599069	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	30656694		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	15658002, 15977985, 29432529		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	29168690		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	31231308		★☆☆☆☆ Found in Text Mining only
Poikiloderma of Kindler	Poikiloderma Of Kindler	BEFREE	27725201		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	34962918	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	Pubtator	34962918	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	27117143, 30341520, 31005728		★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	29118187		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	18322253, 19996270		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	29749399		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11850819, 16238095, 17560336, 22766602, 23129185, 23900581, 24985060, 27431052, 28122633, 28565848, 31600936, 9645439		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10839298, 12663665, 14766760, 18472959, 19420015, 19667069, 20566643, 20649571, 21734453, 23380421, 24980815, 25559363, 25971429, 31600936, 31902674, 32319589, 32427575, 34099634, 36364008, 38099475	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12859962, 12902351, 14766760		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12902351	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19275204	Inhibit	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28602508, 29167025, 30171832, 31540162		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	30171832	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	25905460	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22518834, 24988221, 30468094	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27226108, 31601679		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	23027623, 23859041		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	19164706		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27717821, 28381189, 28950257, 29763892, 29864454		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	27770286, 29101337, 29230844, 30760641		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	16946096, 28781625		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29039541		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	16946096		★☆☆☆☆ Found in Text Mining only
Restrictive cardiomyopathy	Restrictive cardiomyopathy	BEFREE	14742426		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	21234586, 21726611, 24825363, 30417500		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	19478459, 19923885, 20495362, 30447254		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	14734742, 16802349, 17530707, 18713996, 19877043, 20228199, 22183962, 24764263, 27226108, 28239846, 28750350, 28806729, 29511118, 30186380		★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	29258061		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	16619517, 16705697	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	31785812		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	15581626	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	16699017, 17964626	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	26850593	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	24284070		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	24284070		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	24578173, 30157947	Stimulate	★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	15970671		★☆☆☆☆ Found in Text Mining only
Secondary Trigeminal Neuralgia	Trigeminal neuralgia	CTD_human_DG	27093858		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	15658002, 15977985		★☆☆☆☆ Found in Text Mining only
Senior Loken Syndrome	Senior-loken syndrome	Pubtator	11849444	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	20237583, 24679696, 28525390, 29039541, 29608549, 30249753, 30740674, 31206807		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	10340964, 37408182	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29698775		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12181446, 15880572, 9092556		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	12149148, 9092556	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	15173070	Stimulate	★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	16388335	Stimulate	★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	33602173	Associate	★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Hereditary	Spastic paraplegia	BEFREE	16388335		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia 11	Spinocerebellar ataxia	Pubtator	25062847	Associate	★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxias	Spinocerebellar ataxia	Pubtator	25062847	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11326313, 16283431, 20121928, 26796273, 27725201		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16283431, 17908987		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27057634, 28801140, 29306013, 29340044, 29423673, 31707583		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24205072, 24398980, 24497297, 27930712, 32085431, 34553218, 35974187, 36430348, 38030062	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	31089135		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	27907906		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25270024, 28522603, 28915597		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	27175933		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28664455, 28870089, 29111385		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	21540183, 24167585, 29107687		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	26463477		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22293972, 26279301, 26291058, 28344324		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	22905237	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	31215272		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12439916, 15069708, 18356158, 20150185, 20559021, 22905237, 23326144, 23921907, 25198898, 25243868, 25342459, 26291058, 26645893, 27268017, 27431278, 27895401, 29343514, 29666306, 31466817, 31829409, 32390606, 35748914	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	18593901		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28236213, 28396258, 29249938, 29273596, 30431087		★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	35976433	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	19137009		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	30702500		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	15658002, 15977985, 28107387, 30315879		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	LHGDN	18540881		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	15119004	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21333695, 31139020		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31139020		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	21333695, 28099584, 28709407, 28730778, 31180559, 37932340	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	30656603	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	27440446		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	CTD_human_DG	27093858		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Trigeminal Neuralgia, Idiopathic	Trigeminal neuralgia	CTD_human_DG	27093858		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21214929, 27941886, 28611109, 29285221, 29301832, 30446635		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24642040, 30442712, 32985606, 35053370, 36969705	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	24988221	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29253460		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23922701, 25526030, 27171279, 27440446, 27556506, 36045117, 36543245	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18373696, 19010820, 21928122, 22427461, 27034261, 29590661, 31081078, 31424656, 32521858, 34004082, 35191522, 35831303, 35939492	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33303976	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	36232829	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	15734884, 27688298, 33763168, 33850461	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	26800561	Stimulate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	28546532, 30536538	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	30158835		★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	33850461	Associate	★☆☆☆☆ Found in Text Mining only
Waisman syndrome	Waisman syndrome	BEFREE	22470468		★☆☆☆☆ Found in Text Mining only
WHIM syndrome	Whim syndrome	Pubtator	33485325	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	16044158		★☆☆☆☆ Found in Text Mining only