VDAC1 (voltage dependent anion channel 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7416
• Gene name: Voltage dependent anion channel 1
• Gene symbol: VDAC1
• Synonyms (NCBI Gene): PORIN, VDAC-1
• Chromosome: 5
• Chromosome location: 5q31.1
• Summary: This gene encodes a voltage-dependent anion channel protein that is a major component of the outer mitochondrial membrane. The encoded protein facilitates the exchange of metabolites and ions across the outer mitochondrial membrane and may regulate mitoch

miRNA Show/Hide all (636)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048331	hsa-miR-106a-5p	CLASH	23622248
MIRT048149	hsa-miR-197-3p	CLASH	23622248
MIRT047728	hsa-miR-10a-5p	CLASH	23622248
MIRT045947	hsa-miR-125b-5p	CLASH	23622248
MIRT044747	hsa-miR-320a	CLASH	23622248
MIRT044747	hsa-miR-320a	CLASH	23622248
MIRT039673	hsa-miR-615-3p	CLASH	23622248
MIRT037391	hsa-miR-744-5p	CLASH	23622248
MIRT037371	hsa-miR-877-5p	CLASH	23622248
MIRT036168	hsa-miR-320c	CLASH	23622248
MIRT036008	hsa-miR-1301-3p	CLASH	23622248
MIRT053765	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22952654
MIRT439307	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT439306	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439307	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT726140	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT726139	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT726137	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT726138	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT439306	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT731276	hsa-miR-7-5p	Luciferase reporter assay	26801612
MIRT731276	hsa-miR-7-5p	Luciferase reporter assay	26801612
MIRT044747	hsa-miR-320a	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	27761954
MIRT044747	hsa-miR-320a	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	27761954
MIRT044747	hsa-miR-320a	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	27761954
MIRT044747	hsa-miR-320a	H226	27304056
MIRT044747	hsa-miR-320a	H226	27304056
MIRT044747	hsa-miR-320a	Luciferase reporter assay, qRT-PCR, Western blot	27229534
MIRT044747	hsa-miR-320a	Luciferase reporter assay, qRT-PCR, Western blot	27229534
MIRT044747	hsa-miR-320a	qRT-PCR, Western blot	26472185
MIRT044747	hsa-miR-320a	qRT-PCR, Western blot	26472185
MIRT048149	hsa-miR-197-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR	32210729
MIRT1483519	hsa-miR-106a	CLIP-seq
MIRT1483520	hsa-miR-106b	CLIP-seq
MIRT1483521	hsa-miR-125a-3p	CLIP-seq
MIRT1483522	hsa-miR-1266	CLIP-seq
MIRT1483523	hsa-miR-1292	CLIP-seq
MIRT1483524	hsa-miR-1298	CLIP-seq
MIRT1483525	hsa-miR-1299	CLIP-seq
MIRT1483526	hsa-miR-1301	CLIP-seq
MIRT1483527	hsa-miR-140-3p	CLIP-seq
MIRT1483528	hsa-miR-143	CLIP-seq
MIRT1483529	hsa-miR-17	CLIP-seq
MIRT1483530	hsa-miR-183	CLIP-seq
MIRT1483531	hsa-miR-2053	CLIP-seq
MIRT1483532	hsa-miR-20a	CLIP-seq
MIRT1483533	hsa-miR-20b	CLIP-seq
MIRT1483534	hsa-miR-21	CLIP-seq
MIRT1483535	hsa-miR-2115	CLIP-seq
MIRT1483536	hsa-miR-296-3p	CLIP-seq
MIRT1483537	hsa-miR-3065-5p	CLIP-seq
MIRT1483538	hsa-miR-3120-3p	CLIP-seq
MIRT1483539	hsa-miR-3120-5p	CLIP-seq
MIRT1483540	hsa-miR-3135b	CLIP-seq
MIRT1483541	hsa-miR-3156-5p	CLIP-seq
MIRT1483542	hsa-miR-3158-5p	CLIP-seq
MIRT1483543	hsa-miR-3162-5p	CLIP-seq
MIRT1483544	hsa-miR-3166	CLIP-seq
MIRT1483545	hsa-miR-3179	CLIP-seq
MIRT1483546	hsa-miR-3182	CLIP-seq
MIRT1483547	hsa-miR-3202	CLIP-seq
MIRT1483548	hsa-miR-320b	CLIP-seq
MIRT1483549	hsa-miR-320d	CLIP-seq
MIRT1483550	hsa-miR-324-5p	CLIP-seq
MIRT1483551	hsa-miR-329	CLIP-seq
MIRT1483552	hsa-miR-3613-3p	CLIP-seq
MIRT1483553	hsa-miR-3620	CLIP-seq
MIRT1483554	hsa-miR-362-3p	CLIP-seq
MIRT1483555	hsa-miR-3662	CLIP-seq
MIRT1483556	hsa-miR-3664-3p	CLIP-seq
MIRT1483557	hsa-miR-3664-5p	CLIP-seq
MIRT1483558	hsa-miR-3686	CLIP-seq
MIRT1483559	hsa-miR-3690	CLIP-seq
MIRT1483560	hsa-miR-371-5p	CLIP-seq
MIRT1483561	hsa-miR-371b-5p	CLIP-seq
MIRT1483562	hsa-miR-3908	CLIP-seq
MIRT1483563	hsa-miR-3926	CLIP-seq
MIRT1483564	hsa-miR-3934	CLIP-seq
MIRT1483565	hsa-miR-3941	CLIP-seq
MIRT1483566	hsa-miR-3942-5p	CLIP-seq
MIRT1483567	hsa-miR-4254	CLIP-seq
MIRT1483568	hsa-miR-4275	CLIP-seq
MIRT1483569	hsa-miR-4282	CLIP-seq
MIRT1483570	hsa-miR-4299	CLIP-seq
MIRT1483571	hsa-miR-4310	CLIP-seq
MIRT1483572	hsa-miR-4311	CLIP-seq
MIRT1483573	hsa-miR-4429	CLIP-seq
MIRT1483574	hsa-miR-4432	CLIP-seq
MIRT1483575	hsa-miR-4436b-5p	CLIP-seq
MIRT1483576	hsa-miR-4456	CLIP-seq
MIRT1483577	hsa-miR-4464	CLIP-seq
MIRT1483578	hsa-miR-4471	CLIP-seq
MIRT1483579	hsa-miR-4481	CLIP-seq
MIRT1483580	hsa-miR-4517	CLIP-seq
MIRT1483581	hsa-miR-4518	CLIP-seq
MIRT1483582	hsa-miR-4533	CLIP-seq
MIRT1483583	hsa-miR-4633-3p	CLIP-seq
MIRT1483584	hsa-miR-4658	CLIP-seq
MIRT1483585	hsa-miR-4659a-3p	CLIP-seq
MIRT1483586	hsa-miR-4659b-3p	CLIP-seq
MIRT1483587	hsa-miR-4694-3p	CLIP-seq
MIRT1483588	hsa-miR-4698	CLIP-seq
MIRT1483589	hsa-miR-4699-3p	CLIP-seq
MIRT1483590	hsa-miR-4699-5p	CLIP-seq
MIRT1483591	hsa-miR-4703-5p	CLIP-seq
MIRT1483592	hsa-miR-4704-5p	CLIP-seq
MIRT1483593	hsa-miR-4708-3p	CLIP-seq
MIRT1483594	hsa-miR-4710	CLIP-seq
MIRT1483595	hsa-miR-4714-5p	CLIP-seq
MIRT1483596	hsa-miR-4721	CLIP-seq
MIRT1483597	hsa-miR-4728-3p	CLIP-seq
MIRT1483598	hsa-miR-4729	CLIP-seq
MIRT1483599	hsa-miR-4731-3p	CLIP-seq
MIRT1483600	hsa-miR-4735-5p	CLIP-seq
MIRT1483601	hsa-miR-4745-5p	CLIP-seq
MIRT1483602	hsa-miR-4748	CLIP-seq
MIRT1483603	hsa-miR-4758-5p	CLIP-seq
MIRT1483604	hsa-miR-4760-5p	CLIP-seq
MIRT1483605	hsa-miR-4766-3p	CLIP-seq
MIRT1483606	hsa-miR-4770	CLIP-seq
MIRT1483607	hsa-miR-4771	CLIP-seq
MIRT1483608	hsa-miR-4777-5p	CLIP-seq
MIRT1483609	hsa-miR-4792	CLIP-seq
MIRT1483610	hsa-miR-4801	CLIP-seq
MIRT1483611	hsa-miR-4803	CLIP-seq
MIRT1483612	hsa-miR-485-3p	CLIP-seq
MIRT1483613	hsa-miR-490-3p	CLIP-seq
MIRT1483614	hsa-miR-493	CLIP-seq
MIRT1483615	hsa-miR-503	CLIP-seq
MIRT1483616	hsa-miR-5047	CLIP-seq
MIRT1483617	hsa-miR-515-3p	CLIP-seq
MIRT1483618	hsa-miR-518d-5p	CLIP-seq
MIRT1483619	hsa-miR-519b-5p	CLIP-seq
MIRT1483620	hsa-miR-519c-5p	CLIP-seq
MIRT1483621	hsa-miR-519d	CLIP-seq
MIRT1483622	hsa-miR-519e	CLIP-seq
MIRT1483623	hsa-miR-520c-5p	CLIP-seq
MIRT1483624	hsa-miR-520d-5p	CLIP-seq
MIRT1483625	hsa-miR-520g	CLIP-seq
MIRT1483626	hsa-miR-520h	CLIP-seq
MIRT1483627	hsa-miR-524-5p	CLIP-seq
MIRT1483628	hsa-miR-526a	CLIP-seq
MIRT1483629	hsa-miR-548g	CLIP-seq
MIRT1483630	hsa-miR-548q	CLIP-seq
MIRT1483631	hsa-miR-569	CLIP-seq
MIRT1483632	hsa-miR-577	CLIP-seq
MIRT1483633	hsa-miR-579	CLIP-seq
MIRT1483634	hsa-miR-580	CLIP-seq
MIRT1483635	hsa-miR-590-5p	CLIP-seq
MIRT1483636	hsa-miR-595	CLIP-seq
MIRT1483637	hsa-miR-603	CLIP-seq
MIRT1483638	hsa-miR-619	CLIP-seq
MIRT1483639	hsa-miR-649	CLIP-seq
MIRT1483640	hsa-miR-656	CLIP-seq
MIRT1483641	hsa-miR-660	CLIP-seq
MIRT1483642	hsa-miR-664	CLIP-seq
MIRT1483643	hsa-miR-671-5p	CLIP-seq
MIRT1483644	hsa-miR-7	CLIP-seq
MIRT1483645	hsa-miR-764	CLIP-seq
MIRT1483646	hsa-miR-873	CLIP-seq
MIRT1483647	hsa-miR-875-3p	CLIP-seq
MIRT1483648	hsa-miR-888	CLIP-seq
MIRT1483649	hsa-miR-93	CLIP-seq
MIRT1483650	hsa-miR-935	CLIP-seq
MIRT1555434	hsa-miR-1297	CLIP-seq
MIRT1483531	hsa-miR-2053	CLIP-seq
MIRT1555435	hsa-miR-26a	CLIP-seq
MIRT1555436	hsa-miR-26b	CLIP-seq
MIRT1483548	hsa-miR-320b	CLIP-seq
MIRT1483549	hsa-miR-320d	CLIP-seq
MIRT1483567	hsa-miR-4254	CLIP-seq
MIRT1555437	hsa-miR-4272	CLIP-seq
MIRT1483573	hsa-miR-4429	CLIP-seq
MIRT1555438	hsa-miR-4465	CLIP-seq
MIRT1483596	hsa-miR-4721	CLIP-seq
MIRT1483611	hsa-miR-4803	CLIP-seq
MIRT1483613	hsa-miR-490-3p	CLIP-seq
MIRT1483631	hsa-miR-569	CLIP-seq
MIRT1483636	hsa-miR-595	CLIP-seq
MIRT1483638	hsa-miR-619	CLIP-seq
MIRT1483639	hsa-miR-649	CLIP-seq
MIRT1483522	hsa-miR-1266	CLIP-seq
MIRT2145577	hsa-miR-1272	CLIP-seq
MIRT1483523	hsa-miR-1292	CLIP-seq
MIRT1555434	hsa-miR-1297	CLIP-seq
MIRT1483524	hsa-miR-1298	CLIP-seq
MIRT1483525	hsa-miR-1299	CLIP-seq
MIRT1483527	hsa-miR-140-3p	CLIP-seq
MIRT1483528	hsa-miR-143	CLIP-seq
MIRT1483531	hsa-miR-2053	CLIP-seq
MIRT1483534	hsa-miR-21	CLIP-seq
MIRT1555435	hsa-miR-26a	CLIP-seq
MIRT1555436	hsa-miR-26b	CLIP-seq
MIRT1483536	hsa-miR-296-3p	CLIP-seq
MIRT1483537	hsa-miR-3065-5p	CLIP-seq
MIRT1483538	hsa-miR-3120-3p	CLIP-seq
MIRT1483540	hsa-miR-3135b	CLIP-seq
MIRT1483541	hsa-miR-3156-5p	CLIP-seq
MIRT1483542	hsa-miR-3158-5p	CLIP-seq
MIRT1483544	hsa-miR-3166	CLIP-seq
MIRT1483545	hsa-miR-3179	CLIP-seq
MIRT1483546	hsa-miR-3182	CLIP-seq
MIRT1483547	hsa-miR-3202	CLIP-seq
MIRT1483548	hsa-miR-320b	CLIP-seq
MIRT1483549	hsa-miR-320d	CLIP-seq
MIRT1483550	hsa-miR-324-5p	CLIP-seq
MIRT2145578	hsa-miR-3545-3p	CLIP-seq
MIRT1483553	hsa-miR-3620	CLIP-seq
MIRT1483555	hsa-miR-3662	CLIP-seq
MIRT1483556	hsa-miR-3664-3p	CLIP-seq
MIRT2145579	hsa-miR-3682-3p	CLIP-seq
MIRT1483558	hsa-miR-3686	CLIP-seq
MIRT1483562	hsa-miR-3908	CLIP-seq
MIRT1483566	hsa-miR-3942-5p	CLIP-seq
MIRT1483567	hsa-miR-4254	CLIP-seq
MIRT1555437	hsa-miR-4272	CLIP-seq
MIRT1483568	hsa-miR-4275	CLIP-seq
MIRT1483571	hsa-miR-4310	CLIP-seq
MIRT1483572	hsa-miR-4311	CLIP-seq
MIRT1483573	hsa-miR-4429	CLIP-seq
MIRT1483574	hsa-miR-4432	CLIP-seq
MIRT1555438	hsa-miR-4465	CLIP-seq
MIRT1483578	hsa-miR-4471	CLIP-seq
MIRT1483581	hsa-miR-4518	CLIP-seq
MIRT1483582	hsa-miR-4533	CLIP-seq
MIRT1483583	hsa-miR-4633-3p	CLIP-seq
MIRT2145580	hsa-miR-4651	CLIP-seq
MIRT1483585	hsa-miR-4659a-3p	CLIP-seq
MIRT1483586	hsa-miR-4659b-3p	CLIP-seq
MIRT1483587	hsa-miR-4694-3p	CLIP-seq
MIRT1483588	hsa-miR-4698	CLIP-seq
MIRT1483590	hsa-miR-4699-5p	CLIP-seq
MIRT1483591	hsa-miR-4703-5p	CLIP-seq
MIRT1483592	hsa-miR-4704-5p	CLIP-seq
MIRT2145581	hsa-miR-4713-5p	CLIP-seq
MIRT1483596	hsa-miR-4721	CLIP-seq
MIRT1483600	hsa-miR-4735-5p	CLIP-seq
MIRT1483605	hsa-miR-4766-3p	CLIP-seq
MIRT1483606	hsa-miR-4770	CLIP-seq
MIRT1483607	hsa-miR-4771	CLIP-seq
MIRT1483611	hsa-miR-4803	CLIP-seq
MIRT1483613	hsa-miR-490-3p	CLIP-seq
MIRT1483614	hsa-miR-493	CLIP-seq
MIRT2145582	hsa-miR-515-5p	CLIP-seq
MIRT1483631	hsa-miR-569	CLIP-seq
MIRT1483635	hsa-miR-590-5p	CLIP-seq
MIRT1483636	hsa-miR-595	CLIP-seq
MIRT2145583	hsa-miR-608	CLIP-seq
MIRT1483638	hsa-miR-619	CLIP-seq
MIRT1483639	hsa-miR-649	CLIP-seq
MIRT1483644	hsa-miR-7	CLIP-seq
MIRT1483646	hsa-miR-873	CLIP-seq
MIRT1483647	hsa-miR-875-3p	CLIP-seq
MIRT1483650	hsa-miR-935	CLIP-seq
MIRT2366019	hsa-miR-101	CLIP-seq
MIRT1483519	hsa-miR-106a	CLIP-seq
MIRT1483520	hsa-miR-106b	CLIP-seq
MIRT2366020	hsa-miR-1252	CLIP-seq
MIRT1483521	hsa-miR-125a-3p	CLIP-seq
MIRT1483522	hsa-miR-1266	CLIP-seq
MIRT2145577	hsa-miR-1272	CLIP-seq
MIRT1555434	hsa-miR-1297	CLIP-seq
MIRT1483526	hsa-miR-1301	CLIP-seq
MIRT1483527	hsa-miR-140-3p	CLIP-seq
MIRT1483528	hsa-miR-143	CLIP-seq
MIRT2366021	hsa-miR-144	CLIP-seq
MIRT1483529	hsa-miR-17	CLIP-seq
MIRT1483531	hsa-miR-2053	CLIP-seq
MIRT1483532	hsa-miR-20a	CLIP-seq
MIRT1483533	hsa-miR-20b	CLIP-seq
MIRT1483534	hsa-miR-21	CLIP-seq
MIRT1555435	hsa-miR-26a	CLIP-seq
MIRT1555436	hsa-miR-26b	CLIP-seq
MIRT1483536	hsa-miR-296-3p	CLIP-seq
MIRT1483537	hsa-miR-3065-5p	CLIP-seq
MIRT1483538	hsa-miR-3120-3p	CLIP-seq
MIRT1483540	hsa-miR-3135b	CLIP-seq
MIRT2366022	hsa-miR-3140-5p	CLIP-seq
MIRT1483543	hsa-miR-3162-5p	CLIP-seq
MIRT1483545	hsa-miR-3179	CLIP-seq
MIRT1483548	hsa-miR-320b	CLIP-seq
MIRT1483549	hsa-miR-320d	CLIP-seq
MIRT1483550	hsa-miR-324-5p	CLIP-seq
MIRT1483551	hsa-miR-329	CLIP-seq
MIRT2145578	hsa-miR-3545-3p	CLIP-seq
MIRT2366023	hsa-miR-3607-5p	CLIP-seq
MIRT1483553	hsa-miR-3620	CLIP-seq
MIRT1483554	hsa-miR-362-3p	CLIP-seq
MIRT2366024	hsa-miR-3659	CLIP-seq
MIRT1483555	hsa-miR-3662	CLIP-seq
MIRT1483556	hsa-miR-3664-3p	CLIP-seq
MIRT1483557	hsa-miR-3664-5p	CLIP-seq
MIRT2145579	hsa-miR-3682-3p	CLIP-seq
MIRT1483559	hsa-miR-3690	CLIP-seq
MIRT1483560	hsa-miR-371-5p	CLIP-seq
MIRT1483561	hsa-miR-371b-5p	CLIP-seq
MIRT2366025	hsa-miR-377	CLIP-seq
MIRT1483562	hsa-miR-3908	CLIP-seq
MIRT1483564	hsa-miR-3934	CLIP-seq
MIRT1483565	hsa-miR-3941	CLIP-seq
MIRT1483566	hsa-miR-3942-5p	CLIP-seq
MIRT1483567	hsa-miR-4254	CLIP-seq
MIRT1555437	hsa-miR-4272	CLIP-seq
MIRT1483568	hsa-miR-4275	CLIP-seq
MIRT1483569	hsa-miR-4282	CLIP-seq
MIRT1483571	hsa-miR-4310	CLIP-seq
MIRT1483572	hsa-miR-4311	CLIP-seq
MIRT1483573	hsa-miR-4429	CLIP-seq
MIRT1483574	hsa-miR-4432	CLIP-seq
MIRT1555438	hsa-miR-4465	CLIP-seq
MIRT1483581	hsa-miR-4518	CLIP-seq
MIRT1483583	hsa-miR-4633-3p	CLIP-seq
MIRT2366026	hsa-miR-4642	CLIP-seq
MIRT2366027	hsa-miR-4680-3p	CLIP-seq
MIRT1483587	hsa-miR-4694-3p	CLIP-seq
MIRT1483588	hsa-miR-4698	CLIP-seq
MIRT1483591	hsa-miR-4703-5p	CLIP-seq
MIRT1483592	hsa-miR-4704-5p	CLIP-seq
MIRT2366028	hsa-miR-4705	CLIP-seq
MIRT2145581	hsa-miR-4713-5p	CLIP-seq
MIRT1483595	hsa-miR-4714-5p	CLIP-seq
MIRT2366029	hsa-miR-4720-5p	CLIP-seq
MIRT1483596	hsa-miR-4721	CLIP-seq
MIRT1483597	hsa-miR-4728-3p	CLIP-seq
MIRT1483599	hsa-miR-4731-3p	CLIP-seq
MIRT1483600	hsa-miR-4735-5p	CLIP-seq
MIRT1483605	hsa-miR-4766-3p	CLIP-seq
MIRT1483606	hsa-miR-4770	CLIP-seq
MIRT1483608	hsa-miR-4777-5p	CLIP-seq
MIRT2366030	hsa-miR-4799-3p	CLIP-seq
MIRT1483610	hsa-miR-4801	CLIP-seq
MIRT1483611	hsa-miR-4803	CLIP-seq
MIRT1483612	hsa-miR-485-3p	CLIP-seq
MIRT1483613	hsa-miR-490-3p	CLIP-seq
MIRT1483614	hsa-miR-493	CLIP-seq
MIRT1483615	hsa-miR-503	CLIP-seq
MIRT1483616	hsa-miR-5047	CLIP-seq
MIRT1483617	hsa-miR-515-3p	CLIP-seq
MIRT1483618	hsa-miR-518d-5p	CLIP-seq
MIRT1483619	hsa-miR-519b-5p	CLIP-seq
MIRT1483620	hsa-miR-519c-5p	CLIP-seq
MIRT1483621	hsa-miR-519d	CLIP-seq
MIRT1483622	hsa-miR-519e	CLIP-seq
MIRT1483623	hsa-miR-520c-5p	CLIP-seq
MIRT1483624	hsa-miR-520d-5p	CLIP-seq
MIRT1483625	hsa-miR-520g	CLIP-seq
MIRT1483626	hsa-miR-520h	CLIP-seq
MIRT1483627	hsa-miR-524-5p	CLIP-seq
MIRT1483628	hsa-miR-526a	CLIP-seq
MIRT1483631	hsa-miR-569	CLIP-seq
MIRT1483632	hsa-miR-577	CLIP-seq
MIRT1483635	hsa-miR-590-5p	CLIP-seq
MIRT1483636	hsa-miR-595	CLIP-seq
MIRT1483637	hsa-miR-603	CLIP-seq
MIRT1483638	hsa-miR-619	CLIP-seq
MIRT1483639	hsa-miR-649	CLIP-seq
MIRT1483640	hsa-miR-656	CLIP-seq
MIRT1483642	hsa-miR-664	CLIP-seq
MIRT1483643	hsa-miR-671-5p	CLIP-seq
MIRT1483644	hsa-miR-7	CLIP-seq
MIRT1483645	hsa-miR-764	CLIP-seq
MIRT1483646	hsa-miR-873	CLIP-seq
MIRT1483649	hsa-miR-93	CLIP-seq
MIRT1483650	hsa-miR-935	CLIP-seq
MIRT2366031	hsa-miR-944	CLIP-seq
MIRT1483526	hsa-miR-1301	CLIP-seq
MIRT1483534	hsa-miR-21	CLIP-seq
MIRT1483535	hsa-miR-2115	CLIP-seq
MIRT1483540	hsa-miR-3135b	CLIP-seq
MIRT1483548	hsa-miR-320b	CLIP-seq
MIRT1483549	hsa-miR-320d	CLIP-seq
MIRT1483559	hsa-miR-3690	CLIP-seq
MIRT1483562	hsa-miR-3908	CLIP-seq
MIRT1483566	hsa-miR-3942-5p	CLIP-seq
MIRT1483567	hsa-miR-4254	CLIP-seq
MIRT1483573	hsa-miR-4429	CLIP-seq
MIRT1483575	hsa-miR-4436b-5p	CLIP-seq
MIRT1483583	hsa-miR-4633-3p	CLIP-seq
MIRT1483591	hsa-miR-4703-5p	CLIP-seq
MIRT1483596	hsa-miR-4721	CLIP-seq
MIRT1483605	hsa-miR-4766-3p	CLIP-seq
MIRT1483608	hsa-miR-4777-5p	CLIP-seq
MIRT1483611	hsa-miR-4803	CLIP-seq
MIRT1483613	hsa-miR-490-3p	CLIP-seq
MIRT1483616	hsa-miR-5047	CLIP-seq
MIRT1483618	hsa-miR-518d-5p	CLIP-seq
MIRT1483619	hsa-miR-519b-5p	CLIP-seq
MIRT1483620	hsa-miR-519c-5p	CLIP-seq
MIRT1483623	hsa-miR-520c-5p	CLIP-seq
MIRT1483628	hsa-miR-526a	CLIP-seq
MIRT1483632	hsa-miR-577	CLIP-seq
MIRT1483635	hsa-miR-590-5p	CLIP-seq
MIRT1483638	hsa-miR-619	CLIP-seq
MIRT1483639	hsa-miR-649	CLIP-seq
MIRT1483525	hsa-miR-1299	CLIP-seq
MIRT1483534	hsa-miR-21	CLIP-seq
MIRT1483540	hsa-miR-3135b	CLIP-seq
MIRT1483547	hsa-miR-3202	CLIP-seq
MIRT1483548	hsa-miR-320b	CLIP-seq
MIRT1483549	hsa-miR-320d	CLIP-seq
MIRT1483559	hsa-miR-3690	CLIP-seq
MIRT1483567	hsa-miR-4254	CLIP-seq
MIRT1483573	hsa-miR-4429	CLIP-seq
MIRT1483582	hsa-miR-4533	CLIP-seq
MIRT1483583	hsa-miR-4633-3p	CLIP-seq
MIRT1483592	hsa-miR-4704-5p	CLIP-seq
MIRT1483635	hsa-miR-590-5p	CLIP-seq
MIRT1483643	hsa-miR-671-5p	CLIP-seq
MIRT1483647	hsa-miR-875-3p	CLIP-seq
MIRT1483519	hsa-miR-106a	CLIP-seq
MIRT1483520	hsa-miR-106b	CLIP-seq
MIRT1483529	hsa-miR-17	CLIP-seq
MIRT1483532	hsa-miR-20a	CLIP-seq
MIRT1483533	hsa-miR-20b	CLIP-seq
MIRT1483580	hsa-miR-4517	CLIP-seq
MIRT1483617	hsa-miR-515-3p	CLIP-seq
MIRT1483621	hsa-miR-519d	CLIP-seq
MIRT1483622	hsa-miR-519e	CLIP-seq
MIRT1483624	hsa-miR-520d-5p	CLIP-seq
MIRT1483625	hsa-miR-520g	CLIP-seq
MIRT1483626	hsa-miR-520h	CLIP-seq
MIRT1483627	hsa-miR-524-5p	CLIP-seq
MIRT1483649	hsa-miR-93	CLIP-seq
MIRT1483519	hsa-miR-106a	CLIP-seq
MIRT1483520	hsa-miR-106b	CLIP-seq
MIRT2366020	hsa-miR-1252	CLIP-seq
MIRT1483521	hsa-miR-125a-3p	CLIP-seq
MIRT1483522	hsa-miR-1266	CLIP-seq
MIRT2145577	hsa-miR-1272	CLIP-seq
MIRT1483523	hsa-miR-1292	CLIP-seq
MIRT2659535	hsa-miR-129-5p	CLIP-seq
MIRT1483524	hsa-miR-1298	CLIP-seq
MIRT1483525	hsa-miR-1299	CLIP-seq
MIRT1483526	hsa-miR-1301	CLIP-seq
MIRT1483527	hsa-miR-140-3p	CLIP-seq
MIRT1483528	hsa-miR-143	CLIP-seq
MIRT1483529	hsa-miR-17	CLIP-seq
MIRT1483530	hsa-miR-183	CLIP-seq
MIRT1483531	hsa-miR-2053	CLIP-seq
MIRT1483532	hsa-miR-20a	CLIP-seq
MIRT1483533	hsa-miR-20b	CLIP-seq
MIRT1483534	hsa-miR-21	CLIP-seq
MIRT1483535	hsa-miR-2115	CLIP-seq
MIRT1483536	hsa-miR-296-3p	CLIP-seq
MIRT1483538	hsa-miR-3120-3p	CLIP-seq
MIRT1483539	hsa-miR-3120-5p	CLIP-seq
MIRT1483540	hsa-miR-3135b	CLIP-seq
MIRT2366022	hsa-miR-3140-5p	CLIP-seq
MIRT1483541	hsa-miR-3156-5p	CLIP-seq
MIRT1483542	hsa-miR-3158-5p	CLIP-seq
MIRT1483543	hsa-miR-3162-5p	CLIP-seq
MIRT1483544	hsa-miR-3166	CLIP-seq
MIRT1483546	hsa-miR-3182	CLIP-seq
MIRT1483547	hsa-miR-3202	CLIP-seq
MIRT1483548	hsa-miR-320b	CLIP-seq
MIRT1483549	hsa-miR-320d	CLIP-seq
MIRT1483550	hsa-miR-324-5p	CLIP-seq
MIRT1483551	hsa-miR-329	CLIP-seq
MIRT2659536	hsa-miR-342-5p	CLIP-seq
MIRT2145578	hsa-miR-3545-3p	CLIP-seq
MIRT2366023	hsa-miR-3607-5p	CLIP-seq
MIRT1483552	hsa-miR-3613-3p	CLIP-seq
MIRT1483553	hsa-miR-3620	CLIP-seq
MIRT1483554	hsa-miR-362-3p	CLIP-seq
MIRT1483556	hsa-miR-3664-3p	CLIP-seq
MIRT1483557	hsa-miR-3664-5p	CLIP-seq
MIRT2145579	hsa-miR-3682-3p	CLIP-seq
MIRT1483558	hsa-miR-3686	CLIP-seq
MIRT1483559	hsa-miR-3690	CLIP-seq
MIRT2366025	hsa-miR-377	CLIP-seq
MIRT1483562	hsa-miR-3908	CLIP-seq
MIRT1483563	hsa-miR-3926	CLIP-seq
MIRT1483564	hsa-miR-3934	CLIP-seq
MIRT1483565	hsa-miR-3941	CLIP-seq
MIRT1483566	hsa-miR-3942-5p	CLIP-seq
MIRT2659537	hsa-miR-3978	CLIP-seq
MIRT1483567	hsa-miR-4254	CLIP-seq
MIRT1483568	hsa-miR-4275	CLIP-seq
MIRT1483570	hsa-miR-4299	CLIP-seq
MIRT1483572	hsa-miR-4311	CLIP-seq
MIRT1483573	hsa-miR-4429	CLIP-seq
MIRT1483575	hsa-miR-4436b-5p	CLIP-seq
MIRT1483576	hsa-miR-4456	CLIP-seq
MIRT1483577	hsa-miR-4464	CLIP-seq
MIRT1483578	hsa-miR-4471	CLIP-seq
MIRT1483580	hsa-miR-4517	CLIP-seq
MIRT1483581	hsa-miR-4518	CLIP-seq
MIRT1483582	hsa-miR-4533	CLIP-seq
MIRT1483583	hsa-miR-4633-3p	CLIP-seq
MIRT2145580	hsa-miR-4651	CLIP-seq
MIRT1483585	hsa-miR-4659a-3p	CLIP-seq
MIRT1483586	hsa-miR-4659b-3p	CLIP-seq
MIRT2659538	hsa-miR-4664-5p	CLIP-seq
MIRT2366027	hsa-miR-4680-3p	CLIP-seq
MIRT1483588	hsa-miR-4698	CLIP-seq
MIRT1483589	hsa-miR-4699-3p	CLIP-seq
MIRT1483590	hsa-miR-4699-5p	CLIP-seq
MIRT1483591	hsa-miR-4703-5p	CLIP-seq
MIRT1483592	hsa-miR-4704-5p	CLIP-seq
MIRT2366028	hsa-miR-4705	CLIP-seq
MIRT1483593	hsa-miR-4708-3p	CLIP-seq
MIRT2145581	hsa-miR-4713-5p	CLIP-seq
MIRT1483595	hsa-miR-4714-5p	CLIP-seq
MIRT1483596	hsa-miR-4721	CLIP-seq
MIRT1483598	hsa-miR-4729	CLIP-seq
MIRT1483599	hsa-miR-4731-3p	CLIP-seq
MIRT1483602	hsa-miR-4748	CLIP-seq
MIRT1483605	hsa-miR-4766-3p	CLIP-seq
MIRT1483606	hsa-miR-4770	CLIP-seq
MIRT1483607	hsa-miR-4771	CLIP-seq
MIRT1483608	hsa-miR-4777-5p	CLIP-seq
MIRT1483610	hsa-miR-4801	CLIP-seq
MIRT1483611	hsa-miR-4803	CLIP-seq
MIRT1483612	hsa-miR-485-3p	CLIP-seq
MIRT2659539	hsa-miR-488	CLIP-seq
MIRT1483613	hsa-miR-490-3p	CLIP-seq
MIRT1483615	hsa-miR-503	CLIP-seq
MIRT1483616	hsa-miR-5047	CLIP-seq
MIRT1483617	hsa-miR-515-3p	CLIP-seq
MIRT2145582	hsa-miR-515-5p	CLIP-seq
MIRT1483618	hsa-miR-518d-5p	CLIP-seq
MIRT1483619	hsa-miR-519b-5p	CLIP-seq
MIRT1483620	hsa-miR-519c-5p	CLIP-seq
MIRT1483621	hsa-miR-519d	CLIP-seq
MIRT1483622	hsa-miR-519e	CLIP-seq
MIRT1483623	hsa-miR-520c-5p	CLIP-seq
MIRT1483624	hsa-miR-520d-5p	CLIP-seq
MIRT1483625	hsa-miR-520g	CLIP-seq
MIRT1483626	hsa-miR-520h	CLIP-seq
MIRT1483627	hsa-miR-524-5p	CLIP-seq
MIRT1483628	hsa-miR-526a	CLIP-seq
MIRT1483630	hsa-miR-548q	CLIP-seq
MIRT1483631	hsa-miR-569	CLIP-seq
MIRT1483633	hsa-miR-579	CLIP-seq
MIRT1483635	hsa-miR-590-5p	CLIP-seq
MIRT1483636	hsa-miR-595	CLIP-seq
MIRT1483637	hsa-miR-603	CLIP-seq
MIRT2145583	hsa-miR-608	CLIP-seq
MIRT1483638	hsa-miR-619	CLIP-seq
MIRT1483639	hsa-miR-649	CLIP-seq
MIRT1483640	hsa-miR-656	CLIP-seq
MIRT1483642	hsa-miR-664	CLIP-seq
MIRT1483643	hsa-miR-671-5p	CLIP-seq
MIRT1483645	hsa-miR-764	CLIP-seq
MIRT1483646	hsa-miR-873	CLIP-seq
MIRT1483647	hsa-miR-875-3p	CLIP-seq
MIRT1483648	hsa-miR-888	CLIP-seq
MIRT1483649	hsa-miR-93	CLIP-seq
MIRT1483650	hsa-miR-935	CLIP-seq
MIRT2366031	hsa-miR-944	CLIP-seq
MIRT2366020	hsa-miR-1252	CLIP-seq
MIRT1483521	hsa-miR-125a-3p	CLIP-seq
MIRT2145577	hsa-miR-1272	CLIP-seq
MIRT1483523	hsa-miR-1292	CLIP-seq
MIRT2659535	hsa-miR-129-5p	CLIP-seq
MIRT1483525	hsa-miR-1299	CLIP-seq
MIRT1483527	hsa-miR-140-3p	CLIP-seq
MIRT1483528	hsa-miR-143	CLIP-seq
MIRT1483530	hsa-miR-183	CLIP-seq
MIRT1483534	hsa-miR-21	CLIP-seq
MIRT1483536	hsa-miR-296-3p	CLIP-seq
MIRT1483539	hsa-miR-3120-5p	CLIP-seq
MIRT1483540	hsa-miR-3135b	CLIP-seq
MIRT2366022	hsa-miR-3140-5p	CLIP-seq
MIRT1483541	hsa-miR-3156-5p	CLIP-seq
MIRT1483542	hsa-miR-3158-5p	CLIP-seq
MIRT1483543	hsa-miR-3162-5p	CLIP-seq
MIRT1483544	hsa-miR-3166	CLIP-seq
MIRT1483546	hsa-miR-3182	CLIP-seq
MIRT1483547	hsa-miR-3202	CLIP-seq
MIRT1483548	hsa-miR-320b	CLIP-seq
MIRT1483549	hsa-miR-320d	CLIP-seq
MIRT1483550	hsa-miR-324-5p	CLIP-seq
MIRT1483551	hsa-miR-329	CLIP-seq
MIRT2659536	hsa-miR-342-5p	CLIP-seq
MIRT2145578	hsa-miR-3545-3p	CLIP-seq
MIRT2366023	hsa-miR-3607-5p	CLIP-seq
MIRT1483552	hsa-miR-3613-3p	CLIP-seq
MIRT1483553	hsa-miR-3620	CLIP-seq
MIRT1483554	hsa-miR-362-3p	CLIP-seq
MIRT1483557	hsa-miR-3664-5p	CLIP-seq
MIRT2145579	hsa-miR-3682-3p	CLIP-seq
MIRT1483558	hsa-miR-3686	CLIP-seq
MIRT1483559	hsa-miR-3690	CLIP-seq
MIRT2366025	hsa-miR-377	CLIP-seq
MIRT1483562	hsa-miR-3908	CLIP-seq
MIRT1483563	hsa-miR-3926	CLIP-seq
MIRT1483564	hsa-miR-3934	CLIP-seq
MIRT1483565	hsa-miR-3941	CLIP-seq
MIRT1483566	hsa-miR-3942-5p	CLIP-seq
MIRT2659537	hsa-miR-3978	CLIP-seq
MIRT1483567	hsa-miR-4254	CLIP-seq
MIRT1483568	hsa-miR-4275	CLIP-seq
MIRT1483570	hsa-miR-4299	CLIP-seq
MIRT1483572	hsa-miR-4311	CLIP-seq
MIRT1483573	hsa-miR-4429	CLIP-seq
MIRT1483576	hsa-miR-4456	CLIP-seq
MIRT1483577	hsa-miR-4464	CLIP-seq
MIRT1483578	hsa-miR-4471	CLIP-seq
MIRT1483582	hsa-miR-4533	CLIP-seq
MIRT1483583	hsa-miR-4633-3p	CLIP-seq
MIRT2145580	hsa-miR-4651	CLIP-seq
MIRT1483585	hsa-miR-4659a-3p	CLIP-seq
MIRT1483586	hsa-miR-4659b-3p	CLIP-seq
MIRT2659538	hsa-miR-4664-5p	CLIP-seq
MIRT2366027	hsa-miR-4680-3p	CLIP-seq
MIRT1483588	hsa-miR-4698	CLIP-seq
MIRT1483590	hsa-miR-4699-5p	CLIP-seq
MIRT1483591	hsa-miR-4703-5p	CLIP-seq
MIRT2366028	hsa-miR-4705	CLIP-seq
MIRT1483593	hsa-miR-4708-3p	CLIP-seq
MIRT1483595	hsa-miR-4714-5p	CLIP-seq
MIRT1483596	hsa-miR-4721	CLIP-seq
MIRT1483599	hsa-miR-4731-3p	CLIP-seq
MIRT1483602	hsa-miR-4748	CLIP-seq
MIRT1483605	hsa-miR-4766-3p	CLIP-seq
MIRT1483606	hsa-miR-4770	CLIP-seq
MIRT1483607	hsa-miR-4771	CLIP-seq
MIRT1483610	hsa-miR-4801	CLIP-seq
MIRT1483611	hsa-miR-4803	CLIP-seq
MIRT1483612	hsa-miR-485-3p	CLIP-seq
MIRT2659539	hsa-miR-488	CLIP-seq
MIRT1483613	hsa-miR-490-3p	CLIP-seq
MIRT1483615	hsa-miR-503	CLIP-seq
MIRT2145582	hsa-miR-515-5p	CLIP-seq
MIRT1483630	hsa-miR-548q	CLIP-seq
MIRT1483635	hsa-miR-590-5p	CLIP-seq
MIRT1483637	hsa-miR-603	CLIP-seq
MIRT2145583	hsa-miR-608	CLIP-seq
MIRT1483638	hsa-miR-619	CLIP-seq
MIRT1483639	hsa-miR-649	CLIP-seq
MIRT1483643	hsa-miR-671-5p	CLIP-seq
MIRT1483645	hsa-miR-764	CLIP-seq
MIRT1483647	hsa-miR-875-3p	CLIP-seq
MIRT1483650	hsa-miR-935	CLIP-seq
MIRT2366031	hsa-miR-944	CLIP-seq

Gene ontology (GO) Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001662	Process	Behavioral fear response	IEA
GO:0005244	Function	Voltage-gated monoatomic ion channel activity	IDA	8420959
GO:0005515	Function	Protein binding	IPI	9843949, 16201016, 19130895, 21370995, 22304920, 23055042, 25296756, 25556234, 26387735, 28514442, 29128334, 30021884, 30352685, 31046837, 31206022, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	30188326, 31206022
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005741	Component	Mitochondrial outer membrane	IDA	7539795, 17008324, 25244949
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005757	Component	Mitochondrial permeability transition pore complex	IDA	26387735
GO:0005886	Component	Plasma membrane	IDA	25296756
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006820	Process	Monoatomic anion transport	IDA	8420959
GO:0006869	Process	Lipid transport	IEA
GO:0006915	Process	Apoptotic process	IDA	25296756
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	10365962
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007270	Process	Neuron-neuron synaptic transmission	IEA
GO:0007612	Process	Learning	IEA
GO:0008142	Function	Oxysterol binding	IEA
GO:0008142	Function	Oxysterol binding	ISS
GO:0008289	Function	Lipid binding	IEA
GO:0008308	Function	Voltage-gated monoatomic anion channel activity	IBA
GO:0008308	Function	Voltage-gated monoatomic anion channel activity	IDA	38065946
GO:0008308	Function	Voltage-gated monoatomic anion channel activity	IEA
GO:0008308	Function	Voltage-gated monoatomic anion channel activity	ISS
GO:0008308	Function	Voltage-gated monoatomic anion channel activity	TAS
GO:0015288	Function	Porin activity	IEA
GO:0015485	Function	Cholesterol binding	IDA	31015432
GO:0016020	Component	Membrane	IDA	27641616
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0019901	Function	Protein kinase binding	IPI	21370995
GO:0030855	Process	Epithelial cell differentiation	IEP	21492153
GO:0031210	Function	Phosphatidylcholine binding	IDA	31015432
GO:0031966	Component	Mitochondrial membrane	IDA	31015432
GO:0036444	Process	Calcium import into the mitochondrion	ISS
GO:0042645	Component	Mitochondrial nucleoid	IDA	18063578
GO:0042802	Function	Identical protein binding	IPI	18832158
GO:0043065	Process	Positive regulation of apoptotic process	IDA	29907098
GO:0043066	Process	Negative regulation of apoptotic process	IMP	32047033
GO:0044325	Function	Transmembrane transporter binding	IPI	25296756
GO:0045121	Component	Membrane raft	IEA
GO:0045202	Component	Synapse	IEA
GO:0046930	Component	Pore complex	IEA
GO:0046930	Component	Pore complex	TAS	9843949
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0097001	Function	Ceramide binding	IDA	31015432
GO:0098656	Process	Monoatomic anion transmembrane transport	IEA
GO:0110099	Process	Negative regulation of calcium import into the mitochondrion	IMP	32047033
GO:1901524	Process	Regulation of mitophagy	IEA
GO:1903146	Process	Regulation of autophagy of mitochondrion	NAS	20098416
GO:1905091	Process	Positive regulation of type 2 mitophagy	IMP	32047033
GO:1990542	Process	Mitochondrial transmembrane transport	IDA	38065946
GO:2000378	Process	Negative regulation of reactive oxygen species metabolic process	IEA

Other IDs

• MIM: 604492
• HGNC: 12669
• e!Ensembl: ENSG00000213585

Protein

• UniProt ID: P21796
• Protein name: Non-selective voltage-gated ion channel VDAC1 (Outer mitochondrial membrane protein porin 1) (Plasmalemmal porin) (Porin 31HL) (Porin 31HM) (Voltage-dependent anion-selective channel protein 1) (VDAC-1) (hVDAC1)
• Protein function: Non-selective voltage-gated ion channel that mediates the transport of anions and cations through the mitochondrion outer membrane and plasma membrane (PubMed:10661876, PubMed:11845315, PubMed:18755977, PubMed:30061676, PubMed:8420959). The chan
• PDB: 2JK4 , 2K4T , 5JDP , 5XDN , 5XDO , 6G6U , 6G73 , 6TIQ , 6TIR , 7QI2 , 8J0O
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01459	Porin_3	3 → 276	Eukaryotic porin	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in erythrocytes (at protein level) (PubMed:27641616). Expressed in heart, liver and skeletal muscle (PubMed:8420959). {ECO:0000269|PubMed:27641616, ECO:0000269|PubMed:8420959}.
• Sequence:

  MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLET
  KYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKR
  EHINLGCDMDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQL
  HTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNS
  SLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA

• Sequence length: 283

Pathways

KEGG Pathway	Reactome Pathway
Calcium signaling pathway	Pink/Parkin Mediated Mitophagy
cGMP-PKG signaling pathway	Ub-specific processing proteases
Necroptosis	Pyruvate metabolism
Cellular senescence
Neutrophil extracellular trap formation
NOD-like receptor signaling pathway
Cholesterol metabolism
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Spinocerebellar ataxia
Prion disease
Pathways of neurodegeneration - multiple diseases
Shigellosis
Influenza A
Human T-cell leukemia virus 1 infection
Chemical carcinogenesis - reactive oxygen species
Diabetic cardiomyopathy

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (16)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ASTHMA	—	GWAS catalog	32296059	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	32581359, 37002690	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	37106081	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	19634143	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	17893921	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	30595370, 34594039, 39067062, 39789286, 41238958	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL MYOPATHIES	—	CTD, Disgenet CTD, Disgenet	8726225	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	21833088, 24076602, 31604244	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	25488258	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	37386247	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOMOTOR DISORDERS	—	CTD, Disgenet CTD, Disgenet	8726225	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	38965376	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	32868391, 33310728, 36333501	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	26502338, 27399966, 28714469, 33272962, 36750564	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION, LEFT	—	CTD	25488258	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (122)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28901260		★☆☆☆☆ Found in Text Mining only
Allan-Herndon-Dudley syndrome (AHDS)	Allan-Herndon-Dudley Syndrome	BEFREE	8733041		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	24063855	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26542804	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	20797535, 27721436, 28571556, 31474832		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	36350974	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	23333625	Associate	★☆☆☆☆ Found in Text Mining only
Awakening Epilepsy	Epilepsy	CTD_human_DG	17893921		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28824871		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	30305621, 31017259		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21297950, 25333947, 29185755, 31195298, 31452730		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33680287, 35729567, 36042412, 36750173, 37834358	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26831666, 27069917, 32436862	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25333947, 31167495		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26831666, 27069917, 37717471	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24272356, 30544833, 31195298, 31364685		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24970796, 32194829	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32436862	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	36056063	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	11583900	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	27796346		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28461778		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	26716410		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	27778231		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31167495		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	31167495	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27078856		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	35035669	Inhibit	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30327144		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29675103		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36333388	Associate	★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	28461778		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29630893		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	15571586		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	27030419		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	23880169		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	37834358	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Psychomotor Disorders	Psychomotor Disorders	CTD_human_DG	8726225		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29551631, 30293774		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29551631, 30293774		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28742858	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30293774		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	27796346		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	19634143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	39181068	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32829673	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	CTD_human_DG	17893921		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	17893921		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	19360286	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	39837946	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29673597		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29673597, 31375359		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27080741, 28339833, 28412744, 29698587, 30544833, 31195298, 31661894		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27080741, 28339833, 28412744, 29698587, 30544833, 31195298, 31661894		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	25333947	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30293774, 30767071, 31168903		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	31168903	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28461778		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29596470, 32810507	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32194829, 36803235	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28461778		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	28461778		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	35729567	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17417801, 18047543		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	29698587		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37344914, 38179723	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26831666, 29971501		★☆☆☆☆ Found in Text Mining only
Luft Disease	Luft Disease	CTD_human_DG	8726225		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28461778		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	25333947		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25333947	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	29196874		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21297950, 25333947, 29185755, 31195298, 31452730		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29747160		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24272356, 30544833, 31195298, 31364685		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25177836		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25333947		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19094960, 21297950, 24272356, 25333947, 25448878, 27080741, 27543313, 28339833, 28554318, 28618997, 28824871, 29551631, 29596470, 29682501, 29698587, 30544833, 30899431, 31195298, 31452730, 31542392, 31582380, 31661894		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30327144		★☆☆☆☆ Found in Text Mining only
Megaconial Myopathies	Megaconial Myopathies	CTD_human_DG	8726225		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19383853	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26462148		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	27761954		★☆☆☆☆ Found in Text Mining only
Mitochondrial Complex III Deficiency	Mitochondrial complex deficiency	Pubtator	28431142	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	20028813, 24880043, 33691089, 37717471	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Encephalomyopathies	Mitochondrial encephalomyopathy	BEFREE	10049775		★☆☆☆☆ Found in Text Mining only
Mitochondrial Myopathies	Mitochondrial myopathy	CTD_human_DG	8726225		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	31542386		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21297950		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37700273	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	25488258		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	29630893		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	15254372		★☆☆☆☆ Found in Text Mining only
MYOPATHY, MYOFIBRILLAR, DESMIN-RELATED	Myofibrillar myopathy	BEFREE	27941998		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21297950, 22589539, 23902561, 25448878, 26716410, 26831666, 27080741, 28339833, 28824871, 28918503, 29596470, 30544833, 31582380, 31661894		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28571556		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20930307, 24063855		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	27064145, 32810507	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	35258800	Stimulate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28571556, 28618997		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	19634143		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20646307, 21297950, 31582380		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	36871636	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33802591	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24825319, 28571556, 31309116		★☆☆☆☆ Found in Text Mining only
Patterned dystrophy of retinal pigment epithelium	Patterned macular dystrophy	Pubtator	39181068	Associate	★☆☆☆☆ Found in Text Mining only
Pleoconial Myopathies	Pleoconial myopathy	CTD_human_DG	8726225		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34480296	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25177836		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31914854	Associate	★☆☆☆☆ Found in Text Mining only
Psychomotor Disorders	Psychomotor Disorders	CTD_human_DG	8726225		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Insufficiency	Renal Insufficiency	BEFREE	31618620		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30339841		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Steatohepatitis	Fatty Liver	BEFREE	29673597, 31375359		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26646027, 37296105	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25333947		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30544833, 31195298		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	33680287	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	27419626	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26472185, 26716410, 27419626, 32436862, 33000213	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30522557		★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	33082910	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

VDAC2 2 shared diseasesDiabetic neuropathy, Epilepsy 14 shared pathwaysCalcium signaling pathway, cGMP-PKG signaling pathway, Necroptosis, Cellular senescence, Neutrophil extracellular trap formation, NOD-like receptor signaling pathway, Cholesterol metabolism, Parkinson disease, Spinocerebellar ataxia, Prion disease, Human T-cell leukemia virus 1 infection, Chemical carcinogenesis - reactive oxygen species +2 more 4 shared evidence sourcesCTD (Diabetic neuropathy), Disgenet (Diabetic neuropathy), CTD (Epilepsy), Disgenet (Epilepsy) Related via 14 shared pathways including Calcium signaling pathway, cGMP-PKG signaling pathway — evidence mostly CTD. TCF7 3 shared diseasesAutoimmune thyroid disease, Cancer, Respiratory system disease 3 shared evidence sourcesGWAS catalog (Autoimmune thyroid disease), GWAS catalog (Cancer), GWAS catalog (Respiratory system disease) Related via 3 shared diseases including Autoimmune thyroid disease, Cancer — evidence mostly GWAS catalog. VDAC3 14 shared pathwaysCalcium signaling pathway, cGMP-PKG signaling pathway, Necroptosis, Cellular senescence, Neutrophil extracellular trap formation, NOD-like receptor signaling pathway, Cholesterol metabolism, Parkinson disease, Spinocerebellar ataxia, Prion disease, Human T-cell leukemia virus 1 infection, Chemical carcinogenesis - reactive oxygen species +2 more Related via 14 shared pathways including Calcium signaling pathway, cGMP-PKG signaling pathway. SLC25A31 12 shared pathwaysCalcium signaling pathway, cGMP-PKG signaling pathway, Necroptosis, Cellular senescence, Neutrophil extracellular trap formation, Parkinson disease, Spinocerebellar ataxia, Prion disease, Influenza A, Human T-cell leukemia virus 1 infection, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy Related via 12 shared pathways including Calcium signaling pathway, cGMP-PKG signaling pathway. SLC25A5 12 shared pathwaysCalcium signaling pathway, cGMP-PKG signaling pathway, Necroptosis, Cellular senescence, Neutrophil extracellular trap formation, Parkinson disease, Spinocerebellar ataxia, Prion disease, Influenza A, Human T-cell leukemia virus 1 infection, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy Related via 12 shared pathways including Calcium signaling pathway, cGMP-PKG signaling pathway.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
VDAC2	2	["Diabetic neuropathy","Epilepsy"]	14	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","NOD-like receptor signaling pathway","Cholesterol metabolism","Parkinson disease","Spinocerebellar ataxia","Prion disease","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species"]	4	["CTD (Diabetic neuropathy)","Disgenet (Diabetic neuropathy)","CTD (Epilepsy)","Disgenet (Epilepsy)"]
TCF7	3	["Autoimmune thyroid disease","Cancer","Respiratory system disease"]	0	[]	3	["GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Cancer)","GWAS catalog (Respiratory system disease)"]
VDAC3	0	[]	14	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","NOD-like receptor signaling pathway","Cholesterol metabolism","Parkinson disease","Spinocerebellar ataxia","Prion disease","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species"]	0	[]
SLC25A31	0	[]	12	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","Parkinson disease","Spinocerebellar ataxia","Prion disease","Influenza A","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	0	[]
SLC25A5	0	[]	12	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","Parkinson disease","Spinocerebellar ataxia","Prion disease","Influenza A","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	0	[]

Diseases Linked via Similar Genes

Squamous cell carcinoma Linked via 1 of 5 related genesVDAC2 Mouth neoplasms Linked via 1 of 5 related genesVDAC2 Osteoarthritis Linked via 1 of 5 related genesVDAC2 Severe combined immunodeficiency Linked via 1 of 5 related genesVDAC2 Crohn disease Linked via 1 of 5 related genesTCF7

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Squamous cell carcinoma	1	["VDAC2"]
Mouth neoplasms	1	["VDAC2"]
Osteoarthritis	1	["VDAC2"]
Severe combined immunodeficiency	1	["VDAC2"]
Crohn disease	1	["TCF7"]