Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	1958
Gene name	Early growth response 1
Gene symbol	EGR1
Synonyms (NCBI Gene)	AT225G0S30KROX-24NGFI-ATIS8ZIF-268ZIF268ZNF225
Chromosome	5
Chromosome location	5q31.2
Summary	The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis

549

Show/Hide all (549)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004130	hsa-miR-192-5p	Microarray	16822819
MIRT006540	hsa-miR-183-5p	Luciferase reporter assay	21118966
MIRT006540	hsa-miR-183-5p	Luciferase reporter assay	21118966
MIRT023192	hsa-miR-124-3p	Microarray	18668037
MIRT024271	hsa-miR-215-5p	Microarray	19074876
MIRT004130	hsa-miR-192-5p	Microarray	19074876
MIRT054161	hsa-miR-191-5p	ImmunoprecipitationIn situ hybridizationLuciferase assayMicroarrayNorthern blotQRTPCRWestern blot	23505378
MIRT440745	hsa-miR-487a-3p	HITS-CLIP	24374217
MIRT440744	hsa-miR-377-3p	HITS-CLIP	24374217
MIRT440745	hsa-miR-487a-3p	HITS-CLIP	24374217
MIRT440744	hsa-miR-377-3p	HITS-CLIP	24374217
MIRT023192	hsa-miR-124-3p	Luciferase reporter assayWestern blot	27569005
MIRT736969	hsa-miR-92a-3p	Western blottingqRT-PCR	31545429
MIRT738417	hsa-miR-3684	HITS-CLIP	33718276
MIRT738419	hsa-miR-548s	HITS-CLIP	33718276
MIRT738420	hsa-miR-4701-5p	HITS-CLIP	33718276
MIRT738421	hsa-miR-4435	HITS-CLIP	33718276
MIRT738422	hsa-miR-3187-3p	HITS-CLIP	33718276
MIRT954924	hsa-miR-1207-5p	CLIP-seq
MIRT954925	hsa-miR-1261	CLIP-seq
MIRT954926	hsa-miR-1264	CLIP-seq
MIRT954927	hsa-miR-1288	CLIP-seq
MIRT954928	hsa-miR-129-5p	CLIP-seq
MIRT954929	hsa-miR-132	CLIP-seq
MIRT738400	hsa-miR-146a	CLIP-seq
MIRT738399	hsa-miR-146b-5p	CLIP-seq
MIRT954930	hsa-miR-183	CLIP-seq
MIRT954931	hsa-miR-1909	CLIP-seq
MIRT954932	hsa-miR-191	CLIP-seq
MIRT954933	hsa-miR-192	CLIP-seq
MIRT954934	hsa-miR-200b	CLIP-seq
MIRT954935	hsa-miR-200c	CLIP-seq
MIRT954936	hsa-miR-203	CLIP-seq
MIRT954937	hsa-miR-212	CLIP-seq
MIRT954938	hsa-miR-215	CLIP-seq
MIRT954939	hsa-miR-3064-3p	CLIP-seq
MIRT954940	hsa-miR-3119	CLIP-seq
MIRT954941	hsa-miR-3121-3p	CLIP-seq
MIRT954942	hsa-miR-3125	CLIP-seq
MIRT954943	hsa-miR-3136-3p	CLIP-seq
MIRT954944	hsa-miR-3183	CLIP-seq
MIRT954945	hsa-miR-3184	CLIP-seq
MIRT954946	hsa-miR-3185	CLIP-seq
MIRT954947	hsa-miR-3194-3p	CLIP-seq
MIRT954948	hsa-miR-3199	CLIP-seq
MIRT954949	hsa-miR-3202	CLIP-seq
MIRT954950	hsa-miR-3545-3p	CLIP-seq
MIRT954951	hsa-miR-3607-5p	CLIP-seq
MIRT954952	hsa-miR-3613-3p	CLIP-seq
MIRT954953	hsa-miR-361-3p	CLIP-seq
MIRT954954	hsa-miR-3679-3p	CLIP-seq
MIRT954955	hsa-miR-3914	CLIP-seq
MIRT954956	hsa-miR-3916	CLIP-seq
MIRT738404	hsa-miR-3921	CLIP-seq
MIRT954957	hsa-miR-3928	CLIP-seq
MIRT954958	hsa-miR-3942-3p	CLIP-seq
MIRT954959	hsa-miR-3973	CLIP-seq
MIRT954960	hsa-miR-423-5p	CLIP-seq
MIRT738401	hsa-miR-4251	CLIP-seq
MIRT954961	hsa-miR-4256	CLIP-seq
MIRT954962	hsa-miR-4269	CLIP-seq
MIRT954963	hsa-miR-4279	CLIP-seq
MIRT954964	hsa-miR-429	CLIP-seq
MIRT738402	hsa-miR-4329	CLIP-seq
MIRT954965	hsa-miR-4421	CLIP-seq
MIRT954966	hsa-miR-4436b-3p	CLIP-seq
MIRT954967	hsa-miR-4446-5p	CLIP-seq
MIRT954968	hsa-miR-4503	CLIP-seq
MIRT954969	hsa-miR-4511	CLIP-seq
MIRT954970	hsa-miR-4514	CLIP-seq
MIRT954971	hsa-miR-4529-5p	CLIP-seq
MIRT954972	hsa-miR-4533	CLIP-seq
MIRT954973	hsa-miR-4643	CLIP-seq
MIRT954974	hsa-miR-4649-3p	CLIP-seq
MIRT738403	hsa-miR-4653-5p	CLIP-seq
MIRT954975	hsa-miR-4667-3p	CLIP-seq
MIRT954976	hsa-miR-4668-3p	CLIP-seq
MIRT954977	hsa-miR-4687-3p	CLIP-seq
MIRT954978	hsa-miR-4692	CLIP-seq
MIRT954979	hsa-miR-4693-3p	CLIP-seq
MIRT954980	hsa-miR-4699-3p	CLIP-seq
MIRT954981	hsa-miR-4704-3p	CLIP-seq
MIRT954982	hsa-miR-4714-5p	CLIP-seq
MIRT954983	hsa-miR-4715-3p	CLIP-seq
MIRT954984	hsa-miR-4719	CLIP-seq
MIRT954985	hsa-miR-4723-3p	CLIP-seq
MIRT954986	hsa-miR-4731-3p	CLIP-seq
MIRT954987	hsa-miR-4733-5p	CLIP-seq
MIRT954988	hsa-miR-4742-5p	CLIP-seq
MIRT954989	hsa-miR-4763-3p	CLIP-seq
MIRT954990	hsa-miR-4775	CLIP-seq
MIRT954991	hsa-miR-4776-3p	CLIP-seq
MIRT954992	hsa-miR-4789-5p	CLIP-seq
MIRT954993	hsa-miR-4801	CLIP-seq
MIRT954994	hsa-miR-518a-3p	CLIP-seq
MIRT954995	hsa-miR-518b	CLIP-seq
MIRT954996	hsa-miR-518c	CLIP-seq
MIRT954997	hsa-miR-518d-3p	CLIP-seq
MIRT954998	hsa-miR-518f	CLIP-seq
MIRT954999	hsa-miR-520d-5p	CLIP-seq
MIRT955000	hsa-miR-524-5p	CLIP-seq
MIRT955001	hsa-miR-548a-5p	CLIP-seq
MIRT955002	hsa-miR-548ab	CLIP-seq
MIRT955003	hsa-miR-548ad	CLIP-seq
MIRT955004	hsa-miR-548ak	CLIP-seq
MIRT955005	hsa-miR-548b-5p	CLIP-seq
MIRT955006	hsa-miR-548c-5p	CLIP-seq
MIRT955007	hsa-miR-548d-5p	CLIP-seq
MIRT955008	hsa-miR-548h	CLIP-seq
MIRT955009	hsa-miR-548i	CLIP-seq
MIRT955010	hsa-miR-548j	CLIP-seq
MIRT955011	hsa-miR-548w	CLIP-seq
MIRT955012	hsa-miR-548y	CLIP-seq
MIRT955013	hsa-miR-559	CLIP-seq
MIRT955014	hsa-miR-580	CLIP-seq
MIRT955015	hsa-miR-581	CLIP-seq
MIRT738398	hsa-miR-589	CLIP-seq
MIRT955016	hsa-miR-590-3p	CLIP-seq
MIRT955017	hsa-miR-607	CLIP-seq
MIRT955018	hsa-miR-624	CLIP-seq
MIRT955019	hsa-miR-642b	CLIP-seq
MIRT738405	hsa-miR-760	CLIP-seq
MIRT955020	hsa-miR-877	CLIP-seq
MIRT955021	hsa-miR-9	CLIP-seq
MIRT955022	hsa-miR-935	CLIP-seq
MIRT954980	hsa-miR-4699-3p	CLIP-seq
MIRT954999	hsa-miR-520d-5p	CLIP-seq
MIRT955000	hsa-miR-524-5p	CLIP-seq
MIRT1982812	hsa-miR-1179	CLIP-seq
MIRT954924	hsa-miR-1207-5p	CLIP-seq
MIRT1982813	hsa-miR-1236	CLIP-seq
MIRT954926	hsa-miR-1264	CLIP-seq
MIRT1982814	hsa-miR-1270	CLIP-seq
MIRT1982815	hsa-miR-1272	CLIP-seq
MIRT954927	hsa-miR-1288	CLIP-seq
MIRT954928	hsa-miR-129-5p	CLIP-seq
MIRT954929	hsa-miR-132	CLIP-seq
MIRT1982816	hsa-miR-1322	CLIP-seq
MIRT1982817	hsa-miR-143	CLIP-seq
MIRT1982818	hsa-miR-150	CLIP-seq
MIRT954930	hsa-miR-183	CLIP-seq
MIRT954931	hsa-miR-1909	CLIP-seq
MIRT954932	hsa-miR-191	CLIP-seq
MIRT954934	hsa-miR-200b	CLIP-seq
MIRT954935	hsa-miR-200c	CLIP-seq
MIRT954936	hsa-miR-203	CLIP-seq
MIRT1982819	hsa-miR-2110	CLIP-seq
MIRT954937	hsa-miR-212	CLIP-seq
MIRT1982820	hsa-miR-217	CLIP-seq
MIRT1982821	hsa-miR-25	CLIP-seq
MIRT954939	hsa-miR-3064-3p	CLIP-seq
MIRT954941	hsa-miR-3121-3p	CLIP-seq
MIRT954942	hsa-miR-3125	CLIP-seq
MIRT1982822	hsa-miR-3134	CLIP-seq
MIRT954943	hsa-miR-3136-3p	CLIP-seq
MIRT1982823	hsa-miR-3140-5p	CLIP-seq
MIRT1982824	hsa-miR-3150a-3p	CLIP-seq
MIRT1982825	hsa-miR-3179	CLIP-seq
MIRT954944	hsa-miR-3183	CLIP-seq
MIRT954945	hsa-miR-3184	CLIP-seq
MIRT954947	hsa-miR-3194-3p	CLIP-seq
MIRT954948	hsa-miR-3199	CLIP-seq
MIRT1982826	hsa-miR-32	CLIP-seq
MIRT954949	hsa-miR-3202	CLIP-seq
MIRT954950	hsa-miR-3545-3p	CLIP-seq
MIRT954951	hsa-miR-3607-5p	CLIP-seq
MIRT954952	hsa-miR-3613-3p	CLIP-seq
MIRT954953	hsa-miR-361-3p	CLIP-seq
MIRT1982827	hsa-miR-363	CLIP-seq
MIRT1982828	hsa-miR-3660	CLIP-seq
MIRT1982829	hsa-miR-367	CLIP-seq
MIRT1982830	hsa-miR-3682-3p	CLIP-seq
MIRT1982831	hsa-miR-377	CLIP-seq
MIRT954955	hsa-miR-3914	CLIP-seq
MIRT954956	hsa-miR-3916	CLIP-seq
MIRT738404	hsa-miR-3921	CLIP-seq
MIRT954957	hsa-miR-3928	CLIP-seq
MIRT1982832	hsa-miR-3936	CLIP-seq
MIRT954959	hsa-miR-3973	CLIP-seq
MIRT954960	hsa-miR-423-5p	CLIP-seq
MIRT738401	hsa-miR-4251	CLIP-seq
MIRT954962	hsa-miR-4269	CLIP-seq
MIRT1982833	hsa-miR-4271	CLIP-seq
MIRT954963	hsa-miR-4279	CLIP-seq
MIRT954964	hsa-miR-429	CLIP-seq
MIRT738402	hsa-miR-4329	CLIP-seq
MIRT954965	hsa-miR-4421	CLIP-seq
MIRT1982834	hsa-miR-4427	CLIP-seq
MIRT954966	hsa-miR-4436b-3p	CLIP-seq
MIRT738424	hsa-miR-4445	CLIP-seq
MIRT954968	hsa-miR-4503	CLIP-seq
MIRT954970	hsa-miR-4514	CLIP-seq
MIRT1982835	hsa-miR-4526	CLIP-seq
MIRT954971	hsa-miR-4529-5p	CLIP-seq
MIRT954972	hsa-miR-4533	CLIP-seq
MIRT1982836	hsa-miR-4534	CLIP-seq
MIRT954973	hsa-miR-4643	CLIP-seq
MIRT954974	hsa-miR-4649-3p	CLIP-seq
MIRT738403	hsa-miR-4653-5p	CLIP-seq
MIRT954975	hsa-miR-4667-3p	CLIP-seq
MIRT954976	hsa-miR-4668-3p	CLIP-seq
MIRT1982837	hsa-miR-4683	CLIP-seq
MIRT954977	hsa-miR-4687-3p	CLIP-seq
MIRT1982838	hsa-miR-4687-5p	CLIP-seq
MIRT1982839	hsa-miR-4690-3p	CLIP-seq
MIRT954978	hsa-miR-4692	CLIP-seq
MIRT954979	hsa-miR-4693-3p	CLIP-seq
MIRT954980	hsa-miR-4699-3p	CLIP-seq
MIRT954981	hsa-miR-4704-3p	CLIP-seq
MIRT1982840	hsa-miR-4708-3p	CLIP-seq
MIRT954984	hsa-miR-4719	CLIP-seq
MIRT954985	hsa-miR-4723-3p	CLIP-seq
MIRT1982841	hsa-miR-4724-5p	CLIP-seq
MIRT1982842	hsa-miR-4725-3p	CLIP-seq
MIRT954986	hsa-miR-4731-3p	CLIP-seq
MIRT954987	hsa-miR-4733-5p	CLIP-seq
MIRT954988	hsa-miR-4742-5p	CLIP-seq
MIRT1982843	hsa-miR-4747-5p	CLIP-seq
MIRT954989	hsa-miR-4763-3p	CLIP-seq
MIRT1982844	hsa-miR-4770	CLIP-seq
MIRT954991	hsa-miR-4776-3p	CLIP-seq
MIRT1982845	hsa-miR-4795-5p	CLIP-seq
MIRT954993	hsa-miR-4801	CLIP-seq
MIRT954994	hsa-miR-518a-3p	CLIP-seq
MIRT954995	hsa-miR-518b	CLIP-seq
MIRT954996	hsa-miR-518c	CLIP-seq
MIRT954997	hsa-miR-518d-3p	CLIP-seq
MIRT954998	hsa-miR-518f	CLIP-seq
MIRT954999	hsa-miR-520d-5p	CLIP-seq
MIRT1982846	hsa-miR-524-3p	CLIP-seq
MIRT955000	hsa-miR-524-5p	CLIP-seq
MIRT1982847	hsa-miR-525-3p	CLIP-seq
MIRT1982848	hsa-miR-543	CLIP-seq
MIRT1982849	hsa-miR-545	CLIP-seq
MIRT955001	hsa-miR-548a-5p	CLIP-seq
MIRT955002	hsa-miR-548ab	CLIP-seq
MIRT955004	hsa-miR-548ak	CLIP-seq
MIRT955005	hsa-miR-548b-5p	CLIP-seq
MIRT955006	hsa-miR-548c-5p	CLIP-seq
MIRT955007	hsa-miR-548d-5p	CLIP-seq
MIRT955008	hsa-miR-548h	CLIP-seq
MIRT955009	hsa-miR-548i	CLIP-seq
MIRT955010	hsa-miR-548j	CLIP-seq
MIRT955011	hsa-miR-548w	CLIP-seq
MIRT955012	hsa-miR-548y	CLIP-seq
MIRT955013	hsa-miR-559	CLIP-seq
MIRT955014	hsa-miR-580	CLIP-seq
MIRT955015	hsa-miR-581	CLIP-seq
MIRT1982850	hsa-miR-606	CLIP-seq
MIRT955017	hsa-miR-607	CLIP-seq
MIRT1982851	hsa-miR-620	CLIP-seq
MIRT955018	hsa-miR-624	CLIP-seq
MIRT955019	hsa-miR-642b	CLIP-seq
MIRT738405	hsa-miR-760	CLIP-seq
MIRT955020	hsa-miR-877	CLIP-seq
MIRT1982852	hsa-miR-92a	CLIP-seq
MIRT1982853	hsa-miR-92b	CLIP-seq
MIRT1982812	hsa-miR-1179	CLIP-seq
MIRT954924	hsa-miR-1207-5p	CLIP-seq
MIRT2217814	hsa-miR-124	CLIP-seq
MIRT954925	hsa-miR-1261	CLIP-seq
MIRT954927	hsa-miR-1288	CLIP-seq
MIRT954929	hsa-miR-132	CLIP-seq
MIRT738400	hsa-miR-146a	CLIP-seq
MIRT738399	hsa-miR-146b-5p	CLIP-seq
MIRT1982818	hsa-miR-150	CLIP-seq
MIRT954930	hsa-miR-183	CLIP-seq
MIRT954931	hsa-miR-1909	CLIP-seq
MIRT954932	hsa-miR-191	CLIP-seq
MIRT2217815	hsa-miR-1911	CLIP-seq
MIRT2217816	hsa-miR-1913	CLIP-seq
MIRT954933	hsa-miR-192	CLIP-seq
MIRT954934	hsa-miR-200b	CLIP-seq
MIRT954935	hsa-miR-200c	CLIP-seq
MIRT954937	hsa-miR-212	CLIP-seq
MIRT954938	hsa-miR-215	CLIP-seq
MIRT2217817	hsa-miR-23a	CLIP-seq
MIRT2217818	hsa-miR-23b	CLIP-seq
MIRT2217819	hsa-miR-23c	CLIP-seq
MIRT1982821	hsa-miR-25	CLIP-seq
MIRT954939	hsa-miR-3064-3p	CLIP-seq
MIRT954940	hsa-miR-3119	CLIP-seq
MIRT954941	hsa-miR-3121-3p	CLIP-seq
MIRT954942	hsa-miR-3125	CLIP-seq
MIRT954943	hsa-miR-3136-3p	CLIP-seq
MIRT1982825	hsa-miR-3179	CLIP-seq
MIRT954945	hsa-miR-3184	CLIP-seq
MIRT954947	hsa-miR-3194-3p	CLIP-seq
MIRT954948	hsa-miR-3199	CLIP-seq
MIRT1982826	hsa-miR-32	CLIP-seq
MIRT2217820	hsa-miR-324-3p	CLIP-seq
MIRT2217821	hsa-miR-335	CLIP-seq
MIRT954951	hsa-miR-3607-5p	CLIP-seq
MIRT954952	hsa-miR-3613-3p	CLIP-seq
MIRT954953	hsa-miR-361-3p	CLIP-seq
MIRT1982827	hsa-miR-363	CLIP-seq
MIRT1982828	hsa-miR-3660	CLIP-seq
MIRT1982829	hsa-miR-367	CLIP-seq
MIRT1982831	hsa-miR-377	CLIP-seq
MIRT954955	hsa-miR-3914	CLIP-seq
MIRT954956	hsa-miR-3916	CLIP-seq
MIRT738404	hsa-miR-3921	CLIP-seq
MIRT738418	hsa-miR-3926	CLIP-seq
MIRT954957	hsa-miR-3928	CLIP-seq
MIRT1982832	hsa-miR-3936	CLIP-seq
MIRT2217822	hsa-miR-412	CLIP-seq
MIRT954960	hsa-miR-423-5p	CLIP-seq
MIRT738401	hsa-miR-4251	CLIP-seq
MIRT954961	hsa-miR-4256	CLIP-seq
MIRT954962	hsa-miR-4269	CLIP-seq
MIRT954964	hsa-miR-429	CLIP-seq
MIRT2217823	hsa-miR-4313	CLIP-seq
MIRT738402	hsa-miR-4329	CLIP-seq
MIRT954966	hsa-miR-4436b-3p	CLIP-seq
MIRT738424	hsa-miR-4445	CLIP-seq
MIRT954970	hsa-miR-4514	CLIP-seq
MIRT1982835	hsa-miR-4526	CLIP-seq
MIRT954973	hsa-miR-4643	CLIP-seq
MIRT954974	hsa-miR-4649-3p	CLIP-seq
MIRT738403	hsa-miR-4653-5p	CLIP-seq
MIRT954976	hsa-miR-4668-3p	CLIP-seq
MIRT954978	hsa-miR-4692	CLIP-seq
MIRT954979	hsa-miR-4693-3p	CLIP-seq
MIRT954980	hsa-miR-4699-3p	CLIP-seq
MIRT954981	hsa-miR-4704-3p	CLIP-seq
MIRT1982840	hsa-miR-4708-3p	CLIP-seq
MIRT954982	hsa-miR-4714-5p	CLIP-seq
MIRT954984	hsa-miR-4719	CLIP-seq
MIRT954987	hsa-miR-4733-5p	CLIP-seq
MIRT954988	hsa-miR-4742-5p	CLIP-seq
MIRT954989	hsa-miR-4763-3p	CLIP-seq
MIRT954991	hsa-miR-4776-3p	CLIP-seq
MIRT954992	hsa-miR-4789-5p	CLIP-seq
MIRT2217824	hsa-miR-4792	CLIP-seq
MIRT2217825	hsa-miR-483-3p	CLIP-seq
MIRT2217826	hsa-miR-506	CLIP-seq
MIRT954994	hsa-miR-518a-3p	CLIP-seq
MIRT954995	hsa-miR-518b	CLIP-seq
MIRT954996	hsa-miR-518c	CLIP-seq
MIRT954997	hsa-miR-518d-3p	CLIP-seq
MIRT954998	hsa-miR-518f	CLIP-seq
MIRT954999	hsa-miR-520d-5p	CLIP-seq
MIRT1982846	hsa-miR-524-3p	CLIP-seq
MIRT955000	hsa-miR-524-5p	CLIP-seq
MIRT1982847	hsa-miR-525-3p	CLIP-seq
MIRT1982849	hsa-miR-545	CLIP-seq
MIRT955003	hsa-miR-548ad	CLIP-seq
MIRT2217827	hsa-miR-548an	CLIP-seq
MIRT955014	hsa-miR-580	CLIP-seq
MIRT738423	hsa-miR-588	CLIP-seq
MIRT738398	hsa-miR-589	CLIP-seq
MIRT955017	hsa-miR-607	CLIP-seq
MIRT955018	hsa-miR-624	CLIP-seq
MIRT955019	hsa-miR-642b	CLIP-seq
MIRT738405	hsa-miR-760	CLIP-seq
MIRT955020	hsa-miR-877	CLIP-seq
MIRT955021	hsa-miR-9	CLIP-seq
MIRT1982852	hsa-miR-92a	CLIP-seq
MIRT1982853	hsa-miR-92b	CLIP-seq
MIRT955022	hsa-miR-935	CLIP-seq
MIRT954924	hsa-miR-1207-5p	CLIP-seq
MIRT954927	hsa-miR-1288	CLIP-seq
MIRT954931	hsa-miR-1909	CLIP-seq
MIRT954934	hsa-miR-200b	CLIP-seq
MIRT954935	hsa-miR-200c	CLIP-seq
MIRT1982821	hsa-miR-25	CLIP-seq
MIRT954943	hsa-miR-3136-3p	CLIP-seq
MIRT954945	hsa-miR-3184	CLIP-seq
MIRT954947	hsa-miR-3194-3p	CLIP-seq
MIRT954948	hsa-miR-3199	CLIP-seq
MIRT1982826	hsa-miR-32	CLIP-seq
MIRT954952	hsa-miR-3613-3p	CLIP-seq
MIRT1982827	hsa-miR-363	CLIP-seq
MIRT1982829	hsa-miR-367	CLIP-seq
MIRT738404	hsa-miR-3921	CLIP-seq
MIRT954960	hsa-miR-423-5p	CLIP-seq
MIRT738401	hsa-miR-4251	CLIP-seq
MIRT954964	hsa-miR-429	CLIP-seq
MIRT738402	hsa-miR-4329	CLIP-seq
MIRT954966	hsa-miR-4436b-3p	CLIP-seq
MIRT954973	hsa-miR-4643	CLIP-seq
MIRT954974	hsa-miR-4649-3p	CLIP-seq
MIRT738403	hsa-miR-4653-5p	CLIP-seq
MIRT1982840	hsa-miR-4708-3p	CLIP-seq
MIRT954989	hsa-miR-4763-3p	CLIP-seq
MIRT1982846	hsa-miR-524-3p	CLIP-seq
MIRT1982847	hsa-miR-525-3p	CLIP-seq
MIRT1982849	hsa-miR-545	CLIP-seq
MIRT955014	hsa-miR-580	CLIP-seq
MIRT955017	hsa-miR-607	CLIP-seq
MIRT955018	hsa-miR-624	CLIP-seq
MIRT955019	hsa-miR-642b	CLIP-seq
MIRT738405	hsa-miR-760	CLIP-seq
MIRT1982852	hsa-miR-92a	CLIP-seq
MIRT1982853	hsa-miR-92b	CLIP-seq
MIRT2428423	hsa-miR-199a-3p	CLIP-seq
MIRT2428424	hsa-miR-199b-3p	CLIP-seq
MIRT2428425	hsa-miR-3129-5p	CLIP-seq
MIRT954946	hsa-miR-3185	CLIP-seq
MIRT954962	hsa-miR-4269	CLIP-seq
MIRT954968	hsa-miR-4503	CLIP-seq
MIRT954969	hsa-miR-4511	CLIP-seq
MIRT954970	hsa-miR-4514	CLIP-seq
MIRT2428426	hsa-miR-4520a-3p	CLIP-seq
MIRT2428427	hsa-miR-4520b-3p	CLIP-seq
MIRT954977	hsa-miR-4687-3p	CLIP-seq
MIRT954978	hsa-miR-4692	CLIP-seq
MIRT954986	hsa-miR-4731-3p	CLIP-seq
MIRT954988	hsa-miR-4742-5p	CLIP-seq
MIRT2428428	hsa-miR-4797-3p	CLIP-seq
MIRT954993	hsa-miR-4801	CLIP-seq
MIRT2428429	hsa-miR-510	CLIP-seq
MIRT2428430	hsa-miR-512-5p	CLIP-seq
MIRT1982848	hsa-miR-543	CLIP-seq
MIRT2428431	hsa-miR-548c-3p	CLIP-seq
MIRT1982850	hsa-miR-606	CLIP-seq
MIRT2428432	hsa-miR-890	CLIP-seq
MIRT738411	hsa-miR-936	CLIP-seq
MIRT954924	hsa-miR-1207-5p	CLIP-seq
MIRT2436927	hsa-miR-1224-5p	CLIP-seq
MIRT2436928	hsa-miR-1273e	CLIP-seq
MIRT954927	hsa-miR-1288	CLIP-seq
MIRT738406	hsa-miR-1321	CLIP-seq
MIRT738400	hsa-miR-146a	CLIP-seq
MIRT738399	hsa-miR-146b-5p	CLIP-seq
MIRT954931	hsa-miR-1909	CLIP-seq
MIRT954934	hsa-miR-200b	CLIP-seq
MIRT954935	hsa-miR-200c	CLIP-seq
MIRT1982819	hsa-miR-2110	CLIP-seq
MIRT954940	hsa-miR-3119	CLIP-seq
MIRT954941	hsa-miR-3121-3p	CLIP-seq
MIRT954942	hsa-miR-3125	CLIP-seq
MIRT954943	hsa-miR-3136-3p	CLIP-seq
MIRT2436929	hsa-miR-3145-5p	CLIP-seq
MIRT1982824	hsa-miR-3150a-3p	CLIP-seq
MIRT1982825	hsa-miR-3179	CLIP-seq
MIRT954945	hsa-miR-3184	CLIP-seq
MIRT954947	hsa-miR-3194-3p	CLIP-seq
MIRT954948	hsa-miR-3199	CLIP-seq
MIRT954949	hsa-miR-3202	CLIP-seq
MIRT2436930	hsa-miR-338-5p	CLIP-seq
MIRT954953	hsa-miR-361-3p	CLIP-seq
MIRT954954	hsa-miR-3679-3p	CLIP-seq
MIRT2436931	hsa-miR-369-3p	CLIP-seq
MIRT2436932	hsa-miR-374c	CLIP-seq
MIRT954956	hsa-miR-3916	CLIP-seq
MIRT738404	hsa-miR-3921	CLIP-seq
MIRT738414	hsa-miR-3925-3p	CLIP-seq
MIRT738418	hsa-miR-3926	CLIP-seq
MIRT954960	hsa-miR-423-5p	CLIP-seq
MIRT738401	hsa-miR-4251	CLIP-seq
MIRT1982833	hsa-miR-4271	CLIP-seq
MIRT954964	hsa-miR-429	CLIP-seq
MIRT738402	hsa-miR-4329	CLIP-seq
MIRT738410	hsa-miR-4419a	CLIP-seq
MIRT954966	hsa-miR-4436b-3p	CLIP-seq
MIRT738416	hsa-miR-4436b-5p	CLIP-seq
MIRT738424	hsa-miR-4445	CLIP-seq
MIRT954967	hsa-miR-4446-5p	CLIP-seq
MIRT738409	hsa-miR-4510	CLIP-seq
MIRT954973	hsa-miR-4643	CLIP-seq
MIRT954974	hsa-miR-4649-3p	CLIP-seq
MIRT738403	hsa-miR-4653-5p	CLIP-seq
MIRT2436933	hsa-miR-4666-3p	CLIP-seq
MIRT738412	hsa-miR-4712-5p	CLIP-seq
MIRT954984	hsa-miR-4719	CLIP-seq
MIRT1982842	hsa-miR-4725-3p	CLIP-seq
MIRT738407	hsa-miR-4739	CLIP-seq
MIRT1982843	hsa-miR-4747-5p	CLIP-seq
MIRT2436934	hsa-miR-4751	CLIP-seq
MIRT738408	hsa-miR-4756-5p	CLIP-seq
MIRT954989	hsa-miR-4763-3p	CLIP-seq
MIRT2436935	hsa-miR-4764-3p	CLIP-seq
MIRT954991	hsa-miR-4776-3p	CLIP-seq
MIRT1982845	hsa-miR-4795-5p	CLIP-seq
MIRT738415	hsa-miR-508-5p	CLIP-seq
MIRT955014	hsa-miR-580	CLIP-seq
MIRT738423	hsa-miR-588	CLIP-seq
MIRT738398	hsa-miR-589	CLIP-seq
MIRT955018	hsa-miR-624	CLIP-seq
MIRT955019	hsa-miR-642b	CLIP-seq
MIRT2436936	hsa-miR-655	CLIP-seq
MIRT738405	hsa-miR-760	CLIP-seq
MIRT738413	hsa-miR-770-5p	CLIP-seq
MIRT955020	hsa-miR-877	CLIP-seq
MIRT738411	hsa-miR-936	CLIP-seq
MIRT1982812	hsa-miR-1179	CLIP-seq
MIRT954924	hsa-miR-1207-5p	CLIP-seq
MIRT954927	hsa-miR-1288	CLIP-seq
MIRT954931	hsa-miR-1909	CLIP-seq
MIRT954934	hsa-miR-200b	CLIP-seq
MIRT954935	hsa-miR-200c	CLIP-seq
MIRT954941	hsa-miR-3121-3p	CLIP-seq
MIRT954942	hsa-miR-3125	CLIP-seq
MIRT954943	hsa-miR-3136-3p	CLIP-seq
MIRT1982825	hsa-miR-3179	CLIP-seq
MIRT954945	hsa-miR-3184	CLIP-seq
MIRT954947	hsa-miR-3194-3p	CLIP-seq
MIRT954948	hsa-miR-3199	CLIP-seq
MIRT954952	hsa-miR-3613-3p	CLIP-seq
MIRT954956	hsa-miR-3916	CLIP-seq
MIRT738404	hsa-miR-3921	CLIP-seq
MIRT1982832	hsa-miR-3936	CLIP-seq
MIRT954960	hsa-miR-423-5p	CLIP-seq
MIRT738401	hsa-miR-4251	CLIP-seq
MIRT954962	hsa-miR-4269	CLIP-seq
MIRT954964	hsa-miR-429	CLIP-seq
MIRT738402	hsa-miR-4329	CLIP-seq
MIRT954966	hsa-miR-4436b-3p	CLIP-seq
MIRT954970	hsa-miR-4514	CLIP-seq
MIRT954973	hsa-miR-4643	CLIP-seq
MIRT954974	hsa-miR-4649-3p	CLIP-seq
MIRT738403	hsa-miR-4653-5p	CLIP-seq
MIRT954978	hsa-miR-4692	CLIP-seq
MIRT954984	hsa-miR-4719	CLIP-seq
MIRT954988	hsa-miR-4742-5p	CLIP-seq
MIRT954989	hsa-miR-4763-3p	CLIP-seq
MIRT954991	hsa-miR-4776-3p	CLIP-seq
MIRT955014	hsa-miR-580	CLIP-seq
MIRT955017	hsa-miR-607	CLIP-seq
MIRT955018	hsa-miR-624	CLIP-seq
MIRT955019	hsa-miR-642b	CLIP-seq
MIRT738405	hsa-miR-760	CLIP-seq
MIRT955020	hsa-miR-877	CLIP-seq
MIRT954924	hsa-miR-1207-5p	CLIP-seq
MIRT954927	hsa-miR-1288	CLIP-seq
MIRT954931	hsa-miR-1909	CLIP-seq
MIRT954934	hsa-miR-200b	CLIP-seq
MIRT954935	hsa-miR-200c	CLIP-seq
MIRT954943	hsa-miR-3136-3p	CLIP-seq
MIRT954945	hsa-miR-3184	CLIP-seq
MIRT954947	hsa-miR-3194-3p	CLIP-seq
MIRT954948	hsa-miR-3199	CLIP-seq
MIRT954952	hsa-miR-3613-3p	CLIP-seq
MIRT738404	hsa-miR-3921	CLIP-seq
MIRT954960	hsa-miR-423-5p	CLIP-seq
MIRT738401	hsa-miR-4251	CLIP-seq
MIRT954964	hsa-miR-429	CLIP-seq
MIRT738402	hsa-miR-4329	CLIP-seq
MIRT954966	hsa-miR-4436b-3p	CLIP-seq
MIRT954973	hsa-miR-4643	CLIP-seq
MIRT954974	hsa-miR-4649-3p	CLIP-seq
MIRT738403	hsa-miR-4653-5p	CLIP-seq
MIRT954989	hsa-miR-4763-3p	CLIP-seq
MIRT955014	hsa-miR-580	CLIP-seq
MIRT955017	hsa-miR-607	CLIP-seq
MIRT955018	hsa-miR-624	CLIP-seq
MIRT955019	hsa-miR-642b	CLIP-seq
MIRT738405	hsa-miR-760	CLIP-seq

Show/Hide all (15)

Transcription factor	Regulation	Reference
ATF5	Unknown	19531563
BRCA1	Unknown	20103632
ETS1	Activation	19074849
ETS1	Unknown	9207063
ETS2	Unknown	9207063
FOXO1	Repression	22865884
HDAC1	Repression	21983014
MAML1	Activation	23029358
NFKB1	Repression	21983014
NKX2-3	Unknown	21968973
RBMX	Repression	16707624
RELA	Repression	21983014
SP1	Activation	8349585
SP1	Unknown	10826704
TP53	Unknown	16990849

Show/Hide all (90)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IDA	19307576
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	18718911
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	14979875
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19307576, 20018936
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	19307576, 20018936
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001666	Process	Response to hypoxia	ISS
GO:0002931	Process	Response to ischemia	IEA
GO:0002931	Process	Response to ischemia	ISS
GO:0003677	Function	DNA binding	IDA	12560508
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	12560508
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	19057511, 21743491
GO:0005634	Component	Nucleus	IDA	19057511, 20018936, 20363028
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	19057511, 20363028
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0008270	Function	Zinc ion binding	IDA	25258363
GO:0008270	Function	Zinc ion binding	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0010385	Function	Double-stranded methylated DNA binding	IDA	25258363
GO:0010628	Process	Positive regulation of gene expression	IMP	24244514
GO:0019899	Function	Enzyme binding	IEA
GO:0030217	Process	T cell differentiation	IEA
GO:0030509	Process	BMP signaling pathway	IEA
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032722	Process	Positive regulation of chemokine production	ISS
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032868	Process	Response to insulin	IEA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0033233	Process	Regulation of protein sumoylation	IDA	19057511
GO:0035035	Function	Histone acetyltransferase binding	IPI	20018936
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043523	Process	Regulation of neuron apoptotic process	IEA
GO:0043523	Process	Regulation of neuron apoptotic process	ISS
GO:0043565	Function	Sequence-specific DNA binding	IDA	1662794, 25258363
GO:0044029	Process	Positive regulation of gene expression via chromosomal CpG island demethylation	IEA
GO:0044029	Process	Positive regulation of gene expression via chromosomal CpG island demethylation	ISS	31467272
GO:0044729	Function	Hemi-methylated DNA-binding	IDA	25258363
GO:0044849	Process	Estrous cycle	IEA
GO:0044849	Process	Estrous cycle	ISS
GO:0045475	Process	Locomotor rhythm	IEA
GO:0045475	Process	Locomotor rhythm	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	12560508
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19057511, 26089202
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	14979875
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	14979875, 20018936
GO:0046872	Function	Metal ion binding	IEA
GO:0046886	Process	Positive regulation of hormone biosynthetic process	IEA
GO:0046886	Process	Positive regulation of hormone biosynthetic process	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0060086	Process	Circadian temperature homeostasis	IEA
GO:0060086	Process	Circadian temperature homeostasis	ISS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IMP	20018936
GO:0071480	Process	Cellular response to gamma radiation	IEA
GO:0071504	Process	Cellular response to heparin	ISS
GO:0071506	Process	Cellular response to mycophenolic acid	ISS
GO:0072110	Process	Glomerular mesangial cell proliferation	ISS
GO:0072303	Process	Positive regulation of glomerular metanephric mesangial cell proliferation	ISS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0098759	Process	Cellular response to interleukin-8	IDA	20363028
GO:1901875	Process	Positive regulation of post-translational protein modification	IMP	20018936
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	19307576
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990841	Function	Promoter-specific chromatin binding	IDA	20363028
GO:2000182	Process	Regulation of progesterone biosynthetic process	IEA
GO:2000182	Process	Regulation of progesterone biosynthetic process	ISS

MIM	HGNC	e!Ensembl
128990	3238	ENSG00000120738

P18146

Protein name

Early growth response protein 1 (EGR-1) (AT225) (Nerve growth factor-induced protein A) (NGFI-A) (Transcription factor ETR103) (Transcription factor Zif268) (Zinc finger protein 225) (Zinc finger protein Krox-24)

Protein function

Transcriptional regulator (PubMed:20121949). Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'(EGR-site) in the promoter region of target genes (By similarity). Binds double-stranded target DNA, irrespective of the cytosine methylatio

PDB

4R2A , 4R2C , 4R2D , 4X9J , 5N14

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11928	DUF3446	135 → 219	Early growth response N-terminal domain	Domain
PF00096	zf-C2H2	338 → 362	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	368 → 390	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	396 → 418	Zinc finger, C2H2 type	Domain
PF11914	DUF3432	424 → 462	Domain of unknown function (DUF3432)	Repeat
PF11914	DUF3432	452 → 530	Domain of unknown function (DUF3432)	Repeat

Tissue specificity

TISSUE SPECIFICITY: Detected in neutrophils (at protein level). {ECO:0000269|PubMed:20363028}.

Sequence

MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGS
NSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETS
YPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAAS
SASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAY
PAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG
SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR
IHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSS
TYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTI
EIC

Sequence length

543

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLANGITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, INTRAHEPATIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYDRONEPHROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOXIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRAHEPATIC CHOLESTASIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (376)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
5q-syndrome	5q-syndrome	BEFREE	11325642, 19608274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	28407684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	20690147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	31521893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	31545429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	11734301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	16601242, 20489156, 21166939, 9622090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16227405, 20489156, 24842518, 31698633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	11707452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	31521893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	23592216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	28881635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	19833116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	15743889, 20405009, 33920138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	18525291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	25815723, 28641077, 30548663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29241710		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	BEFREE	24264229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	17156400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Macrocytic	Anemia	BEFREE	24264229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	20448047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	26134032	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27363020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	26113112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	LHGDN	19245972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29977360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	12890669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	39766890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10712437, 10794543, 11597989, 11676978, 16456111, 22999639, 24186862, 26577385, 28105751, 28460186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	12507899	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15142264, 36238290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	29487594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	15003938, 18507785, 24012056, 27188427		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	18774390, 24012056, 33878997, 35751199	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	18489490, 20414733, 7775459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	18489490, 35746681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10712437, 10794543, 11597989, 11676978, 16456111, 22999639, 24186862, 26577385, 28105751, 28460186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10982796, 17967787, 18682391, 31875420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	36646776	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24106272		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	CTD_human_DG	25055964		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23363221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	20543560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15709168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Beta ketothiolase deficiency	Beta-ketothiolase deficiency	Pubtator	19878561	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	25658856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar I disorder	Bipolar Disorder	BEFREE	22370066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	19878561, 28521108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	30925677, 37488639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	17394460		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	8664375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	16093249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12872165, 15181171, 15999367, 16012519, 17516844, 18204200, 20204305, 22147081, 23478574, 23696025, 23945289, 27072400, 29228577, 31844579, 7585551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15999367, 16619504, 23936147	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22431919, 26957268, 27809618, 29328395, 29614078, 31253870, 32635983, 33436746, 34239022, 35037412, 35906698, 36647876, 37958905, 40403280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	22721276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	21160498	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	22947087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11336542, 12890669, 19351775, 22228178, 23485556, 23755764, 29197744, 34409922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	14751836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	25673149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	35906698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11336542, 19861515, 22912725, 22930530, 25909168, 27642033, 29795057, 30663411, 30929558, 34409922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30228980, 36046377	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	19878561, 28521108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19786090, 20489156, 24077187, 24925061, 25638724, 31237749, 31399076, 7768965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	37817210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23029358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	12439908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	14966901	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22095904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	36936778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27251707, 27888751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	10982796	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Intimal Medial Thickness 1	Carotid intima-media thickness	Pubtator	37023023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	37131205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	28834871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	18208539, 18556777, 25637490		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	18460021, 24354753, 30365040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	18460021, 24354753, 30365040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	31521893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	27835650, 29436659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	CTD_human_DG	25055964		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis	Cholestasis	CTD_human_DG	21224055		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis	Cholestasis	BEFREE	21356363, 30814402		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Kidney Diseases	Kidney Disease	BEFREE	24819335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30601084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	17420284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	16601242, 21224049, 24012056, 28602698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	21535247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16093249, 16155208, 18583030, 21118966, 24704156, 28991232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	11751871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36246978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21436631, 24297681, 26343742, 26498686, 27677186, 28991232, 29953268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19074849, 20087343, 22228178, 22230687, 25029911, 26343742, 27442508, 33346749, 34162701, 37188478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complement Component C1s Deficiency	Complement component deficiency	Pubtator	31537905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	26774383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	19336532, 29905975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23029358, 29742507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10794543, 22344601, 28111550, 28636181, 30783476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	10794543, 28636181, 30783476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	21889313, 23468932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10794543, 28636181, 30783476, 30988776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cri-du-Chat Syndrome	5p partial monosomy syndrome	BEFREE	17506096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	21968973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	16139532, 29843768, 31201921, 31357246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29294341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	20981109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20182520, 23602926, 29307595, 29490938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20182520, 23602926, 29307595, 29490938, 30815865, 30887692, 31284541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	37713834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30025875, 30755828, 31309546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	33408314	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	35721731	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37745718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28077323, 29490938, 29854821, 30024615, 30462533, 30815865, 30927260, 31195367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	37792788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	17656571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Embryopathies	Embryopathy	BEFREE	23468876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	11021835	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	18769632, 19812322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	29614078, 36765275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	18798221, 22147081, 26294741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	23427178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36232817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	17910586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	26445738, 30792272, 9344557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Absence	Absence epilepsy	Pubtator	18435749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Partial with Variable Foci	Progressive myoclonic epilepsy	Pubtator	17910586	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28716058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	22095904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11819815, 11925592, 12439908, 14966901, 16866858, 19435811, 25439783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	11925592, 14966901, 16866858, 19435811, 25439783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	12439908, 14966901, 19435811, 25439783, 36207572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	19435811, 25439783, 29047233, 32662828, 36207572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	31466866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	LHGDN	12958075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	12958075	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	23103837, 26278386, 29681936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	23103837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	31013265	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrinogen Deficiency	Fibrinogen Deficiency	BEFREE	21356363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	11855883, 15231681, 17975260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	15231681, 17975260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	11121417, 11925592, 12210033, 12553721, 16818645, 9714058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	21725089, 23132749, 24619556, 27538444, 28286204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	24706321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	33990633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	37131205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	18436822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10783396, 11555594, 16849552, 18316600, 19810093, 31006910, 8664375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	10783396, 16849552, 27002148, 32518380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18316600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10783396, 16849552, 18316600, 19810093, 31006910, 8664375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12384223, 16990846, 28187447, 29246166, 8664375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18067864, 27002148, 32518380, 40653505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	28713898, 31392215, 34823491, 38278877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	10907091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	37324256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	12915945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29905975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	29905975, 36859608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	24381225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	34294125	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	17125835, 24264229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	30858922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	11823033	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	35037412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	36248794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	23592216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	36046723, 36831273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28593442, 9344557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	CTD_human_DG	25015655		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	BEFREE	23468876, 24186862, 29307595, 30887692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31309546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	15388524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	37792788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19188657, 23132749, 26774383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive Nephropathy	Hypertensive nephropathy	Pubtator	28713898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	26398137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	26398137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16849552, 20606312	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	30967156, 31752873, 37078361	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	36240645	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	26774383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19347046, 21511034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	19812322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21535247, 24686449, 28416808, 30227888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	14722058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	14722058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	31013265	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	11701445, 24631481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis	Intrahepatic Cholestasis	CTD_human_DG	18364083, 22094456		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	24060757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	25637490, 28834871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	20864524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	12517959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	23468876, 26960759, 30776024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	26960759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	23029358, 36046723	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17599039, 19152168		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19152168, 29050203, 31746437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	28596280, 34294125	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	1864967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10733509, 24314118, 31537905, 37532789, 40225861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12203786, 20417862, 21274003, 21622185, 24314118, 24381225, 31537905, 8516290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	17420284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	28881635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10395376, 11925592, 14973178, 16079887, 17827686, 18215136, 19526316, 20602107, 25909168, 26708617, 26936374, 27244890, 28134935, 29254483, 29378599 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	34409922	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	37175814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10395376, 14973178, 16079887, 29910624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	11021835, 19188657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	11021835, 37792788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	20204305		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	24925061, 36224313	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	27935865		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21886837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	12439908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24990820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15890690, 20472833, 28064239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	28064239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	28064239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	25658856, 27219347, 27475889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	21386735, 21531298, 28187447, 9681412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	12915945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15181171, 16012519, 17516844, 18204200, 20204305, 22147081, 23478574, 23696025, 23945289, 27072400, 29228577, 31253870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	22147081, 26294741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	11925592, 14966901, 16866858, 19435811, 25439783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	23029358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22919248, 26376677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19786090, 20489156, 24077187, 24925061, 25638724, 31237749, 31399076, 7768965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	27935865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	22947087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25997867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10984481, 11567222, 11586104, 12890669, 14751836, 14985468, 15486985, 15548358, 15709168, 16138117, 16267018, 17942914, 18506761, 19837667, 21622185 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	16552752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12553019, 20403028, 22918686, 24011795, 30185552, 30514177, 31515938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	19878561, 28521108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11555594, 11819815, 12439908, 12792775, 14688464, 14965266, 15902277, 16818645, 16866858, 17257596, 17942914, 21511034, 22095904, 22721276, 22918686 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	18460021, 24354753, 30365040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16155208, 18583030, 21118966, 24704156, 28991232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18204200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20204305, 29408223, 31253870		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31116991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	31116991, 7565779, 7823937, 8910582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29294341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28894112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	15878867		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	CTD_human_DG	15878867		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma Malignant	Mesothelioma	Pubtator	15878867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	28763805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	24264229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	29197744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19837979, 25944690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	19837979, 24429703, 26282654, 28550183, 37012388, 37452600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23456643		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	17420284		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	19446747, 24244432, 24381225, 7858491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndrome with Isolated del(5q)	Myelodysplastic syndrome	BEFREE	11325642, 19608274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	24244432, 29286619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	19958752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	19151753, 29050203, 29437554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	10794543, 17373938, 22344601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	22344601, 28111550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	18636116, 28063778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	18636116, 23637909, 26984843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	10929762, 24722284, 28269757, 34906623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16077901, 20635349, 22947087, 28269757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	24722284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	27642033	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10604389, 10748299, 11106242, 11555594, 11586104, 11802200, 11819815, 11925592, 12065847, 12210033, 12792775, 12802290, 12872165, 14751836, 15231681 View all (67 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	26960759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	26960759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	11106242, 11734301, 1654597, 20123987, 21622185, 21826097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15548358, 16990846, 18434015, 18469860, 19187099, 19812322, 21506108, 23059951, 24190252, 24686449, 29868983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19187099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	20635349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31013265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15774784, 24990820, 25578635, 25987100, 30195659, 30732622, 31752873, 7478546, 9374113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23632636, 33487124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24819376	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28771625, 29170465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	26922429, 28720506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10806043, 16139532, 25807424, 30081074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	39354574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21283769, 22659570, 31114985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29339716, 30936265, 31114985, 38417243	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	31004220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17158885, 22531302, 24337575, 32046751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25997867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17696250, 36932397	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	18923405, 29337144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	11823033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	17257596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	37989866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
POLYCYSTIC KIDNEY DISEASE 1	Polycystic kidney disease	BEFREE	26113112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	31322266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10984481, 11567222, 11586104, 12890669, 14751836, 14985468, 15486985, 15548358, 15709168, 16138117, 16238095, 16267018, 17942914, 18506761, 19837667 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	9622090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hypertrophy	Prostatic Hypertrophy	BEFREE	9622090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10984481, 12890669, 22127986	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	12065847, 12890669, 14751836, 16138117, 20190820, 22115966, 23715767		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15486985, 15709168, 17448597		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15548358, 17942914, 22081596, 25031707, 27003515, 30333255, 32319557, 35812443, 39837010, 9407088	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	16552752		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	20653771	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	25256120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	25658856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	25658856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	26774383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	37792788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24012056, 31419078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	11021835, 16601242, 17099140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	18772333, 23132749, 23874821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	23874821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	23029358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23029358, 29742507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	19088428, 24819335, 28077323, 28411025, 28673338, 30050950, 30816527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	15803145, 21118966, 29719592, 30979887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10050673, 1411083, 28282578, 9352605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12553721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	31786685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	16933469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20144677, 25658856, 28072411, 28754123, 29520222, 30952071		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	25658856, 28754123, 31959813	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	18772333, 21931594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28005260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	16306258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	35205254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31387910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	18636116, 23637909, 26984843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	20653771	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	25256120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	23761323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12439908, 14966901, 24077187, 8813113		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16866858, 21271225, 25439783, 29047233, 30557604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17498291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	30396177	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16103054, 25710185, 28452807, 30396177, 30845713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	30792272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23103837, 26278386, 29681936, 31013265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12553019, 20403028, 22918686, 24011795, 30185552, 30514177, 31515938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23121767, 23755764, 28169308, 29393474, 30266078, 31515938, 31949544, 37989866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35169855	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	34938355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28125090		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	21118966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	18772333, 21931594, 23132749		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	17420284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	29105401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	31357246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	16306258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thromboangiitis Obliterans	Thromboangiitis obliterans	Pubtator	38275601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	33173052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	37324256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	15231710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	26985959, 37219859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27072400, 27377973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37762678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumoral Calcinosis Normophosphatemic Familial	Tumoral calcinosis	Pubtator	21160498	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21968973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	15911105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	19878561, 23717422, 31906413, 35982887, 37862152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18460021	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	11855883, 15231681, 17975260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	17717122, 19188657, 26774383, 27057945, 29307595, 30939252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	17717122	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	17967787, 18682391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	21365018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

EGR1 (early growth response 1)