Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	3725
Gene name	Jun proto-oncogene, AP-1 transcription factor subunit
Gene symbol	JUN
Synonyms (NCBI Gene)	AP-1AP1c-JuncJUNp39
Chromosome	1
Chromosome location	1p32.1
Summary	This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless

363

Show/Hide all (363)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000868	hsa-miR-15a-5p	Microarray	18362358
MIRT000867	hsa-miR-16-5p	Microarray	18362358
MIRT005128	hsa-miR-30a-5p	pSILAC	18668040
MIRT006208	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	22508041
MIRT006208	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	22508041
MIRT006208	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	22508041
MIRT006208	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	22508041
MIRT006208	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	22508041
MIRT006208	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	22508041
MIRT020367	hsa-miR-29c-3p	Sequencing	20371350
MIRT027318	hsa-miR-101-3p	Sequencing	20371350
MIRT005128	hsa-miR-30a-5p	Proteomics;Other	18668040
MIRT029641	hsa-miR-26b-5p	Microarray	19088304
MIRT048821	hsa-miR-93-5p	CLASH	23622248
MIRT045693	hsa-miR-149-5p	CLASH	23622248
MIRT043728	hsa-miR-342-3p	CLASH	23622248
MIRT053050	hsa-miR-203a-3p	ImmunoblotImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCR	23552555
MIRT054258	hsa-miR-139-5p	ChIP-seqFlowLuciferase reporter assayqRT-PCRWestern blot	25499265
MIRT054258	hsa-miR-139-5p	ChIP-seqFlowLuciferase reporter assayqRT-PCRWestern blot	25499265
MIRT560411	hsa-miR-4328	PAR-CLIP	20371350
MIRT560410	hsa-miR-4804-3p	PAR-CLIP	20371350
MIRT560409	hsa-miR-4720-3p	PAR-CLIP	20371350
MIRT560407	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT560408	hsa-miR-633	PAR-CLIP	20371350
MIRT560406	hsa-miR-2681-5p	PAR-CLIP	20371350
MIRT502179	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT502178	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT502177	hsa-miR-429	PAR-CLIP	24398324
MIRT502176	hsa-miR-8084	PAR-CLIP	24398324
MIRT502175	hsa-miR-4724-5p	PAR-CLIP	24398324
MIRT502174	hsa-miR-374c-5p	PAR-CLIP	24398324
MIRT502173	hsa-miR-655-3p	PAR-CLIP	24398324
MIRT260042	hsa-miR-1321	PAR-CLIP	22100165
MIRT260049	hsa-miR-4739	PAR-CLIP	22100165
MIRT260051	hsa-miR-4756-5p	PAR-CLIP	22100165
MIRT403890	hsa-miR-3691-3p	PAR-CLIP	22100165
MIRT443329	hsa-miR-4480	PAR-CLIP	22100165
MIRT443328	hsa-miR-4783-5p	PAR-CLIP	22100165
MIRT115283	hsa-miR-149-3p	PAR-CLIP	22100165
MIRT115286	hsa-miR-4728-5p	PAR-CLIP	22100165
MIRT115291	hsa-miR-6785-5p	PAR-CLIP	22100165
MIRT115299	hsa-miR-6883-5p	PAR-CLIP	22100165
MIRT443327	hsa-miR-3178	PAR-CLIP	22100165
MIRT731173	hsa-miR-1470	qRT-PCRLuciferase reporter assayWestern blot	25545366
MIRT731173	hsa-miR-1470	qRT-PCRLuciferase reporter assayWestern blot	25545366
MIRT502178	hsa-miR-200b-3p	Luciferase reporter assayqRT-PCRWestern blot	27979826
MIRT502178	hsa-miR-200b-3p	Luciferase reporter assayWestern blot	27979826
MIRT054258	hsa-miR-139-5p	Luciferase reporter assayWestern blottingMicroarrayImmunohistochemistry (IHC)ImmunofluorescenceChIP-seqin vivo gain/loss-of-function experiments	32641995
MIRT054258	hsa-miR-139-5p	Western blottingqRT-PCRFlow cytometry	34249000
MIRT054258	hsa-miR-139-5p	Luciferase reporter assayWestern blottingMicroarrayImmunohistochemistry (IHC)ImmunofluorescenceChIP-seqqRT-PCRIn situ hybridization	32641995
MIRT560411	hsa-miR-4328	PAR-CLIP	20371350
MIRT560410	hsa-miR-4804-3p	PAR-CLIP	20371350
MIRT560409	hsa-miR-4720-3p	PAR-CLIP	20371350
MIRT560407	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT560408	hsa-miR-633	PAR-CLIP	20371350
MIRT560406	hsa-miR-2681-5p	PAR-CLIP	20371350
MIRT502179	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT502178	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT502177	hsa-miR-429	PAR-CLIP	24398324
MIRT502176	hsa-miR-8084	PAR-CLIP	24398324
MIRT502175	hsa-miR-4724-5p	PAR-CLIP	24398324
MIRT502174	hsa-miR-374c-5p	PAR-CLIP	24398324
MIRT502173	hsa-miR-655-3p	PAR-CLIP	24398324
MIRT260042	hsa-miR-1321	PAR-CLIP	22100165
MIRT260049	hsa-miR-4739	PAR-CLIP	22100165
MIRT260051	hsa-miR-4756-5p	PAR-CLIP	22100165
MIRT403890	hsa-miR-3691-3p	PAR-CLIP	22100165
MIRT443329	hsa-miR-4480	PAR-CLIP	22100165
MIRT443328	hsa-miR-4783-5p	PAR-CLIP	22100165
MIRT115283	hsa-miR-149-3p	PAR-CLIP	22100165
MIRT115286	hsa-miR-4728-5p	PAR-CLIP	22100165
MIRT115291	hsa-miR-6785-5p	PAR-CLIP	22100165
MIRT115299	hsa-miR-6883-5p	PAR-CLIP	22100165
MIRT443327	hsa-miR-3178	PAR-CLIP	22100165
MIRT1078094	hsa-miR-1245b-3p	CLIP-seq
MIRT1078095	hsa-miR-1258	CLIP-seq
MIRT1078096	hsa-miR-1275	CLIP-seq
MIRT1078097	hsa-miR-1285	CLIP-seq
MIRT1078098	hsa-miR-1322	CLIP-seq
MIRT1078099	hsa-miR-141	CLIP-seq
MIRT1078100	hsa-miR-1468	CLIP-seq
MIRT1078101	hsa-miR-1972	CLIP-seq
MIRT1078102	hsa-miR-1976	CLIP-seq
MIRT1078103	hsa-miR-200a	CLIP-seq
MIRT1078104	hsa-miR-200b	CLIP-seq
MIRT1078105	hsa-miR-200c	CLIP-seq
MIRT1078106	hsa-miR-2116	CLIP-seq
MIRT1078107	hsa-miR-216b	CLIP-seq
MIRT1078108	hsa-miR-24	CLIP-seq
MIRT1078109	hsa-miR-25	CLIP-seq
MIRT1078110	hsa-miR-298	CLIP-seq
MIRT1078111	hsa-miR-3074-5p	CLIP-seq
MIRT1078112	hsa-miR-3120-5p	CLIP-seq
MIRT1078113	hsa-miR-3137	CLIP-seq
MIRT1078114	hsa-miR-3152-3p	CLIP-seq
MIRT1078115	hsa-miR-3173-3p	CLIP-seq
MIRT1078116	hsa-miR-3187-5p	CLIP-seq
MIRT1078117	hsa-miR-32	CLIP-seq
MIRT1078118	hsa-miR-363	CLIP-seq
MIRT1078119	hsa-miR-367	CLIP-seq
MIRT1078120	hsa-miR-370	CLIP-seq
MIRT1078121	hsa-miR-3714	CLIP-seq
MIRT1078122	hsa-miR-374c	CLIP-seq
MIRT1078123	hsa-miR-3943	CLIP-seq
MIRT1078124	hsa-miR-4277	CLIP-seq
MIRT1078125	hsa-miR-4428	CLIP-seq
MIRT1078126	hsa-miR-4469	CLIP-seq
MIRT1078127	hsa-miR-4477b	CLIP-seq
MIRT1078128	hsa-miR-4525	CLIP-seq
MIRT1078129	hsa-miR-4632	CLIP-seq
MIRT1078130	hsa-miR-4640-3p	CLIP-seq
MIRT1078131	hsa-miR-4659a-3p	CLIP-seq
MIRT1078132	hsa-miR-4659b-3p	CLIP-seq
MIRT1078133	hsa-miR-4665-5p	CLIP-seq
MIRT1078134	hsa-miR-4667-3p	CLIP-seq
MIRT1078135	hsa-miR-4672	CLIP-seq
MIRT1078136	hsa-miR-4677-5p	CLIP-seq
MIRT1078137	hsa-miR-4690-3p	CLIP-seq
MIRT1078138	hsa-miR-4699-3p	CLIP-seq
MIRT1078139	hsa-miR-4711-5p	CLIP-seq
MIRT1078140	hsa-miR-4719	CLIP-seq
MIRT1078141	hsa-miR-4722-3p	CLIP-seq
MIRT1078142	hsa-miR-4723-5p	CLIP-seq
MIRT1078143	hsa-miR-4729	CLIP-seq
MIRT1078144	hsa-miR-4731-5p	CLIP-seq
MIRT1078145	hsa-miR-4749-3p	CLIP-seq
MIRT1078146	hsa-miR-4762-5p	CLIP-seq
MIRT1078147	hsa-miR-490-3p	CLIP-seq
MIRT1078148	hsa-miR-499-3p	CLIP-seq
MIRT1078149	hsa-miR-499a-3p	CLIP-seq
MIRT1078150	hsa-miR-513c	CLIP-seq
MIRT1078151	hsa-miR-514b-5p	CLIP-seq
MIRT1078152	hsa-miR-520d-5p	CLIP-seq
MIRT1078153	hsa-miR-522	CLIP-seq
MIRT1078154	hsa-miR-524-5p	CLIP-seq
MIRT1078155	hsa-miR-580	CLIP-seq
MIRT1078156	hsa-miR-583	CLIP-seq
MIRT1078157	hsa-miR-591	CLIP-seq
MIRT1078158	hsa-miR-593	CLIP-seq
MIRT1078159	hsa-miR-599	CLIP-seq
MIRT1078160	hsa-miR-612	CLIP-seq
MIRT1078161	hsa-miR-625	CLIP-seq
MIRT1078162	hsa-miR-637	CLIP-seq
MIRT1078163	hsa-miR-649	CLIP-seq
MIRT1078164	hsa-miR-655	CLIP-seq
MIRT1078165	hsa-miR-759	CLIP-seq
MIRT1078166	hsa-miR-765	CLIP-seq
MIRT1078167	hsa-miR-92a	CLIP-seq
MIRT1078168	hsa-miR-92b	CLIP-seq
MIRT1078169	hsa-miR-940	CLIP-seq
MIRT1078094	hsa-miR-1245b-3p	CLIP-seq
MIRT2019460	hsa-miR-1261	CLIP-seq
MIRT1078098	hsa-miR-1322	CLIP-seq
MIRT1078102	hsa-miR-1976	CLIP-seq
MIRT1078108	hsa-miR-24	CLIP-seq
MIRT1078110	hsa-miR-298	CLIP-seq
MIRT1078111	hsa-miR-3074-5p	CLIP-seq
MIRT2019461	hsa-miR-3119	CLIP-seq
MIRT1078112	hsa-miR-3120-5p	CLIP-seq
MIRT2019462	hsa-miR-3130-5p	CLIP-seq
MIRT1078113	hsa-miR-3137	CLIP-seq
MIRT1078114	hsa-miR-3152-3p	CLIP-seq
MIRT2019463	hsa-miR-3168	CLIP-seq
MIRT2019464	hsa-miR-323b-3p	CLIP-seq
MIRT2019465	hsa-miR-340	CLIP-seq
MIRT2019466	hsa-miR-3605-3p	CLIP-seq
MIRT1078120	hsa-miR-370	CLIP-seq
MIRT2019467	hsa-miR-3917	CLIP-seq
MIRT2019468	hsa-miR-4278	CLIP-seq
MIRT2019469	hsa-miR-4436a	CLIP-seq
MIRT1078126	hsa-miR-4469	CLIP-seq
MIRT2019470	hsa-miR-4482	CLIP-seq
MIRT2019471	hsa-miR-4488	CLIP-seq
MIRT2019472	hsa-miR-455-3p	CLIP-seq
MIRT1078129	hsa-miR-4632	CLIP-seq
MIRT1078131	hsa-miR-4659a-3p	CLIP-seq
MIRT1078132	hsa-miR-4659b-3p	CLIP-seq
MIRT1078134	hsa-miR-4667-3p	CLIP-seq
MIRT2019473	hsa-miR-4697-5p	CLIP-seq
MIRT2019474	hsa-miR-4715-3p	CLIP-seq
MIRT1078140	hsa-miR-4719	CLIP-seq
MIRT1078141	hsa-miR-4722-3p	CLIP-seq
MIRT2019475	hsa-miR-4727-5p	CLIP-seq
MIRT1078145	hsa-miR-4749-3p	CLIP-seq
MIRT2019476	hsa-miR-4768-5p	CLIP-seq
MIRT2019477	hsa-miR-4769-3p	CLIP-seq
MIRT1078150	hsa-miR-513c	CLIP-seq
MIRT1078151	hsa-miR-514b-5p	CLIP-seq
MIRT1078155	hsa-miR-580	CLIP-seq
MIRT1078156	hsa-miR-583	CLIP-seq
MIRT1078158	hsa-miR-593	CLIP-seq
MIRT1078162	hsa-miR-637	CLIP-seq
MIRT2019478	hsa-miR-890	CLIP-seq
MIRT2019479	hsa-miR-891b	CLIP-seq
MIRT2251289	hsa-miR-1247	CLIP-seq
MIRT1078095	hsa-miR-1258	CLIP-seq
MIRT2019460	hsa-miR-1261	CLIP-seq
MIRT1078096	hsa-miR-1275	CLIP-seq
MIRT1078100	hsa-miR-1468	CLIP-seq
MIRT2251290	hsa-miR-1587	CLIP-seq
MIRT1078101	hsa-miR-1972	CLIP-seq
MIRT1078102	hsa-miR-1976	CLIP-seq
MIRT1078104	hsa-miR-200b	CLIP-seq
MIRT1078105	hsa-miR-200c	CLIP-seq
MIRT2251291	hsa-miR-203	CLIP-seq
MIRT1078106	hsa-miR-2116	CLIP-seq
MIRT2251292	hsa-miR-2277-5p	CLIP-seq
MIRT1078108	hsa-miR-24	CLIP-seq
MIRT1078109	hsa-miR-25	CLIP-seq
MIRT2019461	hsa-miR-3119	CLIP-seq
MIRT1078112	hsa-miR-3120-5p	CLIP-seq
MIRT2019462	hsa-miR-3130-5p	CLIP-seq
MIRT1078113	hsa-miR-3137	CLIP-seq
MIRT1078114	hsa-miR-3152-3p	CLIP-seq
MIRT1078115	hsa-miR-3173-3p	CLIP-seq
MIRT1078117	hsa-miR-32	CLIP-seq
MIRT2019466	hsa-miR-3605-3p	CLIP-seq
MIRT1078118	hsa-miR-363	CLIP-seq
MIRT1078119	hsa-miR-367	CLIP-seq
MIRT1078121	hsa-miR-3714	CLIP-seq
MIRT1078122	hsa-miR-374c	CLIP-seq
MIRT2251293	hsa-miR-4252	CLIP-seq
MIRT2251294	hsa-miR-4263	CLIP-seq
MIRT2251295	hsa-miR-4264	CLIP-seq
MIRT1078124	hsa-miR-4277	CLIP-seq
MIRT2251296	hsa-miR-4417	CLIP-seq
MIRT1078125	hsa-miR-4428	CLIP-seq
MIRT2019469	hsa-miR-4436a	CLIP-seq
MIRT1078126	hsa-miR-4469	CLIP-seq
MIRT1078127	hsa-miR-4477b	CLIP-seq
MIRT2019470	hsa-miR-4482	CLIP-seq
MIRT2019471	hsa-miR-4488	CLIP-seq
MIRT2251297	hsa-miR-4492	CLIP-seq
MIRT2251298	hsa-miR-4498	CLIP-seq
MIRT1078128	hsa-miR-4525	CLIP-seq
MIRT2019472	hsa-miR-455-3p	CLIP-seq
MIRT1078129	hsa-miR-4632	CLIP-seq
MIRT1078130	hsa-miR-4640-3p	CLIP-seq
MIRT2251299	hsa-miR-4645-3p	CLIP-seq
MIRT2251300	hsa-miR-4656	CLIP-seq
MIRT1078133	hsa-miR-4665-5p	CLIP-seq
MIRT1078134	hsa-miR-4667-3p	CLIP-seq
MIRT1078135	hsa-miR-4672	CLIP-seq
MIRT2251301	hsa-miR-4675	CLIP-seq
MIRT1078136	hsa-miR-4677-5p	CLIP-seq
MIRT2251302	hsa-miR-4694-3p	CLIP-seq
MIRT2019473	hsa-miR-4697-5p	CLIP-seq
MIRT2251303	hsa-miR-4706	CLIP-seq
MIRT1078139	hsa-miR-4711-5p	CLIP-seq
MIRT1078140	hsa-miR-4719	CLIP-seq
MIRT1078141	hsa-miR-4722-3p	CLIP-seq
MIRT1078142	hsa-miR-4723-5p	CLIP-seq
MIRT1078143	hsa-miR-4729	CLIP-seq
MIRT1078144	hsa-miR-4731-5p	CLIP-seq
MIRT2251304	hsa-miR-4741	CLIP-seq
MIRT1078145	hsa-miR-4749-3p	CLIP-seq
MIRT2251305	hsa-miR-4749-5p	CLIP-seq
MIRT2251306	hsa-miR-4772-3p	CLIP-seq
MIRT2251307	hsa-miR-4797-3p	CLIP-seq
MIRT2251308	hsa-miR-4799-5p	CLIP-seq
MIRT1078147	hsa-miR-490-3p	CLIP-seq
MIRT2251309	hsa-miR-495	CLIP-seq
MIRT1078148	hsa-miR-499-3p	CLIP-seq
MIRT1078149	hsa-miR-499a-3p	CLIP-seq
MIRT1078152	hsa-miR-520d-5p	CLIP-seq
MIRT1078153	hsa-miR-522	CLIP-seq
MIRT1078154	hsa-miR-524-5p	CLIP-seq
MIRT2251310	hsa-miR-576-5p	CLIP-seq
MIRT2251311	hsa-miR-587	CLIP-seq
MIRT1078157	hsa-miR-591	CLIP-seq
MIRT1078158	hsa-miR-593	CLIP-seq
MIRT1078159	hsa-miR-599	CLIP-seq
MIRT2251312	hsa-miR-617	CLIP-seq
MIRT1078161	hsa-miR-625	CLIP-seq
MIRT1078162	hsa-miR-637	CLIP-seq
MIRT2251313	hsa-miR-642a	CLIP-seq
MIRT1078163	hsa-miR-649	CLIP-seq
MIRT1078164	hsa-miR-655	CLIP-seq
MIRT2251314	hsa-miR-762	CLIP-seq
MIRT1078166	hsa-miR-765	CLIP-seq
MIRT2019478	hsa-miR-890	CLIP-seq
MIRT1078167	hsa-miR-92a	CLIP-seq
MIRT1078168	hsa-miR-92b	CLIP-seq
MIRT1078169	hsa-miR-940	CLIP-seq
MIRT2389566	hsa-miR-1260	CLIP-seq
MIRT2389567	hsa-miR-1260b	CLIP-seq
MIRT1078100	hsa-miR-1468	CLIP-seq
MIRT2389568	hsa-miR-188-3p	CLIP-seq
MIRT1078102	hsa-miR-1976	CLIP-seq
MIRT1078106	hsa-miR-2116	CLIP-seq
MIRT2251292	hsa-miR-2277-5p	CLIP-seq
MIRT1078109	hsa-miR-25	CLIP-seq
MIRT2389569	hsa-miR-3156-3p	CLIP-seq
MIRT1078117	hsa-miR-32	CLIP-seq
MIRT1078118	hsa-miR-363	CLIP-seq
MIRT2389570	hsa-miR-3667-3p	CLIP-seq
MIRT1078119	hsa-miR-367	CLIP-seq
MIRT2389571	hsa-miR-4301	CLIP-seq
MIRT1078126	hsa-miR-4469	CLIP-seq
MIRT2019471	hsa-miR-4488	CLIP-seq
MIRT1078129	hsa-miR-4632	CLIP-seq
MIRT2389572	hsa-miR-4636	CLIP-seq
MIRT1078130	hsa-miR-4640-3p	CLIP-seq
MIRT1078134	hsa-miR-4667-3p	CLIP-seq
MIRT1078136	hsa-miR-4677-5p	CLIP-seq
MIRT2019473	hsa-miR-4697-5p	CLIP-seq
MIRT2251303	hsa-miR-4706	CLIP-seq
MIRT1078141	hsa-miR-4722-3p	CLIP-seq
MIRT1078145	hsa-miR-4749-3p	CLIP-seq
MIRT2251305	hsa-miR-4749-5p	CLIP-seq
MIRT2389573	hsa-miR-517a	CLIP-seq
MIRT2389574	hsa-miR-517b	CLIP-seq
MIRT2389575	hsa-miR-517c	CLIP-seq
MIRT1078162	hsa-miR-637	CLIP-seq
MIRT1078167	hsa-miR-92a	CLIP-seq
MIRT1078168	hsa-miR-92b	CLIP-seq
MIRT1078096	hsa-miR-1275	CLIP-seq
MIRT1078111	hsa-miR-3074-5p	CLIP-seq
MIRT2554628	hsa-miR-3121-5p	CLIP-seq
MIRT2554629	hsa-miR-3143	CLIP-seq
MIRT2019465	hsa-miR-340	CLIP-seq
MIRT2554630	hsa-miR-362-5p	CLIP-seq
MIRT1078120	hsa-miR-370	CLIP-seq
MIRT2554631	hsa-miR-4282	CLIP-seq
MIRT1078128	hsa-miR-4525	CLIP-seq
MIRT2554632	hsa-miR-4528	CLIP-seq
MIRT2554633	hsa-miR-4637	CLIP-seq
MIRT1078133	hsa-miR-4665-5p	CLIP-seq
MIRT2251302	hsa-miR-4694-3p	CLIP-seq
MIRT1078139	hsa-miR-4711-5p	CLIP-seq
MIRT2019474	hsa-miR-4715-3p	CLIP-seq
MIRT1078142	hsa-miR-4723-5p	CLIP-seq
MIRT1078144	hsa-miR-4731-5p	CLIP-seq
MIRT1078147	hsa-miR-490-3p	CLIP-seq
MIRT2554634	hsa-miR-494	CLIP-seq
MIRT2554635	hsa-miR-500b	CLIP-seq
MIRT2554636	hsa-miR-501-5p	CLIP-seq
MIRT2554637	hsa-miR-513a-3p	CLIP-seq
MIRT1078153	hsa-miR-522	CLIP-seq
MIRT2554638	hsa-miR-543	CLIP-seq
MIRT1078155	hsa-miR-580	CLIP-seq
MIRT2251311	hsa-miR-587	CLIP-seq
MIRT1078157	hsa-miR-591	CLIP-seq
MIRT1078161	hsa-miR-625	CLIP-seq
MIRT1078162	hsa-miR-637	CLIP-seq
MIRT1078163	hsa-miR-649	CLIP-seq
MIRT1078166	hsa-miR-765	CLIP-seq
MIRT2554639	hsa-miR-9	CLIP-seq
MIRT1078096	hsa-miR-1275	CLIP-seq
MIRT2554628	hsa-miR-3121-5p	CLIP-seq
MIRT2554630	hsa-miR-362-5p	CLIP-seq
MIRT1078128	hsa-miR-4525	CLIP-seq
MIRT1078133	hsa-miR-4665-5p	CLIP-seq
MIRT1078142	hsa-miR-4723-5p	CLIP-seq
MIRT1078144	hsa-miR-4731-5p	CLIP-seq
MIRT2554634	hsa-miR-494	CLIP-seq
MIRT2554635	hsa-miR-500b	CLIP-seq
MIRT2554636	hsa-miR-501-5p	CLIP-seq
MIRT2251311	hsa-miR-587	CLIP-seq
MIRT1078161	hsa-miR-625	CLIP-seq
MIRT1078162	hsa-miR-637	CLIP-seq
MIRT1078166	hsa-miR-765	CLIP-seq
MIRT2554639	hsa-miR-9	CLIP-seq

Show/Hide all (38)

Transcription factor	Regulation	Reference
ABL1	Activation	15145216
ABL1	Repression	19357699
AR	Activation	20148354
ARNT	Repression	21544813
ATF2	Activation	9502786
CREB1	Repression	8647095
CREB1	Unknown	10403485
CTNNB1	Activation	20300972
CTNNB1	Unknown	19671687
ESR1	Activation	11477071
ESR1	Unknown	10037443
ESR2	Unknown	10037443
GLI1	Unknown	19219074
GLI2	Unknown	19219074
HDAC3	Repression	17244530
HDAC4	Activation	10523670
HDAC4	Repression	10523670
HSF1	Unknown	24127737
JUN	Activation	9502786
JUN	Unknown	19671687
MEF2A	Activation	12054430
MEF2A	Unknown	10403485
MEF2C	Activation	10523670;12054430
MEF2C	Repression	10523670
MEF2C	Unknown	10849446
MEF2D	Activation	12054430
NFIC	Unknown	10403485
NFRKB	Activation	22291976
PARP1	Unknown	16026317
PITX1	Repression	21425961
RUNX1	Activation	20959602
SMAD3	Unknown	10022869
SMAD4	Unknown	10022869
TCF4	Unknown	19671687
TNFAIP3	Repression	19124729
WT1	Activation	20842112
ZNF382	Repression	20682794
ZNF383	Repression	15964543

Show/Hide all (99)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	2833704
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	21113145
GO:0000228	Component	Nuclear chromosome	TAS	10918580
GO:0000785	Component	Chromatin	IDA	31341047
GO:0000785	Component	Chromatin	ISA
GO:0000791	Component	Euchromatin	IDA	19861239
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	2833704, 9732876, 14645924, 21113145, 22083952, 24623306
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19861239
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	2833704, 19861239, 21113145
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	2833704
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	2833704, 19861239
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001774	Process	Microglial cell activation	IEA
GO:0001889	Process	Liver development	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	2825349
GO:0003682	Function	Chromatin binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9732876, 31341047
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0005096	Function	GTPase activator activity	IDA	11804590
GO:0005515	Function	Protein binding	IPI	7816143, 8440710, 10327051, 10393177, 10428834, 11738026, 15334056, 15378002, 15626733, 15894542, 16291755, 16533805, 18003900, 18172215, 19028685, 19064921, 19074269, 19527717, 20102225, 20195357, 20511396, 20557936, 20852630, 20936779, 21199371, 21555589, 21988832, 22327296, 23602
GO:0005634	Component	Nucleus	IDA	9443941, 12370307, 21113145
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20102225, 23661758
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	8628277, 17283046
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	9510247, 20102225, 23661758
GO:0006915	Process	Apoptotic process	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	9732876
GO:0007254	Process	JNK cascade	IEA
GO:0007254	Process	JNK cascade	ISS
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010634	Process	Positive regulation of epithelial cell migration	IEA
GO:0017053	Component	Transcription repressor complex	IEA
GO:0019046	Process	Release from viral latency	IDA	34893887
GO:0019046	Process	Release from viral latency	IDA	31341047
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0030224	Process	Monocyte differentiation	IEA
GO:0031103	Process	Axon regeneration	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	14739464
GO:0034976	Process	Response to endoplasmic reticulum stress	IMP	21113145
GO:0035026	Process	Leading edge cell differentiation	IEA
GO:0035497	Function	CAMP response element binding	IDA	19861239
GO:0035976	Component	Transcription factor AP-1 complex	IDA	10508860, 16327802
GO:0035976	Component	Transcription factor AP-1 complex	IEA
GO:0035976	Component	Transcription factor AP-1 complex	IMP	26514923
GO:0035976	Component	Transcription factor AP-1 complex	IPI	7816143, 8662824, 9510247
GO:0035994	Process	Response to muscle stretch	IEA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042802	Function	Identical protein binding	IPI	8662824, 20102225, 25609649
GO:0043065	Process	Positive regulation of apoptotic process	IMP	10508860
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043392	Process	Negative regulation of DNA binding	IDA	14645924
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043922	Process	Host-mediated suppression of viral transcription	IDA	2833704
GO:0043923	Process	Host-mediated activation of viral transcription	IDA	2833704
GO:0044389	Function	Ubiquitin-like protein ligase binding	IPI	27458189
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	2833704
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	2833704, 9732876, 22083952
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	2833704, 10508860, 12490281, 19861239, 24623306
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	1406655
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048545	Process	Response to steroid hormone	IBA
GO:0051726	Process	Regulation of cell cycle	IBA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0060395	Process	SMAD protein signal transduction	IDA	9732876
GO:0061029	Process	Eyelid development in camera-type eye	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	10508860, 16007074, 19861239
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070412	Function	R-SMAD binding	IPI	9732876
GO:0071277	Process	Cellular response to calcium ion	IEA
GO:0072740	Process	Cellular response to anisomycin	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758
GO:0140296	Function	General transcription initiation factor binding	IPI	12676957
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:1902895	Process	Positive regulation of miRNA transcription	IMP	24375836
GO:1902895	Process	Positive regulation of miRNA transcription	ISS
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IMP	28701355
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000144	Process	Positive regulation of DNA-templated transcription initiation	IDA	23027619

MIM	HGNC	e!Ensembl
165160	6204	ENSG00000177606

P05412

Protein name

Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39)

Protein function

Transcription factor that recognizes and binds to the AP-1 consensus motif 5'-TGA[GC]TCA-3' (PubMed:10995748, PubMed:22083952). Heterodimerizes with proteins of the FOS family to form an AP-1 transcription complex, thereby enhancing its DNA bind

PDB

1A02 , 1FOS , 1JNM , 1JUN , 1S9K , 1T2K , 5FV8 , 5T01 , 6Y3V , 8SOS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03957	Jun	5 → 241	Jun-like transcription factor	Family
PF00170	bZIP_1	250 → 313	bZIP transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Expressed in the developing and adult prostate and prostate cancer cells. {ECO:0000269|PubMed:24263171, ECO:0000269|PubMed:24559171}.

Sequence

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Sequence length

331

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Breast neoplasm	Pathogenic	rs2524557470	RCV002285232	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (24)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, BASAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMANGIOSARCOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTESTINAL POLYPS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NERVOUS SYSTEM DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (383)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	22869147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16911523, 16951171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	18436711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16166335, 27323831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22869147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10845928, 22493372, 27600282, 30066853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	20826579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17712163, 8774439	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19162185, 24346217, 32437347, 38049398, 40363838, 8063812, 9880041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	15917097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	17518770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	28366453, 37488208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	16732325, 30311853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	21175428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	33318474	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21825040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	20488324, 30864718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	23523566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	19008257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	39766890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	20826579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30785199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	17626252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	31338093, 32840301, 7822331, 8660103, 9797555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11488985, 16452600, 31638834, 7500041, 7633872, 8541027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	39465738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	17971243	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	30572904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	11278277, 9830038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	22092038, 31330988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30785199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aural Atresia Congenital	Congenital aural atresia	Pubtator	19162185	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28824171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	17518770		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	22493372, 28233171		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	19064921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	1398227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	17702894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	31047984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25050631, 27588391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	25808168, 37310848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	17901229		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	10369069, 11891846, 14985464, 17458902, 17637753, 17672916, 20511396, 22004728, 22132731, 22828875, 23242121, 23813018, 24073962, 26965145, 28981843 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12072430, 15319452, 17846503, 19052522, 1906001, 19553068, 19687301, 20219890, 20339243, 20459645, 20482821, 20511396, 20554528, 21785467, 21860415 View all (20 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	40666524	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiolitis	Bronchiolitis	BEFREE	17703412, 21837802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11514621, 16520839, 17416736, 17686773, 18219112, 18923650, 18992165, 19435822, 21245048, 23922701, 24073962, 26581505, 28684765, 30488826, 30523154, 35263597, 37310848, 37779141 View all (3 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19758438, 25271301, 28502334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	23660123, 32319607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	14530285, 21862593, 23844083, 26718209, 26964667, 27431384, 27894081, 28323861, 30565389, 35414777, 36764493, 36941472, 37215991, 9030721	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25050631, 27588391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15517561, 16158054, 21847632, 23793869, 31162839, 9662339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28713952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31789394, 32596961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	30488826, 39354528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	19190345		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23942796, 27553367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	17626252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	11239196		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15514944, 21496227, 23682787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	10329043, 15514944, 21496227, 23682787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22869147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	26501139, 30305612, 30850583, 33431813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	27490694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	28789951		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chondrosarcoma	Chondrosarcoma	Pubtator	24472657, 25823818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29642064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19064921, 2113601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28602698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31569788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24118792, 28751935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	14712303, 15139522, 23210512, 30482246, 8631127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	12628520, 18283038		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	15754327, 16449643, 18032824	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16285957		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	14712303, 15806176, 16259733, 16361535, 17510314, 17689689, 21393476, 21418301, 22489574, 22851508, 27065323, 28381157, 30569725, 30591445, 30951563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12707033, 16343055, 17510524, 18534616, 18992165, 20460455, 22489574, 22870247, 23616010, 23693020, 23800415, 31217031, 31506433, 32408577, 32641980 View all (4 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23588207	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	28222755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	7984056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital bilateral aplasia of vas deferens	Congenital bilateral absence of vas deferens	Pubtator	32054096	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital ichthyosis	Congenital Ichthyosis	BEFREE	28526300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31550675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	28794385, 30961613, 31014396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	31014396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	39465738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	12223450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	30678730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21961038, 24566851, 26903440, 27147707, 28627596, 30081074, 30186872, 31572500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28409880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	11121152, 16354184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	11121152, 11912010, 24853951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	26251042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	26599598, 30012597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26599598, 30012597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	27240294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	18485515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	26599598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	30488826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27600282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	16050486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	21555589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	30709899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	24931237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	36197437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	11121152, 11912010, 24853951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalocele	Encephalocele	Pubtator	12384753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	24564526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11720885, 28502334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	10393530, 32083122, 8701784	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	19022561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	19074548, 24500404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	26394174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	17639289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Dystrophic epidermolysis bullosa	Pubtator	8143767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29399113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	19558549, 19758438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	19164283, 26858249, 33793074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	19558549, 19758438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	24796531	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	19164283, 24796531, 25915860, 27689325	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	28748534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	22832488	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	30768984, 31114367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29023819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	15319452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	12570660, 12753293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30778201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	29162878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	29693707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	14631383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	24706321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	9442092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	31371779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10885623, 11234878, 16849552, 19276385, 20467333, 30775317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11352915, 21245048, 24732116, 28036297, 30572904, 35538663, 36850002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10885623, 11234878, 11778649, 16849552, 19276385, 30572904, 30775317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	16303762, 24325785, 26418950, 27956703, 28036297, 30572904, 30927504, 32902145, 34887392, 34959221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	17235455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	18443593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	1712408, 39696012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	19482216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	7984056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	22554965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	21480395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	23455325, 9119742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	CTD_human_DG	17569031		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	28630090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	19608687, 37608082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	23809614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	36916737	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	23844083, 30565389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	17355264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	12145210, 12875982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	12145210, 30375407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	27600282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	30709899, 31330988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	11053476, 28478229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	21505178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20430007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	24039778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoglycemia	Hypoglycemia	Pubtator	9115218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	29670181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10212278, 11739718, 12737630, 12939282, 27486656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19794957, 25573199, 8910439	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyoses	Ichthyosis	BEFREE	28526300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis Vulgaris	Ichthyosis Vulgaris	BEFREE	28526300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	28424250	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30709904, 31025089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	32899090, 40294812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	28502334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28409880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	19403722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	23562910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	26439025, 29208967, 29286093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	32572902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	12384753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	27240294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Displacement	Intervertebral disc displacement	Pubtator	12384753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28834871, 29580816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	23064464, 24750504, 25961698, 25987255, 27600282, 28659618, 29588546, 29597249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	26860885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	28424250	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30659917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	31672701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	18692824	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10936867, 11226825, 19298651, 21702955, 22825467, 36899005, 8157646, 8348968	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	7592995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	1310062, 20227498, 2105946, 2122980, 2174893, 7521696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15911090, 19010914, 20376080, 20945381, 22096027, 23247046, 2477086, 31533028, 32635894, 36333583, 39251712	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19298651	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	26486083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12944913, 23247046, 26212328, 27840425, 29442453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	21828134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	10845928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	30459815		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	16732325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	19449367, 26336885, 29153098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	BEFREE	19449367, 26336885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12168099, 15927205, 16434963, 17543481, 18644981, 20044606, 21473287, 21862593, 24659263, 25230788, 25526895, 27215316, 28323861, 29731667, 31222831, 31293639, 31531018, 8390762 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15991283, 18644981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	20214788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	35338348, 37175814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	12127263, 24183702		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	BEFREE	28323861, 28692045		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	12424143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	14965369, 28618937, 35263597, 37192591, 40294812, 9671482	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	18644994	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	19018257		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	20716630		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28502334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22354960, 22489574, 30715676, 9822266	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15322221, 16224536, 21757709, 22489574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17130130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	18285351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36163022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	15507668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18494816, 23064464, 25533033, 29597249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	19937141, 25070240, 30375407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	18494816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	LHGDN	18494816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	29670082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	25734512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	21480395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	19396864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10369069, 14985464, 17407600, 17637753, 17672916, 20511396, 21384344, 22004728, 22132731, 22828875, 23242121, 23813018, 24073962, 26965145, 28981843 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	11720885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	19558549, 19758438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	12127263, 24183702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	18644981, 21225234, 27341307, 27894081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16158054, 21847632, 23793869, 26745678, 31162839, 9662339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	20716630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	19653276, 30459815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23942796, 27553367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19435822, 19887609, 21825040, 22109562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12727841, 16199533, 16272172, 16964758, 19787273, 21743958, 28241827, 28386843, 29758263, 31276688, 31387585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	17355264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20944126, 26279301, 30011079, 30425531, 31249448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	14602779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25050631, 27588391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10449779, 10924853, 16272172, 16652374, 16784822, 17213017, 17510397, 18362358, 18850008, 19057013, 19653276, 19850100, 20060892, 20338993, 21393476 View all (19 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15514944, 21496227, 23682787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	12628520, 18283038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	14712303, 15139522, 23210512, 30482246, 30650553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14654548, 15746191, 17637753, 17672916, 17914574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18519796, 24073962, 24345432, 27758885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	17951536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10318823, 10353757, 11557318, 14717848, 15492115, 16798740, 1712822, 17482134, 22832488, 25046326, 25793618, 25814555, 27050748, 31378787, 32134466, 35008862, 35926467 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11251188, 12939465, 15492260, 16116595, 21732343, 22797068, 23633675, 24315690, 26286024, 27045082, 27050748, 27479139, 29187213, 30614626, 31378787, 9824619 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	20374154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31645130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31085379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	20338993, 33097606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	16520839, 30488826, 32265484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	15467434, 17545547, 22276160, 26282073, 9639523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19837979, 27890927, 31284669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	10550297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	29807388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	22559819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	12573143, 1737349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	12700665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	31456916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	19158123, 9797757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	19860880, 24157866, 25958199, 28269757, 28672814, 31907338, 32641685, 33122398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23681229, 24157866, 25571870, 25958199, 29017171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10449779, 10673028, 11108661, 11358840, 11570575, 11991252, 12570660, 15554385, 16166335, 16412434, 17297470, 17363560, 17440073, 17846172, 1791843 View all (30 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12101231, 14617628, 40149013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16484283, 26734995, 2776489, 31303139, 9218873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	28366453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26445738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30012597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	29017171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24411941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	7984056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11788907, 28566434, 9662339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29023819, 30778201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	24265756, 28726785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	30488826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	12507586, 15498796, 32140068, 33097606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	30893847	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	31251836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29693149, 30661131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36626454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	17412493, 24025361, 8076631	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	CTD_human_DG	18645001		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	LHGDN	18708361, 18757369		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	27072870, 30001480, 8076631		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	23942796		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27553367, 7591243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10228559, 12637505, 12785726, 17434164, 24865582, 35351053, 37420173, 39954656, 9774447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19435822, 19887609, 21825040, 22109562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12963995, 16951171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19435822, 23727582, 30584464, 40305202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21196815	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28673327, 30704487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	29670181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	17686523		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peritoneal Fibrosis	Peritoneal fibrosis	Pubtator	12753293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	7984056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	16049073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	16049073, 22570239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	LHGDN	16049073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	27035648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	28603286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	31678370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12727841, 15486991, 16199533, 16272172, 16964758, 19787273, 21617851, 21743958, 28241827, 28386843, 29758263, 31276688, 31387585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	17702894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12963547, 16199533, 17634427, 19123467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17346688, 17634427, 23752183, 25483191, 27604827, 28394299, 30483762, 32414345, 38087324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	27215316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	15377346, 16385345, 28502334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	15654976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	1940437	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	7822331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	23559854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	28424250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22409248	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22413812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	22265050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23583295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	8649863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	1404666, 31550675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	23797008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	12359053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11037876, 26211509, 26362732, 27653023, 30809149, 8649863, 9153554, 9973520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	16586042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	34278468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	17418412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	14550555, 37599787, 39201282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	26850593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12799614, 15380860, 17849003		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	12799614, 15380860		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	28424250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	37773725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	16125115, 29406423, 29935173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	23637909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	39465738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	16443394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	31729200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	10713077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders Circadian Rhythm	Sleep disorder	Pubtator	20353996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	9092556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	24465924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Autosomal Recessive 2	Spinocerebellar ataxia	Pubtator	12775760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23633675, 28751006, 30452490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	18695873, 19758438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16520839, 19671684, 23455325, 24398980, 25945837, 28751006, 28790303, 30488826, 36163022, 9119742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	12393863, 20949447, 30860495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	7984056		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	7984056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29023819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20944126, 26279301, 30425531, 31249448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15069708, 15161022, 16474375, 16769709, 19371443, 20939893, 25875631, 26035356, 27078844, 27882939, 30683841, 31249448, 33435161, 35169855, 36171622	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	17355264		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18570890, 19020743		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	BEFREE	21515915, 22139817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	2115330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	14602779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	37675898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	24044365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	10598206, 14602779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	26581505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26792858, 27758885, 31931653, 35022313, 36969705, 37551997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31015574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	23809614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23922701, 27556506, 28358415, 31401412, 36045117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	18992165, 24796531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15308638, 15514944, 21937452, 22405256, 24481121, 33303976, 35831303, 8985358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28684765	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	26908399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	11889018, 31720303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	25726846	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

JUN (Jun proto-oncogene, AP-1 transcription factor subunit)