Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	6932
Gene name	Transcription factor 7
Gene symbol	TCF7
Synonyms (NCBI Gene)	TCF-1
Chromosome	5
Chromosome location	5q31.1
Summary	This gene encodes a member of the T-cell factor/lymphoid enhancer-binding factor family of high mobility group (HMG) box transcriptional activators. This gene is expressed predominantly in T-cells and plays a critical role in natural killer cell and innat

135

Show/Hide all (135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024837	hsa-miR-215-5p	Microarray	19074876
MIRT026207	hsa-miR-192-5p	Microarray	19074876
MIRT731117	hsa-miR-34a-5p	qRT-PCRLuciferase reporter assayImmunohistochemistryWestern blot	25436980
MIRT731117	hsa-miR-34a-5p	qRT-PCRLuciferase reporter assayImmunohistochemistryWestern blot	25436980
MIRT731389	hsa-miR-22-3p	Luciferase reporter assayqRT-PCRWestern blot	26193896
MIRT755362	hsa-miR-491-5p	Luciferase reporter assayWestern blottingqRT-PCR	36988257
MIRT1416377	hsa-miR-127-5p	CLIP-seq
MIRT1416378	hsa-miR-197	CLIP-seq
MIRT1416379	hsa-miR-24	CLIP-seq
MIRT1416380	hsa-miR-296-3p	CLIP-seq
MIRT1416381	hsa-miR-3187-3p	CLIP-seq
MIRT1416382	hsa-miR-3613-3p	CLIP-seq
MIRT1416383	hsa-miR-3663-5p	CLIP-seq
MIRT1416384	hsa-miR-3688-5p	CLIP-seq
MIRT1416385	hsa-miR-371-5p	CLIP-seq
MIRT1416386	hsa-miR-371b-5p	CLIP-seq
MIRT1416387	hsa-miR-4284	CLIP-seq
MIRT1416388	hsa-miR-4435	CLIP-seq
MIRT1416389	hsa-miR-4453	CLIP-seq
MIRT1416390	hsa-miR-4457	CLIP-seq
MIRT1416391	hsa-miR-4470	CLIP-seq
MIRT1416392	hsa-miR-4538	CLIP-seq
MIRT1416393	hsa-miR-4691-3p	CLIP-seq
MIRT1416394	hsa-miR-4701-5p	CLIP-seq
MIRT1416395	hsa-miR-4716-5p	CLIP-seq
MIRT1416396	hsa-miR-4755-3p	CLIP-seq
MIRT1416397	hsa-miR-4761-5p	CLIP-seq
MIRT1416398	hsa-miR-4781-3p	CLIP-seq
MIRT1416399	hsa-miR-5096	CLIP-seq
MIRT1416400	hsa-miR-548s	CLIP-seq
MIRT1416401	hsa-miR-588	CLIP-seq
MIRT1416402	hsa-miR-606	CLIP-seq
MIRT1416403	hsa-miR-624	CLIP-seq
MIRT1416404	hsa-miR-1178	CLIP-seq
MIRT1416405	hsa-miR-125a-3p	CLIP-seq
MIRT1416406	hsa-miR-1273f	CLIP-seq
MIRT1416407	hsa-miR-129-5p	CLIP-seq
MIRT1416408	hsa-miR-143	CLIP-seq
MIRT1416409	hsa-miR-1914	CLIP-seq
MIRT1416378	hsa-miR-197	CLIP-seq
MIRT1416410	hsa-miR-2113	CLIP-seq
MIRT1416411	hsa-miR-218	CLIP-seq
MIRT1416412	hsa-miR-3144-5p	CLIP-seq
MIRT1416413	hsa-miR-3149	CLIP-seq
MIRT1416381	hsa-miR-3187-3p	CLIP-seq
MIRT1416414	hsa-miR-3191	CLIP-seq
MIRT1416415	hsa-miR-339-5p	CLIP-seq
MIRT1416383	hsa-miR-3663-5p	CLIP-seq
MIRT1416385	hsa-miR-371-5p	CLIP-seq
MIRT1416386	hsa-miR-371b-5p	CLIP-seq
MIRT1416416	hsa-miR-3934	CLIP-seq
MIRT1416417	hsa-miR-3935	CLIP-seq
MIRT1416418	hsa-miR-411	CLIP-seq
MIRT1416419	hsa-miR-4287	CLIP-seq
MIRT1416388	hsa-miR-4435	CLIP-seq
MIRT1416420	hsa-miR-4469	CLIP-seq
MIRT1416421	hsa-miR-4487	CLIP-seq
MIRT1416422	hsa-miR-4532	CLIP-seq
MIRT1416423	hsa-miR-4652-5p	CLIP-seq
MIRT1416424	hsa-miR-4667-5p	CLIP-seq
MIRT1416425	hsa-miR-4685-3p	CLIP-seq
MIRT1416426	hsa-miR-4700-5p	CLIP-seq
MIRT1416394	hsa-miR-4701-5p	CLIP-seq
MIRT1416427	hsa-miR-4708-5p	CLIP-seq
MIRT1416395	hsa-miR-4716-5p	CLIP-seq
MIRT1416428	hsa-miR-4717-5p	CLIP-seq
MIRT1416429	hsa-miR-4731-5p	CLIP-seq
MIRT1416430	hsa-miR-4735-5p	CLIP-seq
MIRT1416396	hsa-miR-4755-3p	CLIP-seq
MIRT1416431	hsa-miR-4763-5p	CLIP-seq
MIRT1416432	hsa-miR-4770	CLIP-seq
MIRT1416433	hsa-miR-4775	CLIP-seq
MIRT1416398	hsa-miR-4781-3p	CLIP-seq
MIRT1416434	hsa-miR-4783-5p	CLIP-seq
MIRT1416435	hsa-miR-486-3p	CLIP-seq
MIRT1416399	hsa-miR-5096	CLIP-seq
MIRT1416400	hsa-miR-548s	CLIP-seq
MIRT1416436	hsa-miR-550a	CLIP-seq
MIRT1416401	hsa-miR-588	CLIP-seq
MIRT1416437	hsa-miR-590-3p	CLIP-seq
MIRT1416438	hsa-miR-591	CLIP-seq
MIRT1416402	hsa-miR-606	CLIP-seq
MIRT1416439	hsa-miR-636	CLIP-seq
MIRT1416440	hsa-miR-640	CLIP-seq
MIRT1416441	hsa-miR-758	CLIP-seq
MIRT1416442	hsa-miR-764	CLIP-seq
MIRT1416443	hsa-miR-3545-3p	CLIP-seq
MIRT1416444	hsa-miR-3921	CLIP-seq
MIRT1416445	hsa-miR-4251	CLIP-seq
MIRT1416446	hsa-miR-4329	CLIP-seq
MIRT1416447	hsa-miR-4421	CLIP-seq
MIRT1416448	hsa-miR-4653-5p	CLIP-seq
MIRT1416428	hsa-miR-4717-5p	CLIP-seq
MIRT1416449	hsa-miR-593	CLIP-seq
MIRT1416424	hsa-miR-4667-5p	CLIP-seq
MIRT1416426	hsa-miR-4700-5p	CLIP-seq
MIRT2640247	hsa-miR-1224-3p	CLIP-seq
MIRT2640248	hsa-miR-1260	CLIP-seq
MIRT2640249	hsa-miR-1260b	CLIP-seq
MIRT2640250	hsa-miR-1280	CLIP-seq
MIRT2640251	hsa-miR-1281	CLIP-seq
MIRT2640252	hsa-miR-1297	CLIP-seq
MIRT2640253	hsa-miR-188-3p	CLIP-seq
MIRT2640254	hsa-miR-26a	CLIP-seq
MIRT2640255	hsa-miR-26b	CLIP-seq
MIRT1416413	hsa-miR-3149	CLIP-seq
MIRT2640256	hsa-miR-3156-3p	CLIP-seq
MIRT2640257	hsa-miR-3614-5p	CLIP-seq
MIRT2640258	hsa-miR-3920	CLIP-seq
MIRT1416417	hsa-miR-3935	CLIP-seq
MIRT1416418	hsa-miR-411	CLIP-seq
MIRT2640259	hsa-miR-432	CLIP-seq
MIRT2640260	hsa-miR-4465	CLIP-seq
MIRT1416422	hsa-miR-4532	CLIP-seq
MIRT2640261	hsa-miR-4666-5p	CLIP-seq
MIRT1416430	hsa-miR-4735-5p	CLIP-seq
MIRT2640262	hsa-miR-4740-3p	CLIP-seq
MIRT1416433	hsa-miR-4775	CLIP-seq
MIRT1416434	hsa-miR-4783-5p	CLIP-seq
MIRT1416437	hsa-miR-590-3p	CLIP-seq
MIRT2640263	hsa-miR-642b	CLIP-seq
MIRT2640264	hsa-miR-718	CLIP-seq
MIRT2640265	hsa-miR-890	CLIP-seq
MIRT2640251	hsa-miR-1281	CLIP-seq
MIRT2640252	hsa-miR-1297	CLIP-seq
MIRT2640254	hsa-miR-26a	CLIP-seq
MIRT2640255	hsa-miR-26b	CLIP-seq
MIRT1416413	hsa-miR-3149	CLIP-seq
MIRT2640260	hsa-miR-4465	CLIP-seq
MIRT1416422	hsa-miR-4532	CLIP-seq
MIRT1416430	hsa-miR-4735-5p	CLIP-seq
MIRT1416433	hsa-miR-4775	CLIP-seq
MIRT1416434	hsa-miR-4783-5p	CLIP-seq
MIRT1416437	hsa-miR-590-3p	CLIP-seq
MIRT2640264	hsa-miR-718	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
CTNNB1	Unknown	17724465

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IBA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	18579517, 20128911
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001217	Function	DNA-binding transcription repressor activity	ISS
GO:0002376	Process	Immune system process	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	9783587, 16442529, 17218525, 17510365, 19304756, 19358846, 20028982, 25678599, 26079538
GO:0005634	Component	Nucleus	IDA	18579517
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	1569101
GO:0006955	Process	Immune response	TAS	1569101
GO:0008013	Function	Beta-catenin binding	IDA	9488439
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0042492	Process	Gamma-delta T cell differentiation	ISS
GO:0045586	Process	Regulation of gamma-delta T cell differentiation	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0071353	Process	Cellular response to interleukin-4	IDA	18579517
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990907	Component	Beta-catenin-TCF complex	IBA

MIM	HGNC	e!Ensembl
189908	11639	ENSG00000081059

P36402

Protein name

Transcription factor 7 (TCF-7) (T-cell-specific transcription factor 1) (T-cell factor 1) (TCF-1)

Protein function

Transcriptional activator involved in T-cell lymphocyte differentiation. Necessary for the survival of CD4(+) CD8(+) immature thymocytes. Isoforms lacking the N-terminal CTNNB1 binding domain cannot fulfill this role. Binds to the T-lymphocyte-s

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08347	CTNNB1_binding	1 → 212	N-terminal CTNNB1 binding	Family
PF00505	HMG_box	269 → 337	HMG (high mobility group) box	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in T-cells. Also detected in proliferating intestinal epithelial cells and in the basal epithelial cells of mammary gland epithelium. {ECO:0000269|PubMed:10489374}.

Sequence

MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE
GAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKET
VYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQ
KQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPS
GKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAIN
QILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTET
NWPRELKDGNGQESLSMSSSSSPA

Sequence length

384

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (96)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27151989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19749792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	27522523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	12707037		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26578390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	26578390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	28220803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16622521	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11543630, 30528236		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	30468298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	30468298	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30837262, 31216480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	BEFREE	28349581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	15326484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	31595984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26079538, 31541685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17187432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23572277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	34657342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31696464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31696464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	27522523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24883311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleidocranial Dysplasia	Cleidocranial Dysplasia	BEFREE	25738174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19749792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	27433921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29532890, 29978469, 30116340, 30225781, 9259402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12408869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19749792, 22778133, 30999858, 32407773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	24994854		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	CTD_human_DG	24994854		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	24994854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	24994854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10690959, 16602010, 16760222, 17033837, 17923767, 20616309, 26193896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10690959, 11668618, 16602010, 16760222, 17033837, 17923767, 20616309, 26193896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18045485, 19956102, 19956109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11668618, 12488961, 12765974, 15620463, 19956102, 19956109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10649494, 10690959, 15277395, 15983230, 17033837, 17311858, 17327436, 17937063, 18546086, 21357677, 21965303, 22529894, 26193896, 26642437, 8945470, 9097962, 9840451 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	31298342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36583231	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31298342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	17433759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	21124956	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29642232, 31410187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	38268923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29642232, 31410187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	23966864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	33651649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	14598263, 15326484, 17187432, 17363580, 25195525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25329529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	18478089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	CTD_human_DG	24994854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28346462		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15369140, 15927679, 27151989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	32692727, 35020836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	26808113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12355088, 29532890, 30457363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	26808113, 28062664, 28128292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	26808113		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28144936		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	Pubtator	12707037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26079538, 31541685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23426183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27922675, 28220803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31133633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15326484, 23103132, 29532890, 30021780, 31488580, 7579399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31696464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12730871, 19749792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	10649494, 15841481, 15928245, 17923767, 17937063, 18331410, 9097962, 9840451		★★★★★ ★☆☆☆☆ Found in Text Mining only
MATURITY-ONSET DIABETES OF THE YOUNG, TYPE 3 (disorder)	Mason type diabetes	BEFREE	11668618, 12355088, 14598263, 8945470, 9097962, 9840451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33275172, 34764492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Monogenic diabetes	Monogenic Diabetes	BEFREE	16760222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	15889128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	32578294	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	26714756	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	28844837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10489374, 12461749, 12730871, 14633602, 15623628, 17187432, 19749792, 28220803, 28346462, 29642232, 29769201, 30018042, 31133633, 31696464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17724465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29532890, 31378895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	29806631	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31835596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27683056, 31595984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27683056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	39985498	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	12707037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	12707037, 27151989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	15369140, 23103132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27922675, 28220803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	23590301, 25407108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Regional enteritis	Crohn Disease	CTD_human_DG	24994854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	25329529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29312594, 31350847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	25195525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31133633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31133633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31191543		★★★★★ ★☆☆☆☆ Found in Text Mining only

TCF7 (transcription factor 7)