Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	292
Gene name	Solute carrier family 25 member 5
Gene symbol	SLC25A5
Synonyms (NCBI Gene)	2F1AAC2ANT2T2T3
Chromosome	X
Chromosome location	Xq24
Summary	This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix i

259 Show/Hide all (259)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050085	hsa-miR-26a-5p	CLASH	23622248
MIRT047644	hsa-miR-10a-5p	CLASH	23622248
MIRT047467	hsa-miR-10b-5p	CLASH	23622248
MIRT046196	hsa-miR-27b-3p	CLASH	23622248
MIRT044296	hsa-miR-106b-5p	CLASH	23622248
MIRT044064	hsa-miR-361-5p	CLASH	23622248
MIRT040669	hsa-miR-92b-3p	CLASH	23622248
MIRT037259	hsa-miR-877-5p	CLASH	23622248
MIRT052814	hsa-miR-3198	CLASH	23622248
MIRT438754	hsa-miR-636	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23306701
MIRT438754	hsa-miR-636	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23306701
MIRT1357386	hsa-miR-1245b-3p	CLIP-seq
MIRT1357387	hsa-miR-1305	CLIP-seq
MIRT1357388	hsa-miR-134	CLIP-seq
MIRT1357389	hsa-miR-135a	CLIP-seq
MIRT1357390	hsa-miR-135b	CLIP-seq
MIRT1357391	hsa-miR-137	CLIP-seq
MIRT1357392	hsa-miR-190	CLIP-seq
MIRT1357393	hsa-miR-190b	CLIP-seq
MIRT1357394	hsa-miR-2115	CLIP-seq
MIRT1357395	hsa-miR-2277-3p	CLIP-seq
MIRT1357396	hsa-miR-2681	CLIP-seq
MIRT1357397	hsa-miR-27a	CLIP-seq
MIRT1357398	hsa-miR-27b	CLIP-seq
MIRT1357399	hsa-miR-3064-3p	CLIP-seq
MIRT1357400	hsa-miR-3118	CLIP-seq
MIRT1357401	hsa-miR-3119	CLIP-seq
MIRT1357402	hsa-miR-3121-3p	CLIP-seq
MIRT1357403	hsa-miR-3136-5p	CLIP-seq
MIRT1357404	hsa-miR-3145-3p	CLIP-seq
MIRT1357405	hsa-miR-3658	CLIP-seq
MIRT1357406	hsa-miR-3688-3p	CLIP-seq
MIRT1357407	hsa-miR-369-3p	CLIP-seq
MIRT1357408	hsa-miR-374a	CLIP-seq
MIRT1357409	hsa-miR-374b	CLIP-seq
MIRT1357410	hsa-miR-374c	CLIP-seq
MIRT1357411	hsa-miR-3977	CLIP-seq
MIRT1357412	hsa-miR-410	CLIP-seq
MIRT1357413	hsa-miR-4252	CLIP-seq
MIRT1357414	hsa-miR-4294	CLIP-seq
MIRT1357415	hsa-miR-4433	CLIP-seq
MIRT1357416	hsa-miR-4439	CLIP-seq
MIRT1357417	hsa-miR-4459	CLIP-seq
MIRT1357418	hsa-miR-4513	CLIP-seq
MIRT1357419	hsa-miR-4666-3p	CLIP-seq
MIRT1357420	hsa-miR-4715-3p	CLIP-seq
MIRT1357421	hsa-miR-4716-3p	CLIP-seq
MIRT1357422	hsa-miR-4760-5p	CLIP-seq
MIRT1357423	hsa-miR-4768-3p	CLIP-seq
MIRT1357424	hsa-miR-4795-3p	CLIP-seq
MIRT1357425	hsa-miR-490-5p	CLIP-seq
MIRT1357426	hsa-miR-513a-5p	CLIP-seq
MIRT1357427	hsa-miR-515-5p	CLIP-seq
MIRT1357428	hsa-miR-516a-3p	CLIP-seq
MIRT1357429	hsa-miR-548a-3p	CLIP-seq
MIRT1357430	hsa-miR-548e	CLIP-seq
MIRT1357431	hsa-miR-548f	CLIP-seq
MIRT1357432	hsa-miR-582-3p	CLIP-seq
MIRT1357433	hsa-miR-627	CLIP-seq
MIRT1357434	hsa-miR-655	CLIP-seq
MIRT1357435	hsa-miR-656	CLIP-seq
MIRT1357436	hsa-miR-665	CLIP-seq
MIRT1357386	hsa-miR-1245b-3p	CLIP-seq
MIRT1357389	hsa-miR-135a	CLIP-seq
MIRT1357390	hsa-miR-135b	CLIP-seq
MIRT1357391	hsa-miR-137	CLIP-seq
MIRT1357392	hsa-miR-190	CLIP-seq
MIRT1357393	hsa-miR-190b	CLIP-seq
MIRT1357394	hsa-miR-2115	CLIP-seq
MIRT1357395	hsa-miR-2277-3p	CLIP-seq
MIRT1357396	hsa-miR-2681	CLIP-seq
MIRT1357397	hsa-miR-27a	CLIP-seq
MIRT1357398	hsa-miR-27b	CLIP-seq
MIRT1357399	hsa-miR-3064-3p	CLIP-seq
MIRT1357401	hsa-miR-3119	CLIP-seq
MIRT1357402	hsa-miR-3121-3p	CLIP-seq
MIRT2105833	hsa-miR-3148	CLIP-seq
MIRT1357405	hsa-miR-3658	CLIP-seq
MIRT1357406	hsa-miR-3688-3p	CLIP-seq
MIRT1357407	hsa-miR-369-3p	CLIP-seq
MIRT1357408	hsa-miR-374a	CLIP-seq
MIRT1357409	hsa-miR-374b	CLIP-seq
MIRT1357410	hsa-miR-374c	CLIP-seq
MIRT1357411	hsa-miR-3977	CLIP-seq
MIRT1357412	hsa-miR-410	CLIP-seq
MIRT2105834	hsa-miR-4251	CLIP-seq
MIRT1357413	hsa-miR-4252	CLIP-seq
MIRT1357414	hsa-miR-4294	CLIP-seq
MIRT1357415	hsa-miR-4433	CLIP-seq
MIRT1357419	hsa-miR-4666-3p	CLIP-seq
MIRT2105835	hsa-miR-4668-3p	CLIP-seq
MIRT2105836	hsa-miR-4668-5p	CLIP-seq
MIRT1357420	hsa-miR-4715-3p	CLIP-seq
MIRT1357421	hsa-miR-4716-3p	CLIP-seq
MIRT2105837	hsa-miR-4738-3p	CLIP-seq
MIRT1357424	hsa-miR-4795-3p	CLIP-seq
MIRT1357425	hsa-miR-490-5p	CLIP-seq
MIRT1357426	hsa-miR-513a-5p	CLIP-seq
MIRT1357428	hsa-miR-516a-3p	CLIP-seq
MIRT2105838	hsa-miR-539	CLIP-seq
MIRT2105839	hsa-miR-548c-3p	CLIP-seq
MIRT2105840	hsa-miR-625	CLIP-seq
MIRT1357433	hsa-miR-627	CLIP-seq
MIRT1357434	hsa-miR-655	CLIP-seq
MIRT1357435	hsa-miR-656	CLIP-seq
MIRT1357436	hsa-miR-665	CLIP-seq
MIRT1357386	hsa-miR-1245b-3p	CLIP-seq
MIRT1357388	hsa-miR-134	CLIP-seq
MIRT1357392	hsa-miR-190	CLIP-seq
MIRT1357393	hsa-miR-190b	CLIP-seq
MIRT1357395	hsa-miR-2277-3p	CLIP-seq
MIRT1357397	hsa-miR-27a	CLIP-seq
MIRT1357398	hsa-miR-27b	CLIP-seq
MIRT1357400	hsa-miR-3118	CLIP-seq
MIRT1357403	hsa-miR-3136-5p	CLIP-seq
MIRT2105833	hsa-miR-3148	CLIP-seq
MIRT2330312	hsa-miR-3660	CLIP-seq
MIRT1357407	hsa-miR-369-3p	CLIP-seq
MIRT1357410	hsa-miR-374c	CLIP-seq
MIRT2105834	hsa-miR-4251	CLIP-seq
MIRT1357413	hsa-miR-4252	CLIP-seq
MIRT1357414	hsa-miR-4294	CLIP-seq
MIRT1357415	hsa-miR-4433	CLIP-seq
MIRT1357416	hsa-miR-4439	CLIP-seq
MIRT1357418	hsa-miR-4513	CLIP-seq
MIRT2330313	hsa-miR-4526	CLIP-seq
MIRT1357419	hsa-miR-4666-3p	CLIP-seq
MIRT2105835	hsa-miR-4668-3p	CLIP-seq
MIRT2105836	hsa-miR-4668-5p	CLIP-seq
MIRT1357421	hsa-miR-4716-3p	CLIP-seq
MIRT2105837	hsa-miR-4738-3p	CLIP-seq
MIRT1357424	hsa-miR-4795-3p	CLIP-seq
MIRT1357426	hsa-miR-513a-5p	CLIP-seq
MIRT2105838	hsa-miR-539	CLIP-seq
MIRT1357429	hsa-miR-548a-3p	CLIP-seq
MIRT2105839	hsa-miR-548c-3p	CLIP-seq
MIRT1357430	hsa-miR-548e	CLIP-seq
MIRT1357431	hsa-miR-548f	CLIP-seq
MIRT1357432	hsa-miR-582-3p	CLIP-seq
MIRT2105840	hsa-miR-625	CLIP-seq
MIRT1357433	hsa-miR-627	CLIP-seq
MIRT1357434	hsa-miR-655	CLIP-seq
MIRT1357435	hsa-miR-656	CLIP-seq
MIRT1357436	hsa-miR-665	CLIP-seq
MIRT1357389	hsa-miR-135a	CLIP-seq
MIRT1357390	hsa-miR-135b	CLIP-seq
MIRT1357396	hsa-miR-2681	CLIP-seq
MIRT1357401	hsa-miR-3119	CLIP-seq
MIRT1357405	hsa-miR-3658	CLIP-seq
MIRT1357406	hsa-miR-3688-3p	CLIP-seq
MIRT1357425	hsa-miR-490-5p	CLIP-seq
MIRT1357395	hsa-miR-2277-3p	CLIP-seq
MIRT1357414	hsa-miR-4294	CLIP-seq
MIRT1357415	hsa-miR-4433	CLIP-seq
MIRT1357436	hsa-miR-665	CLIP-seq
MIRT1357386	hsa-miR-1245b-3p	CLIP-seq
MIRT1357387	hsa-miR-1305	CLIP-seq
MIRT1357389	hsa-miR-135a	CLIP-seq
MIRT1357390	hsa-miR-135b	CLIP-seq
MIRT1357391	hsa-miR-137	CLIP-seq
MIRT1357392	hsa-miR-190	CLIP-seq
MIRT1357393	hsa-miR-190b	CLIP-seq
MIRT1357394	hsa-miR-2115	CLIP-seq
MIRT1357395	hsa-miR-2277-3p	CLIP-seq
MIRT1357396	hsa-miR-2681	CLIP-seq
MIRT1357397	hsa-miR-27a	CLIP-seq
MIRT1357398	hsa-miR-27b	CLIP-seq
MIRT1357399	hsa-miR-3064-3p	CLIP-seq
MIRT1357401	hsa-miR-3119	CLIP-seq
MIRT1357402	hsa-miR-3121-3p	CLIP-seq
MIRT2105833	hsa-miR-3148	CLIP-seq
MIRT1357405	hsa-miR-3658	CLIP-seq
MIRT2330312	hsa-miR-3660	CLIP-seq
MIRT1357406	hsa-miR-3688-3p	CLIP-seq
MIRT1357407	hsa-miR-369-3p	CLIP-seq
MIRT1357408	hsa-miR-374a	CLIP-seq
MIRT1357409	hsa-miR-374b	CLIP-seq
MIRT1357410	hsa-miR-374c	CLIP-seq
MIRT1357411	hsa-miR-3977	CLIP-seq
MIRT1357412	hsa-miR-410	CLIP-seq
MIRT2105834	hsa-miR-4251	CLIP-seq
MIRT1357413	hsa-miR-4252	CLIP-seq
MIRT1357414	hsa-miR-4294	CLIP-seq
MIRT1357415	hsa-miR-4433	CLIP-seq
MIRT2624385	hsa-miR-4496	CLIP-seq
MIRT2330313	hsa-miR-4526	CLIP-seq
MIRT1357419	hsa-miR-4666-3p	CLIP-seq
MIRT2105835	hsa-miR-4668-3p	CLIP-seq
MIRT2105836	hsa-miR-4668-5p	CLIP-seq
MIRT1357420	hsa-miR-4715-3p	CLIP-seq
MIRT1357421	hsa-miR-4716-3p	CLIP-seq
MIRT2105837	hsa-miR-4738-3p	CLIP-seq
MIRT1357424	hsa-miR-4795-3p	CLIP-seq
MIRT1357425	hsa-miR-490-5p	CLIP-seq
MIRT1357426	hsa-miR-513a-5p	CLIP-seq
MIRT1357428	hsa-miR-516a-3p	CLIP-seq
MIRT2105838	hsa-miR-539	CLIP-seq
MIRT1357429	hsa-miR-548a-3p	CLIP-seq
MIRT2105839	hsa-miR-548c-3p	CLIP-seq
MIRT1357430	hsa-miR-548e	CLIP-seq
MIRT1357431	hsa-miR-548f	CLIP-seq
MIRT1357432	hsa-miR-582-3p	CLIP-seq
MIRT2105840	hsa-miR-625	CLIP-seq
MIRT1357433	hsa-miR-627	CLIP-seq
MIRT1357434	hsa-miR-655	CLIP-seq
MIRT1357435	hsa-miR-656	CLIP-seq
MIRT1357436	hsa-miR-665	CLIP-seq
MIRT1357386	hsa-miR-1245b-3p	CLIP-seq
MIRT1357387	hsa-miR-1305	CLIP-seq
MIRT1357389	hsa-miR-135a	CLIP-seq
MIRT1357390	hsa-miR-135b	CLIP-seq
MIRT1357391	hsa-miR-137	CLIP-seq
MIRT1357392	hsa-miR-190	CLIP-seq
MIRT1357393	hsa-miR-190b	CLIP-seq
MIRT1357394	hsa-miR-2115	CLIP-seq
MIRT1357395	hsa-miR-2277-3p	CLIP-seq
MIRT1357396	hsa-miR-2681	CLIP-seq
MIRT1357397	hsa-miR-27a	CLIP-seq
MIRT1357398	hsa-miR-27b	CLIP-seq
MIRT1357399	hsa-miR-3064-3p	CLIP-seq
MIRT1357401	hsa-miR-3119	CLIP-seq
MIRT1357402	hsa-miR-3121-3p	CLIP-seq
MIRT2105833	hsa-miR-3148	CLIP-seq
MIRT1357405	hsa-miR-3658	CLIP-seq
MIRT2330312	hsa-miR-3660	CLIP-seq
MIRT1357406	hsa-miR-3688-3p	CLIP-seq
MIRT1357407	hsa-miR-369-3p	CLIP-seq
MIRT1357408	hsa-miR-374a	CLIP-seq
MIRT1357409	hsa-miR-374b	CLIP-seq
MIRT1357410	hsa-miR-374c	CLIP-seq
MIRT1357411	hsa-miR-3977	CLIP-seq
MIRT1357412	hsa-miR-410	CLIP-seq
MIRT2105834	hsa-miR-4251	CLIP-seq
MIRT1357413	hsa-miR-4252	CLIP-seq
MIRT1357414	hsa-miR-4294	CLIP-seq
MIRT1357415	hsa-miR-4433	CLIP-seq
MIRT2624385	hsa-miR-4496	CLIP-seq
MIRT2330313	hsa-miR-4526	CLIP-seq
MIRT1357419	hsa-miR-4666-3p	CLIP-seq
MIRT2105835	hsa-miR-4668-3p	CLIP-seq
MIRT2105836	hsa-miR-4668-5p	CLIP-seq
MIRT1357420	hsa-miR-4715-3p	CLIP-seq
MIRT1357421	hsa-miR-4716-3p	CLIP-seq
MIRT2105837	hsa-miR-4738-3p	CLIP-seq
MIRT1357424	hsa-miR-4795-3p	CLIP-seq
MIRT1357425	hsa-miR-490-5p	CLIP-seq
MIRT1357426	hsa-miR-513a-5p	CLIP-seq
MIRT1357428	hsa-miR-516a-3p	CLIP-seq
MIRT2105838	hsa-miR-539	CLIP-seq
MIRT1357429	hsa-miR-548a-3p	CLIP-seq
MIRT2105839	hsa-miR-548c-3p	CLIP-seq
MIRT1357430	hsa-miR-548e	CLIP-seq
MIRT1357431	hsa-miR-548f	CLIP-seq
MIRT1357432	hsa-miR-582-3p	CLIP-seq
MIRT2105840	hsa-miR-625	CLIP-seq
MIRT1357433	hsa-miR-627	CLIP-seq
MIRT1357434	hsa-miR-655	CLIP-seq
MIRT1357435	hsa-miR-656	CLIP-seq
MIRT1357436	hsa-miR-665	CLIP-seq

49 Show/Hide all (49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000295	Function	Adenine nucleotide transmembrane transporter activity	IMP	19116139
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005471	Function	ATP:ADP antiporter activity	IEA
GO:0005471	Function	ATP:ADP antiporter activity	ISS
GO:0005515	Function	Protein binding	IPI	17715127, 19116139, 19130895, 19154410, 21370995, 24725412, 27499296, 31883789
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005757	Component	Mitochondrial permeability transition pore complex	IEA
GO:0005757	Component	Mitochondrial permeability transition pore complex	ISS
GO:0005886	Component	Plasma membrane	TAS	2168878
GO:0007059	Process	Chromosome segregation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	19154410
GO:0015078	Function	Proton transmembrane transporter activity	IEA
GO:0015207	Function	Adenine transmembrane transporter activity	TAS	2168878
GO:0015297	Function	Antiporter activity	IEA
GO:0015853	Process	Adenine transport	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	27641616
GO:0016020	Component	Membrane	IEA
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	IEA
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	ISS
GO:0030183	Process	B cell differentiation	IEA
GO:0030183	Process	B cell differentiation	ISS
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	ISS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	19725078
GO:0042645	Component	Mitochondrial nucleoid	IDA	18063578
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IEA
GO:0046902	Process	Regulation of mitochondrial membrane permeability	ISS
GO:0051503	Process	Adenine nucleotide transport	IMP	19116139
GO:0055085	Process	Transmembrane transport	IEA
GO:0071817	Component	MMXD complex	IDA	20797633
GO:0140021	Process	Mitochondrial ADP transmembrane transport	IEA
GO:0140021	Process	Mitochondrial ADP transmembrane transport	ISS
GO:1901029	Process	Negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IBA
GO:1901029	Process	Negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IMP	19154410
GO:1901526	Process	Positive regulation of mitophagy	IEA
GO:1901526	Process	Positive regulation of mitophagy	ISS
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1990544	Process	Mitochondrial ATP transmembrane transport	IEA
GO:1990544	Process	Mitochondrial ATP transmembrane transport	ISS
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990845	Process	Adaptive thermogenesis	IEA
GO:1990845	Process	Adaptive thermogenesis	ISS

MIM	HGNC	e!Ensembl
300150	10991	ENSG00000005022

P05141

Protein name

ADP/ATP translocase 2 (ADP,ATP carrier protein 2) (ADP,ATP carrier protein, fibroblast isoform) (Adenine nucleotide translocator 2) (ANT 2) (Solute carrier family 25 member 5) [Cleaved into: ADP/ATP translocase 2, N-terminally processed]

Protein function

ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell (By similarity). Cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state): oper

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00153	Mito_carr	4 → 103	Mitochondrial carrier protein	Family
PF00153	Mito_carr	109 → 206	Mitochondrial carrier protein	Family
PF00153	Mito_carr	206 → 298	Mitochondrial carrier protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in erythrocytes (at protein level). {ECO:0000269|PubMed:27641616}.

Sequence

MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWLYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVS
VQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMM
QSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT

Sequence length

298

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Calcium signaling pathway	Vpr-mediated induction of apoptosis by mitochondrial outer membrane permeabilization
cGMP-PKG signaling pathway	Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane
Necroptosis
Cellular senescence
Neutrophil extracellular trap formation
Alzheimer disease
Parkinson disease
Huntington disease
Spinocerebellar ataxia
Prion disease
Pathways of neurodegeneration - multiple diseases
Influenza A
Human T-cell leukemia virus 1 infection
Chemical carcinogenesis - reactive oxygen species
Diabetic cardiomyopathy

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (6)
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	39406924	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	Disgenet, GenCC Disgenet, GenCC	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLC25A5-related disorder	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (32)
Anemia	Anemia	BEFREE	25613378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20650008, 20875141, 22198296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30397354, 35919504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35288533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19140237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30406146	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	18809618, 25833713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	16107323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	16107323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35288533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	35840882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	22034909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	8688152, 8781539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	32515122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	23783460		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasm	Kidney Neoplasm	BEFREE	8688152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23242177, 23306701, 24054501, 27012708, 28350139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19140237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20650008, 20875141, 22198296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20875141, 26883272, 28350139, 30225759, 8688152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18267033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Myopathies	Mitochondrial myopathy	BEFREE	18809618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	33462268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	25833713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20950584, 24054501, 27012708, 30225759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26883272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	8688152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	25351201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	8781539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	8781539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34530829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	21108393		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
SLC25A4	[]	14	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","Parkinson disease","Spinocerebellar ataxia","Prion disease","Influenza A","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	[]
SLC25A6	[]	14	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","Parkinson disease","Spinocerebellar ataxia","Prion disease","Influenza A","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	[]
SLC25A31	[]	12	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","Parkinson disease","Spinocerebellar ataxia","Prion disease","Influenza A","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	[]
VDAC2	[]	11	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","Parkinson disease","Spinocerebellar ataxia","Prion disease","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	[]
VDAC1	[]	12	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","Parkinson disease","Spinocerebellar ataxia","Prion disease","Influenza A","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	[]

SLC25A5 (solute carrier family 25 member 5)

Bookmark This Gene