SLC25A31 (solute carrier family 25 member 31)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 83447
• Gene name: Solute carrier family 25 member 31
• Gene symbol: SLC25A31
• Synonyms (NCBI Gene): AAC4, ANT 4, ANT4, SFEC35kDa
• Chromosome: 4
• Chromosome location: 4q28.1
• Summary: The protein encoded by this gene is a member of the ADP/ATP carrier family of proteins that exchange cytosolic ADP for matrix ATP in the mitochondria. Cells over-expressing this gene have been shown to display an anti-apoptotic phenotype. This protein is

miRNA Show/Hide all (14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018887	hsa-miR-335-5p	Microarray	18185580
MIRT1356212	hsa-miR-3159	CLIP-seq
MIRT1356213	hsa-miR-3685	CLIP-seq
MIRT1356214	hsa-miR-375	CLIP-seq
MIRT1356215	hsa-miR-384	CLIP-seq
MIRT1356216	hsa-miR-4263	CLIP-seq
MIRT1356217	hsa-miR-4273	CLIP-seq
MIRT1356218	hsa-miR-4662a-3p	CLIP-seq
MIRT1356219	hsa-miR-4677-5p	CLIP-seq
MIRT1356220	hsa-miR-4775	CLIP-seq
MIRT1356221	hsa-miR-579	CLIP-seq
MIRT1356222	hsa-miR-590-3p	CLIP-seq
MIRT2624175	hsa-miR-451b	CLIP-seq
MIRT2624175	hsa-miR-451b	CLIP-seq

Gene ontology (GO) Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005471	Function	ATP:ADP antiporter activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005757	Component	Mitochondrial permeability transition pore complex	IEA
GO:0005757	Component	Mitochondrial permeability transition pore complex	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0005929	Component	Cilium	IEA
GO:0007141	Process	Male meiosis I	IEA
GO:0007141	Process	Male meiosis I	ISS
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0015297	Function	Antiporter activity	IEA
GO:0016020	Component	Membrane	IDA	27641616
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0042995	Component	Cell projection	IEA
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IEA
GO:0046902	Process	Regulation of mitochondrial membrane permeability	ISS
GO:0055085	Process	Transmembrane transport	IEA
GO:0140021	Process	Mitochondrial ADP transmembrane transport	IEA
GO:1901029	Process	Negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IBA
GO:1990544	Process	Mitochondrial ATP transmembrane transport	IEA

Other IDs

• MIM: 610796
• HGNC: 25319
• e!Ensembl: ENSG00000151475

Protein

• UniProt ID: Q9H0C2
• Protein name: ADP/ATP translocase 4 (ADP,ATP carrier protein 4) (Adenine nucleotide translocator 4) (ANT 4) (Solute carrier family 25 member 31) (Sperm flagellar energy carrier protein)
• Protein function: ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell (By similarity) (PubMed:15670820). Cycles between the cytoplasmic-open state (c-state) and the matrix-open sta
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00153	Mito_carr	16 → 115	Mitochondrial carrier protein	Family
  PF00153	Mito_carr	121 → 218	Mitochondrial carrier protein	Family
  PF00153	Mito_carr	218 → 311	Mitochondrial carrier protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain, liver, sperm and testis (PubMed:15670820, PubMed:17137571). In testis, expressed at higher level in spermatocytes, while it is expressed at lower level in spermatogonial cells (PubMed:17681941). Expressed in erythro
• Sequence:

  MHREPAKKKAEKRLFDASSFGKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPE
  ARYKGMVDCLVRIPREQGFFSFWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVNKEKQ
  FWRWFLANLASGGAAGATSLCVVYPLDFARTRLGVDIGKGPEERQFKGLGDCIMKIAKSD
  GIAGLYQGFGVSVQGIIVYRASYFGAYDTVKGLLPKPKKTPFLVSFFIAQVVTTCSGILS
  YPFDTVRRRMMMQSGEAKRQYKGTLDCFVKIYQHEGISSFFRGAFSNVLRGTGGALVLVL
  YDKIKEFFHIDIGGR

• Sequence length: 315

Pathways

KEGG Pathway

Calcium signaling pathway

cGMP-PKG signaling pathway

Necroptosis

Cellular senescence

Neutrophil extracellular trap formation

Alzheimer disease

Parkinson disease

Huntington disease

Spinocerebellar ataxia

Prion disease

Pathways of neurodegeneration - multiple diseases

Influenza A

Human T-cell leukemia virus 1 infection

Chemical carcinogenesis - reactive oxygen species

Diabetic cardiomyopathy

Related Genes

Sort by: Blended Diseases Pathways Evidence source

SLC25A5 12 shared pathwaysCalcium signaling pathway, cGMP-PKG signaling pathway, Necroptosis, Cellular senescence, Neutrophil extracellular trap formation, Parkinson disease, Spinocerebellar ataxia, Prion disease, Influenza A, Human T-cell leukemia virus 1 infection, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy Related via 12 shared pathways including Calcium signaling pathway, cGMP-PKG signaling pathway. SLC25A4 12 shared pathwaysCalcium signaling pathway, cGMP-PKG signaling pathway, Necroptosis, Cellular senescence, Neutrophil extracellular trap formation, Parkinson disease, Spinocerebellar ataxia, Prion disease, Influenza A, Human T-cell leukemia virus 1 infection, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy Related via 12 shared pathways including Calcium signaling pathway, cGMP-PKG signaling pathway. SLC25A6 12 shared pathwaysCalcium signaling pathway, cGMP-PKG signaling pathway, Necroptosis, Cellular senescence, Neutrophil extracellular trap formation, Parkinson disease, Spinocerebellar ataxia, Prion disease, Influenza A, Human T-cell leukemia virus 1 infection, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy Related via 12 shared pathways including Calcium signaling pathway, cGMP-PKG signaling pathway. VDAC2 11 shared pathwaysCalcium signaling pathway, cGMP-PKG signaling pathway, Necroptosis, Cellular senescence, Neutrophil extracellular trap formation, Parkinson disease, Spinocerebellar ataxia, Prion disease, Human T-cell leukemia virus 1 infection, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy Related via 11 shared pathways including Calcium signaling pathway, cGMP-PKG signaling pathway. VDAC1 12 shared pathwaysCalcium signaling pathway, cGMP-PKG signaling pathway, Necroptosis, Cellular senescence, Neutrophil extracellular trap formation, Parkinson disease, Spinocerebellar ataxia, Prion disease, Influenza A, Human T-cell leukemia virus 1 infection, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy Related via 12 shared pathways including Calcium signaling pathway, cGMP-PKG signaling pathway.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SLC25A5	0	[]	12	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","Parkinson disease","Spinocerebellar ataxia","Prion disease","Influenza A","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	0	[]
SLC25A4	0	[]	12	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","Parkinson disease","Spinocerebellar ataxia","Prion disease","Influenza A","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	0	[]
SLC25A6	0	[]	12	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","Parkinson disease","Spinocerebellar ataxia","Prion disease","Influenza A","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	0	[]
VDAC2	0	[]	11	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","Parkinson disease","Spinocerebellar ataxia","Prion disease","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	0	[]
VDAC1	0	[]	12	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","Parkinson disease","Spinocerebellar ataxia","Prion disease","Influenza A","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	0	[]

Diseases Linked via Similar Genes

Mitochondrial myopathy Linked via 2 of 5 related genesSLC25A4, VDAC1 Diabetic neuropathy Linked via 2 of 5 related genesVDAC2, VDAC1 Epilepsy Linked via 2 of 5 related genesVDAC2, VDAC1 Gout Linked via 1 of 5 related genesSLC25A5 Intellectual developmental disorder Linked via 1 of 5 related genesSLC25A5

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Mitochondrial myopathy	2	["SLC25A4","VDAC1"]
Diabetic neuropathy	2	["VDAC2","VDAC1"]
Epilepsy	2	["VDAC2","VDAC1"]
Gout	1	["SLC25A5"]
Intellectual developmental disorder	1	["SLC25A5"]