USP30 (ubiquitin specific peptidase 30)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 84749
• Gene name: Ubiquitin specific peptidase 30
• Gene symbol: USP30
• Synonyms (NCBI Gene): -
• Chromosome: 12
• Chromosome location: 12q24.11
• Summary: USP30, a member of the ubiquitin-specific protease family (see USP1, MIM 603478), is a novel mitochondrial deubiquitinating (DUB) enzyme (Nakamura and Hirose, 2008 [PubMed 18287522]).[supplied by OMIM, Dec 2008]

miRNA Show/Hide all (253)

miRTarBase ID	miRNA	Experiments	Reference
MIRT042215	hsa-miR-484	CLASH	23622248
MIRT037261	hsa-miR-877-5p	CLASH	23622248
MIRT756119	hsa-miR-137	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	38111333
MIRT1478569	hsa-miR-1202	CLIP-seq
MIRT1478570	hsa-miR-1206	CLIP-seq
MIRT1478571	hsa-miR-1225-5p	CLIP-seq
MIRT1478572	hsa-miR-1245b-3p	CLIP-seq
MIRT1478573	hsa-miR-149	CLIP-seq
MIRT1478574	hsa-miR-1915	CLIP-seq
MIRT1478575	hsa-miR-27a	CLIP-seq
MIRT1478576	hsa-miR-27b	CLIP-seq
MIRT1478577	hsa-miR-3194-5p	CLIP-seq
MIRT1478578	hsa-miR-369-3p	CLIP-seq
MIRT1478579	hsa-miR-374a	CLIP-seq
MIRT1478580	hsa-miR-374b	CLIP-seq
MIRT1478581	hsa-miR-374c	CLIP-seq
MIRT1478582	hsa-miR-375	CLIP-seq
MIRT1478583	hsa-miR-3915	CLIP-seq
MIRT1478584	hsa-miR-3928	CLIP-seq
MIRT1478585	hsa-miR-3972	CLIP-seq
MIRT1478586	hsa-miR-4283	CLIP-seq
MIRT1478587	hsa-miR-4307	CLIP-seq
MIRT1478588	hsa-miR-4489	CLIP-seq
MIRT1478589	hsa-miR-4492	CLIP-seq
MIRT1478590	hsa-miR-4496	CLIP-seq
MIRT1478591	hsa-miR-4498	CLIP-seq
MIRT1478592	hsa-miR-451	CLIP-seq
MIRT1478593	hsa-miR-4703-3p	CLIP-seq
MIRT1478594	hsa-miR-4719	CLIP-seq
MIRT1478595	hsa-miR-4726-3p	CLIP-seq
MIRT1478596	hsa-miR-4738-3p	CLIP-seq
MIRT1478597	hsa-miR-4797-5p	CLIP-seq
MIRT1478598	hsa-miR-499a-5p	CLIP-seq
MIRT1478599	hsa-miR-513a-5p	CLIP-seq
MIRT1478600	hsa-miR-513b	CLIP-seq
MIRT1478601	hsa-miR-548a-5p	CLIP-seq
MIRT1478602	hsa-miR-548ab	CLIP-seq
MIRT1478603	hsa-miR-548ak	CLIP-seq
MIRT1478604	hsa-miR-548b-5p	CLIP-seq
MIRT1478605	hsa-miR-548c-5p	CLIP-seq
MIRT1478606	hsa-miR-548d-5p	CLIP-seq
MIRT1478607	hsa-miR-548h	CLIP-seq
MIRT1478608	hsa-miR-548i	CLIP-seq
MIRT1478609	hsa-miR-548j	CLIP-seq
MIRT1478610	hsa-miR-548w	CLIP-seq
MIRT1478611	hsa-miR-548y	CLIP-seq
MIRT1478612	hsa-miR-555	CLIP-seq
MIRT1478613	hsa-miR-559	CLIP-seq
MIRT1478614	hsa-miR-579	CLIP-seq
MIRT1478615	hsa-miR-595	CLIP-seq
MIRT1478616	hsa-miR-596	CLIP-seq
MIRT1478617	hsa-miR-655	CLIP-seq
MIRT1478618	hsa-miR-762	CLIP-seq
MIRT2144119	hsa-miR-2116	CLIP-seq
MIRT2144120	hsa-miR-3143	CLIP-seq
MIRT2144121	hsa-miR-320a	CLIP-seq
MIRT2144122	hsa-miR-320b	CLIP-seq
MIRT2144123	hsa-miR-320c	CLIP-seq
MIRT2144124	hsa-miR-320d	CLIP-seq
MIRT2144125	hsa-miR-323-3p	CLIP-seq
MIRT2144126	hsa-miR-329	CLIP-seq
MIRT2144127	hsa-miR-338-5p	CLIP-seq
MIRT2144128	hsa-miR-362-3p	CLIP-seq
MIRT1478578	hsa-miR-369-3p	CLIP-seq
MIRT1478579	hsa-miR-374a	CLIP-seq
MIRT1478580	hsa-miR-374b	CLIP-seq
MIRT1478581	hsa-miR-374c	CLIP-seq
MIRT2144129	hsa-miR-3941	CLIP-seq
MIRT2144130	hsa-miR-4429	CLIP-seq
MIRT2144131	hsa-miR-4517	CLIP-seq
MIRT2144132	hsa-miR-4643	CLIP-seq
MIRT2144133	hsa-miR-4677-5p	CLIP-seq
MIRT2144134	hsa-miR-543	CLIP-seq
MIRT2144135	hsa-miR-548n	CLIP-seq
MIRT2144136	hsa-miR-548v	CLIP-seq
MIRT2144137	hsa-miR-603	CLIP-seq
MIRT1478617	hsa-miR-655	CLIP-seq
MIRT2144138	hsa-miR-922	CLIP-seq
MIRT2364355	hsa-miR-2278	CLIP-seq
MIRT2144120	hsa-miR-3143	CLIP-seq
MIRT2144125	hsa-miR-323-3p	CLIP-seq
MIRT2144126	hsa-miR-329	CLIP-seq
MIRT2144127	hsa-miR-338-5p	CLIP-seq
MIRT2144128	hsa-miR-362-3p	CLIP-seq
MIRT1478578	hsa-miR-369-3p	CLIP-seq
MIRT1478579	hsa-miR-374a	CLIP-seq
MIRT1478580	hsa-miR-374b	CLIP-seq
MIRT1478581	hsa-miR-374c	CLIP-seq
MIRT2364356	hsa-miR-3919	CLIP-seq
MIRT2144131	hsa-miR-4517	CLIP-seq
MIRT2364357	hsa-miR-4533	CLIP-seq
MIRT2364358	hsa-miR-4672	CLIP-seq
MIRT2364359	hsa-miR-4756-3p	CLIP-seq
MIRT2364360	hsa-miR-4762-5p	CLIP-seq
MIRT1478600	hsa-miR-513b	CLIP-seq
MIRT2144134	hsa-miR-543	CLIP-seq
MIRT2144135	hsa-miR-548n	CLIP-seq
MIRT1478617	hsa-miR-655	CLIP-seq
MIRT2144138	hsa-miR-922	CLIP-seq
MIRT1478578	hsa-miR-369-3p	CLIP-seq
MIRT1478579	hsa-miR-374a	CLIP-seq
MIRT1478580	hsa-miR-374b	CLIP-seq
MIRT1478581	hsa-miR-374c	CLIP-seq
MIRT1478617	hsa-miR-655	CLIP-seq
MIRT1478569	hsa-miR-1202	CLIP-seq
MIRT1478577	hsa-miR-3194-5p	CLIP-seq
MIRT2463033	hsa-miR-346	CLIP-seq
MIRT2463034	hsa-miR-361-3p	CLIP-seq
MIRT1478585	hsa-miR-3972	CLIP-seq
MIRT2463035	hsa-miR-4267	CLIP-seq
MIRT2463036	hsa-miR-4288	CLIP-seq
MIRT2463037	hsa-miR-4530	CLIP-seq
MIRT2463038	hsa-miR-4711-3p	CLIP-seq
MIRT2463039	hsa-miR-4727-5p	CLIP-seq
MIRT2463040	hsa-miR-4769-3p	CLIP-seq
MIRT2463041	hsa-miR-632	CLIP-seq
MIRT1478569	hsa-miR-1202	CLIP-seq
MIRT2658139	hsa-miR-1208	CLIP-seq
MIRT2658140	hsa-miR-124	CLIP-seq
MIRT2658141	hsa-miR-1245	CLIP-seq
MIRT2658142	hsa-miR-1254	CLIP-seq
MIRT2658143	hsa-miR-1266	CLIP-seq
MIRT2658144	hsa-miR-185	CLIP-seq
MIRT1478574	hsa-miR-1915	CLIP-seq
MIRT2658145	hsa-miR-2355-5p	CLIP-seq
MIRT2658146	hsa-miR-28-3p	CLIP-seq
MIRT2658147	hsa-miR-2861	CLIP-seq
MIRT2658148	hsa-miR-296-5p	CLIP-seq
MIRT2658149	hsa-miR-298	CLIP-seq
MIRT2658150	hsa-miR-3065-5p	CLIP-seq
MIRT2658151	hsa-miR-3074-5p	CLIP-seq
MIRT2658152	hsa-miR-3115	CLIP-seq
MIRT2658153	hsa-miR-3116	CLIP-seq
MIRT2658154	hsa-miR-3145-5p	CLIP-seq
MIRT2658155	hsa-miR-3160-3p	CLIP-seq
MIRT2658156	hsa-miR-3160-5p	CLIP-seq
MIRT1478577	hsa-miR-3194-5p	CLIP-seq
MIRT2144121	hsa-miR-320a	CLIP-seq
MIRT2144122	hsa-miR-320b	CLIP-seq
MIRT2144123	hsa-miR-320c	CLIP-seq
MIRT2144124	hsa-miR-320d	CLIP-seq
MIRT2658157	hsa-miR-323-5p	CLIP-seq
MIRT2463033	hsa-miR-346	CLIP-seq
MIRT2658158	hsa-miR-3606	CLIP-seq
MIRT2658159	hsa-miR-3622a-3p	CLIP-seq
MIRT2658160	hsa-miR-3622b-3p	CLIP-seq
MIRT2658161	hsa-miR-3650	CLIP-seq
MIRT2658162	hsa-miR-3655	CLIP-seq
MIRT2658163	hsa-miR-3679-3p	CLIP-seq
MIRT2658164	hsa-miR-378g	CLIP-seq
MIRT2658165	hsa-miR-3944-5p	CLIP-seq
MIRT1478585	hsa-miR-3972	CLIP-seq
MIRT2658166	hsa-miR-3973	CLIP-seq
MIRT2658167	hsa-miR-4254	CLIP-seq
MIRT2463035	hsa-miR-4267	CLIP-seq
MIRT2658168	hsa-miR-4279	CLIP-seq
MIRT2463036	hsa-miR-4288	CLIP-seq
MIRT2658169	hsa-miR-4306	CLIP-seq
MIRT1478587	hsa-miR-4307	CLIP-seq
MIRT2658170	hsa-miR-4423-5p	CLIP-seq
MIRT2144130	hsa-miR-4429	CLIP-seq
MIRT2658171	hsa-miR-4446-3p	CLIP-seq
MIRT2658172	hsa-miR-4480	CLIP-seq
MIRT2658173	hsa-miR-4487	CLIP-seq
MIRT2658174	hsa-miR-4518	CLIP-seq
MIRT2658175	hsa-miR-452	CLIP-seq
MIRT2463037	hsa-miR-4530	CLIP-seq
MIRT2658176	hsa-miR-4539	CLIP-seq
MIRT2658177	hsa-miR-4644	CLIP-seq
MIRT2658178	hsa-miR-4656	CLIP-seq
MIRT2658179	hsa-miR-4659a-3p	CLIP-seq
MIRT2658180	hsa-miR-4659b-3p	CLIP-seq
MIRT2658181	hsa-miR-4676-3p	CLIP-seq
MIRT2658182	hsa-miR-4677-3p	CLIP-seq
MIRT1478593	hsa-miR-4703-3p	CLIP-seq
MIRT2463038	hsa-miR-4711-3p	CLIP-seq
MIRT2463039	hsa-miR-4727-5p	CLIP-seq
MIRT2658183	hsa-miR-4765	CLIP-seq
MIRT2463040	hsa-miR-4769-3p	CLIP-seq
MIRT2658184	hsa-miR-4778-5p	CLIP-seq
MIRT2658185	hsa-miR-4793-3p	CLIP-seq
MIRT2658186	hsa-miR-4799-5p	CLIP-seq
MIRT2658187	hsa-miR-486-3p	CLIP-seq
MIRT2658188	hsa-miR-505	CLIP-seq
MIRT2658189	hsa-miR-506	CLIP-seq
MIRT2658190	hsa-miR-508-5p	CLIP-seq
MIRT2658191	hsa-miR-516a-3p	CLIP-seq
MIRT2658192	hsa-miR-558	CLIP-seq
MIRT2658193	hsa-miR-578	CLIP-seq
MIRT1478616	hsa-miR-596	CLIP-seq
MIRT2463041	hsa-miR-632	CLIP-seq
MIRT2658194	hsa-miR-661	CLIP-seq
MIRT2658195	hsa-miR-876-3p	CLIP-seq
MIRT2658196	hsa-miR-9	CLIP-seq
MIRT2144138	hsa-miR-922	CLIP-seq
MIRT1478569	hsa-miR-1202	CLIP-seq
MIRT2658139	hsa-miR-1208	CLIP-seq
MIRT2658140	hsa-miR-124	CLIP-seq
MIRT2658141	hsa-miR-1245	CLIP-seq
MIRT1478572	hsa-miR-1245b-3p	CLIP-seq
MIRT2658142	hsa-miR-1254	CLIP-seq
MIRT2658143	hsa-miR-1266	CLIP-seq
MIRT2694818	hsa-miR-1271	CLIP-seq
MIRT2694819	hsa-miR-182	CLIP-seq
MIRT2658144	hsa-miR-185	CLIP-seq
MIRT1478574	hsa-miR-1915	CLIP-seq
MIRT2658145	hsa-miR-2355-5p	CLIP-seq
MIRT2658148	hsa-miR-296-5p	CLIP-seq
MIRT2658149	hsa-miR-298	CLIP-seq
MIRT2658151	hsa-miR-3074-5p	CLIP-seq
MIRT2658153	hsa-miR-3116	CLIP-seq
MIRT2658155	hsa-miR-3160-3p	CLIP-seq
MIRT1478577	hsa-miR-3194-5p	CLIP-seq
MIRT2463033	hsa-miR-346	CLIP-seq
MIRT2658158	hsa-miR-3606	CLIP-seq
MIRT2658159	hsa-miR-3622a-3p	CLIP-seq
MIRT2658160	hsa-miR-3622b-3p	CLIP-seq
MIRT2658161	hsa-miR-3650	CLIP-seq
MIRT2658163	hsa-miR-3679-3p	CLIP-seq
MIRT2658164	hsa-miR-378g	CLIP-seq
MIRT2658165	hsa-miR-3944-5p	CLIP-seq
MIRT1478585	hsa-miR-3972	CLIP-seq
MIRT2658166	hsa-miR-3973	CLIP-seq
MIRT2658167	hsa-miR-4254	CLIP-seq
MIRT2463035	hsa-miR-4267	CLIP-seq
MIRT2463036	hsa-miR-4288	CLIP-seq
MIRT2658169	hsa-miR-4306	CLIP-seq
MIRT2658170	hsa-miR-4423-5p	CLIP-seq
MIRT2658172	hsa-miR-4480	CLIP-seq
MIRT2658173	hsa-miR-4487	CLIP-seq
MIRT2658174	hsa-miR-4518	CLIP-seq
MIRT2658175	hsa-miR-452	CLIP-seq
MIRT2463037	hsa-miR-4530	CLIP-seq
MIRT2658177	hsa-miR-4644	CLIP-seq
MIRT2658179	hsa-miR-4659a-3p	CLIP-seq
MIRT2658180	hsa-miR-4659b-3p	CLIP-seq
MIRT2658181	hsa-miR-4676-3p	CLIP-seq
MIRT2658182	hsa-miR-4677-3p	CLIP-seq
MIRT2463038	hsa-miR-4711-3p	CLIP-seq
MIRT2463039	hsa-miR-4727-5p	CLIP-seq
MIRT2658183	hsa-miR-4765	CLIP-seq
MIRT2463040	hsa-miR-4769-3p	CLIP-seq
MIRT2658185	hsa-miR-4793-3p	CLIP-seq
MIRT2658186	hsa-miR-4799-5p	CLIP-seq
MIRT2658187	hsa-miR-486-3p	CLIP-seq
MIRT2658189	hsa-miR-506	CLIP-seq
MIRT2658191	hsa-miR-516a-3p	CLIP-seq
MIRT2658192	hsa-miR-558	CLIP-seq
MIRT1478616	hsa-miR-596	CLIP-seq
MIRT2463041	hsa-miR-632	CLIP-seq
MIRT2658194	hsa-miR-661	CLIP-seq
MIRT2144138	hsa-miR-922	CLIP-seq
MIRT2694820	hsa-miR-96	CLIP-seq

Gene ontology (GO) Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000422	Process	Autophagy of mitochondrion	IDA	25621951
GO:0000422	Process	Autophagy of mitochondrion	IMP	24896179
GO:0000425	Process	Pexophagy	TAS
GO:0004197	Function	Cysteine-type endopeptidase activity	IMP	24896179
GO:0004843	Function	Cysteine-type deubiquitinase activity	IBA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	14715245, 24896179, 25621951
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005741	Component	Mitochondrial outer membrane	IDA	24896179
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005778	Component	Peroxisomal membrane	TAS
GO:0005829	Component	Cytosol	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0008053	Process	Mitochondrial fusion	IEA
GO:0008053	Process	Mitochondrial fusion	ISS
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016579	Process	Protein deubiquitination	IDA	24896179
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0031647	Process	Regulation of protein stability	IBA
GO:0035871	Process	Protein K11-linked deubiquitination	IDA	25621951
GO:0044313	Process	Protein K6-linked deubiquitination	IDA	25621951
GO:0101005	Function	Deubiquitinase activity	TAS
GO:1901525	Process	Negative regulation of mitophagy	IEA

Other IDs

• MIM: 612492
• HGNC: 20065
• e!Ensembl: ENSG00000135093

Protein

• UniProt ID: Q70CQ3
• Protein name: Ubiquitin carboxyl-terminal hydrolase 30 (EC 3.4.19.12) (Deubiquitinating enzyme 30) (Ubiquitin thioesterase 30) (Ubiquitin-specific-processing protease 30) (Ub-specific protease 30)
• Protein function: Deubiquitinating enzyme tethered to the mitochondrial outer membrane that acts as a key inhibitor of mitophagy by counteracting the action of parkin (PRKN): hydrolyzes ubiquitin attached by parkin on target proteins, such as RHOT1/MIRO1 and TOMM
• PDB: 5OHK , 5OHN , 5OHP , 8D0A , 8D1T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00443	UCH	68 → 499	Ubiquitin carboxyl-terminal hydrolase	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in skeletal muscle, pancreas, liver and kidney. {ECO:0000269|PubMed:14715245}.
• Sequence:

  MLSSRAEAAMTAADRAIQRFLRTGAAVRYKVMKNWGVIGGIAAALAAGIYVIWGPITERK
  KRRKGLVPGLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQKEPPSHQYLSLTL
  LHLLKALSCQEVTDDEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQ
  PRVTHLFDVHSLEQQSEITPKQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQ
  SPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEK
  VEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLG
  HKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMP
  FPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDT
  VRKASLQEVLSSSAYLLFYERVLSRMQHQSQECKSEE

• Sequence length: 517

Pathways

KEGG Pathway	Reactome Pathway
Mitophagy - animal	Ub-specific processing proteases
	Pexophagy

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Malignant tumor of esophagus	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (21)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	25915564	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	33609088	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37110517	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	35031063	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35260141	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal neovascularization	Pubtator	36579659	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34653676	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34653676	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	32636217	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	35737447	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34694569	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30143522		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30143522		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30143522		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35029926	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	32636217	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33179541, 38054797	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24896179		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34674795	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	33609088	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36474192	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

FKBP8 2 shared pathwaysMitophagy - animal, Ub-specific processing proteases Related via 2 shared pathways including Mitophagy - animal, Ub-specific processing proteases. MUL1 2 shared pathwaysMitophagy - animal, Ub-specific processing proteases Related via 2 shared pathways including Mitophagy - animal, Ub-specific processing proteases. USP15 2 shared pathwaysMitophagy - animal, Ub-specific processing proteases Related via 2 shared pathways including Mitophagy - animal, Ub-specific processing proteases. NBR1 2 shared pathwaysMitophagy - animal, Pexophagy Related via 2 shared pathways including Mitophagy - animal, Pexophagy. RHOT1 2 shared pathwaysMitophagy - animal, Ub-specific processing proteases Related via 2 shared pathways including Mitophagy - animal, Ub-specific processing proteases.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
FKBP8	0	[]	2	["Mitophagy - animal","Ub-specific processing proteases"]	0	[]
MUL1	0	[]	2	["Mitophagy - animal","Ub-specific processing proteases"]	0	[]
USP15	0	[]	2	["Mitophagy - animal","Ub-specific processing proteases"]	0	[]
NBR1	0	[]	2	["Mitophagy - animal","Pexophagy"]	0	[]
RHOT1	0	[]	2	["Mitophagy - animal","Ub-specific processing proteases"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 1 of 5 related genesFKBP8 Attention deficit hyperactivity disorder Linked via 1 of 5 related genesFKBP8 Breast cancer Linked via 1 of 5 related genesFKBP8 Crohn disease Linked via 1 of 5 related genesFKBP8 Gastroesophageal reflux disease Linked via 1 of 5 related genesFKBP8

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	1	["FKBP8"]
Attention deficit hyperactivity disorder	1	["FKBP8"]
Breast cancer	1	["FKBP8"]
Crohn disease	1	["FKBP8"]
Gastroesophageal reflux disease	1	["FKBP8"]