Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	293
Gene name	Solute carrier family 25 member 6
Gene symbol	SLC25A6
Synonyms (NCBI Gene)	AAC3ANTANT 2ANT 3ANT3ANT3Y
Chromosome	X\|Y
Chromosome location	X;Y
Summary	This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix i

155 Show/Hide all (155)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031609	hsa-miR-16-5p	Proteomics	18668040
MIRT042493	hsa-miR-423-3p	CLASH	23622248
MIRT039389	hsa-miR-421	CLASH	23622248
MIRT1357437	hsa-miR-122	CLIP-seq
MIRT1357438	hsa-miR-1229	CLIP-seq
MIRT1357439	hsa-miR-1243	CLIP-seq
MIRT1357440	hsa-miR-1278	CLIP-seq
MIRT1357441	hsa-miR-19a	CLIP-seq
MIRT1357442	hsa-miR-19b	CLIP-seq
MIRT1357443	hsa-miR-296-5p	CLIP-seq
MIRT1357444	hsa-miR-3654	CLIP-seq
MIRT1357445	hsa-miR-378	CLIP-seq
MIRT1357446	hsa-miR-378b	CLIP-seq
MIRT1357447	hsa-miR-378c	CLIP-seq
MIRT1357448	hsa-miR-378d	CLIP-seq
MIRT1357449	hsa-miR-378e	CLIP-seq
MIRT1357450	hsa-miR-378f	CLIP-seq
MIRT1357451	hsa-miR-378h	CLIP-seq
MIRT1357452	hsa-miR-378i	CLIP-seq
MIRT1357453	hsa-miR-422a	CLIP-seq
MIRT1357454	hsa-miR-4264	CLIP-seq
MIRT1357455	hsa-miR-4489	CLIP-seq
MIRT1357456	hsa-miR-4529-5p	CLIP-seq
MIRT1357457	hsa-miR-4638-3p	CLIP-seq
MIRT1357458	hsa-miR-4638-5p	CLIP-seq
MIRT1357459	hsa-miR-4707-5p	CLIP-seq
MIRT1357460	hsa-miR-4712-5p	CLIP-seq
MIRT1357461	hsa-miR-4758-3p	CLIP-seq
MIRT1357462	hsa-miR-4773	CLIP-seq
MIRT1357463	hsa-miR-4797-3p	CLIP-seq
MIRT1357464	hsa-miR-516a-5p	CLIP-seq
MIRT1357465	hsa-miR-549	CLIP-seq
MIRT1357466	hsa-miR-770-5p	CLIP-seq
MIRT2105841	hsa-miR-1185	CLIP-seq
MIRT2105842	hsa-miR-1224-5p	CLIP-seq
MIRT1357441	hsa-miR-19a	CLIP-seq
MIRT1357442	hsa-miR-19b	CLIP-seq
MIRT2105843	hsa-miR-2117	CLIP-seq
MIRT2105844	hsa-miR-3605-5p	CLIP-seq
MIRT2105845	hsa-miR-3679-5p	CLIP-seq
MIRT2105846	hsa-miR-376c	CLIP-seq
MIRT1357445	hsa-miR-378	CLIP-seq
MIRT1357446	hsa-miR-378b	CLIP-seq
MIRT1357447	hsa-miR-378c	CLIP-seq
MIRT1357448	hsa-miR-378d	CLIP-seq
MIRT1357449	hsa-miR-378e	CLIP-seq
MIRT1357450	hsa-miR-378f	CLIP-seq
MIRT1357451	hsa-miR-378h	CLIP-seq
MIRT1357452	hsa-miR-378i	CLIP-seq
MIRT2105847	hsa-miR-3915	CLIP-seq
MIRT1357453	hsa-miR-422a	CLIP-seq
MIRT2105848	hsa-miR-4320	CLIP-seq
MIRT1357455	hsa-miR-4489	CLIP-seq
MIRT1357457	hsa-miR-4638-3p	CLIP-seq
MIRT1357458	hsa-miR-4638-5p	CLIP-seq
MIRT2105849	hsa-miR-4689	CLIP-seq
MIRT1357460	hsa-miR-4712-5p	CLIP-seq
MIRT2105850	hsa-miR-4753-3p	CLIP-seq
MIRT1357462	hsa-miR-4773	CLIP-seq
MIRT1357464	hsa-miR-516a-5p	CLIP-seq
MIRT1357466	hsa-miR-770-5p	CLIP-seq
MIRT2330314	hsa-miR-103a	CLIP-seq
MIRT2330315	hsa-miR-107	CLIP-seq
MIRT2330316	hsa-miR-1301	CLIP-seq
MIRT1357441	hsa-miR-19a	CLIP-seq
MIRT1357442	hsa-miR-19b	CLIP-seq
MIRT2330317	hsa-miR-2052	CLIP-seq
MIRT2105843	hsa-miR-2117	CLIP-seq
MIRT2330318	hsa-miR-214	CLIP-seq
MIRT2330319	hsa-miR-3614-3p	CLIP-seq
MIRT2330320	hsa-miR-3619-5p	CLIP-seq
MIRT1357445	hsa-miR-378	CLIP-seq
MIRT1357446	hsa-miR-378b	CLIP-seq
MIRT1357447	hsa-miR-378c	CLIP-seq
MIRT1357448	hsa-miR-378d	CLIP-seq
MIRT1357449	hsa-miR-378e	CLIP-seq
MIRT1357450	hsa-miR-378f	CLIP-seq
MIRT1357451	hsa-miR-378h	CLIP-seq
MIRT1357452	hsa-miR-378i	CLIP-seq
MIRT1357453	hsa-miR-422a	CLIP-seq
MIRT2330321	hsa-miR-4297	CLIP-seq
MIRT2330322	hsa-miR-4459	CLIP-seq
MIRT2330323	hsa-miR-4462	CLIP-seq
MIRT1357455	hsa-miR-4489	CLIP-seq
MIRT2330324	hsa-miR-450b-5p	CLIP-seq
MIRT1357456	hsa-miR-4529-5p	CLIP-seq
MIRT1357457	hsa-miR-4638-3p	CLIP-seq
MIRT1357458	hsa-miR-4638-5p	CLIP-seq
MIRT2330325	hsa-miR-4695-5p	CLIP-seq
MIRT1357459	hsa-miR-4707-5p	CLIP-seq
MIRT1357460	hsa-miR-4712-5p	CLIP-seq
MIRT2330326	hsa-miR-4722-5p	CLIP-seq
MIRT2105850	hsa-miR-4753-3p	CLIP-seq
MIRT1357462	hsa-miR-4773	CLIP-seq
MIRT2330327	hsa-miR-4787-3p	CLIP-seq
MIRT2330328	hsa-miR-5047	CLIP-seq
MIRT2330329	hsa-miR-507	CLIP-seq
MIRT1357464	hsa-miR-516a-5p	CLIP-seq
MIRT2330330	hsa-miR-518d-5p	CLIP-seq
MIRT2330331	hsa-miR-519b-5p	CLIP-seq
MIRT2330332	hsa-miR-519c-5p	CLIP-seq
MIRT2330333	hsa-miR-520c-5p	CLIP-seq
MIRT2330334	hsa-miR-526a	CLIP-seq
MIRT1357465	hsa-miR-549	CLIP-seq
MIRT2330335	hsa-miR-557	CLIP-seq
MIRT2330336	hsa-miR-761	CLIP-seq
MIRT1357466	hsa-miR-770-5p	CLIP-seq
MIRT2624386	hsa-miR-1224-3p	CLIP-seq
MIRT2624387	hsa-miR-1260	CLIP-seq
MIRT2624388	hsa-miR-1260b	CLIP-seq
MIRT2624389	hsa-miR-1280	CLIP-seq
MIRT2624390	hsa-miR-1470	CLIP-seq
MIRT1357443	hsa-miR-296-5p	CLIP-seq
MIRT2330319	hsa-miR-3614-3p	CLIP-seq
MIRT2330321	hsa-miR-4297	CLIP-seq
MIRT2330323	hsa-miR-4462	CLIP-seq
MIRT1357456	hsa-miR-4529-5p	CLIP-seq
MIRT2624391	hsa-miR-4667-3p	CLIP-seq
MIRT1357459	hsa-miR-4707-5p	CLIP-seq
MIRT1357461	hsa-miR-4758-3p	CLIP-seq
MIRT2624392	hsa-miR-4777-5p	CLIP-seq
MIRT2330327	hsa-miR-4787-3p	CLIP-seq
MIRT1357464	hsa-miR-516a-5p	CLIP-seq
MIRT2330330	hsa-miR-518d-5p	CLIP-seq
MIRT2330331	hsa-miR-519b-5p	CLIP-seq
MIRT2330332	hsa-miR-519c-5p	CLIP-seq
MIRT2330333	hsa-miR-520c-5p	CLIP-seq
MIRT2330334	hsa-miR-526a	CLIP-seq
MIRT2624393	hsa-miR-532-3p	CLIP-seq
MIRT1357465	hsa-miR-549	CLIP-seq
MIRT2624394	hsa-miR-642a	CLIP-seq
MIRT2624386	hsa-miR-1224-3p	CLIP-seq
MIRT2624387	hsa-miR-1260	CLIP-seq
MIRT2624388	hsa-miR-1260b	CLIP-seq
MIRT2624389	hsa-miR-1280	CLIP-seq
MIRT2624390	hsa-miR-1470	CLIP-seq
MIRT1357443	hsa-miR-296-5p	CLIP-seq
MIRT2330319	hsa-miR-3614-3p	CLIP-seq
MIRT2330321	hsa-miR-4297	CLIP-seq
MIRT2330323	hsa-miR-4462	CLIP-seq
MIRT1357456	hsa-miR-4529-5p	CLIP-seq
MIRT2624391	hsa-miR-4667-3p	CLIP-seq
MIRT1357459	hsa-miR-4707-5p	CLIP-seq
MIRT1357461	hsa-miR-4758-3p	CLIP-seq
MIRT2624392	hsa-miR-4777-5p	CLIP-seq
MIRT2330327	hsa-miR-4787-3p	CLIP-seq
MIRT1357464	hsa-miR-516a-5p	CLIP-seq
MIRT2330330	hsa-miR-518d-5p	CLIP-seq
MIRT2330331	hsa-miR-519b-5p	CLIP-seq
MIRT2330332	hsa-miR-519c-5p	CLIP-seq
MIRT2330333	hsa-miR-520c-5p	CLIP-seq
MIRT2330334	hsa-miR-526a	CLIP-seq
MIRT2624393	hsa-miR-532-3p	CLIP-seq
MIRT1357465	hsa-miR-549	CLIP-seq
MIRT2624394	hsa-miR-642a	CLIP-seq

19 Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005471	Function	ATP:ADP antiporter activity	IEA
GO:0005471	Function	ATP:ADP antiporter activity	NAS	2541251
GO:0005515	Function	Protein binding	IPI	16201016, 21370995, 21516116, 24725412, 25416956, 29128334, 29892012, 33961781
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005744	Component	TIM23 mitochondrial import inner membrane translocase complex	TAS	2541251
GO:0006915	Process	Apoptotic process	IEA
GO:0015297	Function	Antiporter activity	IEA
GO:0016020	Component	Membrane	IDA	27641616
GO:0016020	Component	Membrane	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0140021	Process	Mitochondrial ADP transmembrane transport	IEA
GO:1901029	Process	Negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IBA
GO:1990544	Process	Mitochondrial ATP transmembrane transport	IEA

MIM	HGNC	e!Ensembl
300151	N/A	HGNC

P12236

Protein name

ADP/ATP translocase 3 (ADP,ATP carrier protein 3) (ADP,ATP carrier protein, isoform T2) (ANT 2) (Adenine nucleotide translocator 3) (ANT 3) (Solute carrier family 25 member 6) [Cleaved into: ADP/ATP translocase 3, N-terminally processed]

Protein function

ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell (By similarity). Cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state): oper

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00153	Mito_carr	4 → 103	Mitochondrial carrier protein	Family
PF00153	Mito_carr	109 → 206	Mitochondrial carrier protein	Family
PF00153	Mito_carr	206 → 298	Mitochondrial carrier protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in erythrocytes (at protein level). {ECO:0000269|PubMed:27641616}.

Sequence

MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKSGTEREFRGLGDCLVKITKSDGIRGLYQGFSVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI

Sequence length

298

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Calcium signaling pathway	Mitochondrial protein import
cGMP-PKG signaling pathway	Influenza Virus Induced Apoptosis
Necroptosis	Vpr-mediated induction of apoptosis by mitochondrial outer membrane permeabilization
Cellular senescence	Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane
Neutrophil extracellular trap formation
Alzheimer disease
Parkinson disease
Huntington disease
Spinocerebellar ataxia
Prion disease
Pathways of neurodegeneration - multiple diseases
Influenza A
Human T-cell leukemia virus 1 infection
Chemical carcinogenesis - reactive oxygen species
Diabetic cardiomyopathy

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Colon adenocarcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLC25A6-related disorder	Likely benign; Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (24)
Aphasia	Aphasia	BEFREE	30778280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	22980403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	29916066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22524830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20650008, 22198296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19715608	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	8781539	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	10841224, 16107323, 1867322	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	16107323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	8918809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	19715608	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothalamic hamartomas	Hypothalamic Hamartomas	BEFREE	30970205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	22980403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22524830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	10926541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	33615715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	10841224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	16507998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22056254, 31129499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	28043006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy Hereditary Leber	Leber hereditary optic neuropathy	Pubtator	32344771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	33526710	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	29916066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	36254139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
SLC25A4	[]	15	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","Parkinson disease","Spinocerebellar ataxia","Prion disease","Influenza A","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	[]
SLC25A5	[]	14	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","Parkinson disease","Spinocerebellar ataxia","Prion disease","Influenza A","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	[]
SLC25A31	[]	12	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","Parkinson disease","Spinocerebellar ataxia","Prion disease","Influenza A","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	[]
VDAC2	[]	11	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","Parkinson disease","Spinocerebellar ataxia","Prion disease","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	[]
VDAC1	[]	12	["Calcium signaling pathway","cGMP-PKG signaling pathway","Necroptosis","Cellular senescence","Neutrophil extracellular trap formation","Parkinson disease","Spinocerebellar ataxia","Prion disease","Influenza A","Human T-cell leukemia virus 1 infection","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	[]

SLC25A6 (solute carrier family 25 member 6)

Bookmark This Gene