RHOT1 (ras homolog family member T1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 55288
• Gene name: Ras homolog family member T1
• Gene symbol: RHOT1
• Synonyms (NCBI Gene): ARHT1, MIRO-1, MIRO1
• Chromosome: 17
• Chromosome location: 17q11.2

miRNA Show/Hide all (222)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000900	hsa-miR-15a-5p	Microarray	18362358
MIRT000899	hsa-miR-16-5p	Microarray	18362358
MIRT018247	hsa-miR-335-5p	Microarray	18185580
MIRT036811	hsa-miR-877-3p	CLASH	23622248
MIRT438490	hsa-miR-139-5p	Luciferase reporter assay	24158791
MIRT438490	hsa-miR-139-5p	Luciferase reporter assay	24158791
MIRT1306041	hsa-miR-200b	CLIP-seq
MIRT1306042	hsa-miR-200c	CLIP-seq
MIRT1306043	hsa-miR-217	CLIP-seq
MIRT1306044	hsa-miR-3146	CLIP-seq
MIRT1306045	hsa-miR-323b-3p	CLIP-seq
MIRT1306046	hsa-miR-34b	CLIP-seq
MIRT1306047	hsa-miR-3614-5p	CLIP-seq
MIRT1306048	hsa-miR-376c	CLIP-seq
MIRT1306049	hsa-miR-429	CLIP-seq
MIRT1306050	hsa-miR-4418	CLIP-seq
MIRT1306051	hsa-miR-450b-3p	CLIP-seq
MIRT1306052	hsa-miR-4662a-5p	CLIP-seq
MIRT1306053	hsa-miR-509-3-5p	CLIP-seq
MIRT1306054	hsa-miR-509-5p	CLIP-seq
MIRT1306055	hsa-miR-577	CLIP-seq
MIRT1306056	hsa-miR-614	CLIP-seq
MIRT1306057	hsa-miR-621	CLIP-seq
MIRT1306058	hsa-miR-769-3p	CLIP-seq
MIRT1306059	hsa-miR-3140-5p	CLIP-seq
MIRT1306046	hsa-miR-34b	CLIP-seq
MIRT1306048	hsa-miR-376c	CLIP-seq
MIRT1306060	hsa-miR-4427	CLIP-seq
MIRT1306061	hsa-miR-4699-3p	CLIP-seq
MIRT1306055	hsa-miR-577	CLIP-seq
MIRT1306056	hsa-miR-614	CLIP-seq
MIRT1306059	hsa-miR-3140-5p	CLIP-seq
MIRT1306062	hsa-miR-320e	CLIP-seq
MIRT1306046	hsa-miR-34b	CLIP-seq
MIRT1306048	hsa-miR-376c	CLIP-seq
MIRT1306060	hsa-miR-4427	CLIP-seq
MIRT1306063	hsa-miR-4781-3p	CLIP-seq
MIRT1306064	hsa-miR-4786-5p	CLIP-seq
MIRT1306055	hsa-miR-577	CLIP-seq
MIRT1306056	hsa-miR-614	CLIP-seq
MIRT2315345	hsa-miR-199a-3p	CLIP-seq
MIRT2315346	hsa-miR-199b-3p	CLIP-seq
MIRT2315347	hsa-miR-297	CLIP-seq
MIRT2315348	hsa-miR-3117-5p	CLIP-seq
MIRT2315349	hsa-miR-3129-5p	CLIP-seq
MIRT2315350	hsa-miR-3149	CLIP-seq
MIRT1306047	hsa-miR-3614-5p	CLIP-seq
MIRT2315351	hsa-miR-421	CLIP-seq
MIRT2315352	hsa-miR-4272	CLIP-seq
MIRT2315353	hsa-miR-4307	CLIP-seq
MIRT2315354	hsa-miR-4480	CLIP-seq
MIRT1306051	hsa-miR-450b-3p	CLIP-seq
MIRT2315355	hsa-miR-4709-5p	CLIP-seq
MIRT2315356	hsa-miR-494	CLIP-seq
MIRT2315357	hsa-miR-548c-3p	CLIP-seq
MIRT2315358	hsa-miR-567	CLIP-seq
MIRT2315359	hsa-miR-643	CLIP-seq
MIRT1306058	hsa-miR-769-3p	CLIP-seq
MIRT1306044	hsa-miR-3146	CLIP-seq
MIRT2315360	hsa-miR-3163	CLIP-seq
MIRT2315361	hsa-miR-4282	CLIP-seq
MIRT2315362	hsa-miR-664	CLIP-seq
MIRT2393735	hsa-miR-185	CLIP-seq
MIRT2315347	hsa-miR-297	CLIP-seq
MIRT2315350	hsa-miR-3149	CLIP-seq
MIRT2393736	hsa-miR-4306	CLIP-seq
MIRT2315353	hsa-miR-4307	CLIP-seq
MIRT2393737	hsa-miR-4470	CLIP-seq
MIRT2393738	hsa-miR-4644	CLIP-seq
MIRT2393739	hsa-miR-4694-3p	CLIP-seq
MIRT2315357	hsa-miR-548c-3p	CLIP-seq
MIRT2315358	hsa-miR-567	CLIP-seq
MIRT2315359	hsa-miR-643	CLIP-seq
MIRT2611631	hsa-miR-106a	CLIP-seq
MIRT2611632	hsa-miR-106b	CLIP-seq
MIRT2611633	hsa-miR-1245	CLIP-seq
MIRT2611634	hsa-miR-135a	CLIP-seq
MIRT2611635	hsa-miR-135b	CLIP-seq
MIRT2611636	hsa-miR-142-5p	CLIP-seq
MIRT2611637	hsa-miR-151-3p	CLIP-seq
MIRT2611638	hsa-miR-17	CLIP-seq
MIRT2393735	hsa-miR-185	CLIP-seq
MIRT2315345	hsa-miR-199a-3p	CLIP-seq
MIRT2315346	hsa-miR-199b-3p	CLIP-seq
MIRT2611639	hsa-miR-204	CLIP-seq
MIRT2611640	hsa-miR-20a	CLIP-seq
MIRT2611641	hsa-miR-20b	CLIP-seq
MIRT2611642	hsa-miR-211	CLIP-seq
MIRT2315347	hsa-miR-297	CLIP-seq
MIRT2611643	hsa-miR-302f	CLIP-seq
MIRT2315348	hsa-miR-3117-5p	CLIP-seq
MIRT2315349	hsa-miR-3129-5p	CLIP-seq
MIRT2611644	hsa-miR-3140-3p	CLIP-seq
MIRT1306059	hsa-miR-3140-5p	CLIP-seq
MIRT2315350	hsa-miR-3149	CLIP-seq
MIRT2611645	hsa-miR-3160-3p	CLIP-seq
MIRT1306062	hsa-miR-320e	CLIP-seq
MIRT1306046	hsa-miR-34b	CLIP-seq
MIRT2611646	hsa-miR-3609	CLIP-seq
MIRT1306047	hsa-miR-3614-5p	CLIP-seq
MIRT2611647	hsa-miR-3620	CLIP-seq
MIRT2611648	hsa-miR-3689a-3p	CLIP-seq
MIRT2611649	hsa-miR-3689c	CLIP-seq
MIRT1306048	hsa-miR-376c	CLIP-seq
MIRT2611650	hsa-miR-3922-5p	CLIP-seq
MIRT2611651	hsa-miR-3938	CLIP-seq
MIRT2611652	hsa-miR-412	CLIP-seq
MIRT2315351	hsa-miR-421	CLIP-seq
MIRT2315352	hsa-miR-4272	CLIP-seq
MIRT2611653	hsa-miR-4303	CLIP-seq
MIRT2611654	hsa-miR-4305	CLIP-seq
MIRT2393736	hsa-miR-4306	CLIP-seq
MIRT2315353	hsa-miR-4307	CLIP-seq
MIRT1306060	hsa-miR-4427	CLIP-seq
MIRT2611655	hsa-miR-4453	CLIP-seq
MIRT2611656	hsa-miR-4463	CLIP-seq
MIRT2393737	hsa-miR-4470	CLIP-seq
MIRT2611657	hsa-miR-4487	CLIP-seq
MIRT2611658	hsa-miR-4499	CLIP-seq
MIRT1306051	hsa-miR-450b-3p	CLIP-seq
MIRT2611659	hsa-miR-4522	CLIP-seq
MIRT2611660	hsa-miR-4538	CLIP-seq
MIRT2393738	hsa-miR-4644	CLIP-seq
MIRT2611661	hsa-miR-4682	CLIP-seq
MIRT2393739	hsa-miR-4694-3p	CLIP-seq
MIRT1306061	hsa-miR-4699-3p	CLIP-seq
MIRT2315355	hsa-miR-4709-5p	CLIP-seq
MIRT2611662	hsa-miR-4731-3p	CLIP-seq
MIRT2611663	hsa-miR-4755-5p	CLIP-seq
MIRT2611664	hsa-miR-4777-5p	CLIP-seq
MIRT1306063	hsa-miR-4781-3p	CLIP-seq
MIRT1306064	hsa-miR-4786-5p	CLIP-seq
MIRT2611665	hsa-miR-4792	CLIP-seq
MIRT2611666	hsa-miR-4796-3p	CLIP-seq
MIRT2611667	hsa-miR-4801	CLIP-seq
MIRT2611668	hsa-miR-4803	CLIP-seq
MIRT2315356	hsa-miR-494	CLIP-seq
MIRT2611669	hsa-miR-512-5p	CLIP-seq
MIRT2611670	hsa-miR-518d-5p	CLIP-seq
MIRT2611671	hsa-miR-519b-5p	CLIP-seq
MIRT2611672	hsa-miR-519c-5p	CLIP-seq
MIRT2611673	hsa-miR-519d	CLIP-seq
MIRT2611674	hsa-miR-520c-5p	CLIP-seq
MIRT2611675	hsa-miR-520d-5p	CLIP-seq
MIRT2611676	hsa-miR-524-5p	CLIP-seq
MIRT2611677	hsa-miR-526a	CLIP-seq
MIRT2611678	hsa-miR-548ah	CLIP-seq
MIRT2315357	hsa-miR-548c-3p	CLIP-seq
MIRT2611679	hsa-miR-548m	CLIP-seq
MIRT2611680	hsa-miR-558	CLIP-seq
MIRT2315358	hsa-miR-567	CLIP-seq
MIRT1306055	hsa-miR-577	CLIP-seq
MIRT1306056	hsa-miR-614	CLIP-seq
MIRT2611681	hsa-miR-623	CLIP-seq
MIRT2611682	hsa-miR-640	CLIP-seq
MIRT2315359	hsa-miR-643	CLIP-seq
MIRT1306058	hsa-miR-769-3p	CLIP-seq
MIRT2611683	hsa-miR-93	CLIP-seq
MIRT2611631	hsa-miR-106a	CLIP-seq
MIRT2611632	hsa-miR-106b	CLIP-seq
MIRT2611633	hsa-miR-1245	CLIP-seq
MIRT2611636	hsa-miR-142-5p	CLIP-seq
MIRT2611638	hsa-miR-17	CLIP-seq
MIRT2393735	hsa-miR-185	CLIP-seq
MIRT2315345	hsa-miR-199a-3p	CLIP-seq
MIRT2315346	hsa-miR-199b-3p	CLIP-seq
MIRT2611640	hsa-miR-20a	CLIP-seq
MIRT2611641	hsa-miR-20b	CLIP-seq
MIRT2315347	hsa-miR-297	CLIP-seq
MIRT2611643	hsa-miR-302f	CLIP-seq
MIRT2315348	hsa-miR-3117-5p	CLIP-seq
MIRT2315349	hsa-miR-3129-5p	CLIP-seq
MIRT2611644	hsa-miR-3140-3p	CLIP-seq
MIRT1306059	hsa-miR-3140-5p	CLIP-seq
MIRT2315350	hsa-miR-3149	CLIP-seq
MIRT2611645	hsa-miR-3160-3p	CLIP-seq
MIRT1306046	hsa-miR-34b	CLIP-seq
MIRT2611646	hsa-miR-3609	CLIP-seq
MIRT1306047	hsa-miR-3614-5p	CLIP-seq
MIRT2611647	hsa-miR-3620	CLIP-seq
MIRT2611648	hsa-miR-3689a-3p	CLIP-seq
MIRT2611649	hsa-miR-3689c	CLIP-seq
MIRT1306048	hsa-miR-376c	CLIP-seq
MIRT2611652	hsa-miR-412	CLIP-seq
MIRT2315351	hsa-miR-421	CLIP-seq
MIRT2315352	hsa-miR-4272	CLIP-seq
MIRT2611653	hsa-miR-4303	CLIP-seq
MIRT2393736	hsa-miR-4306	CLIP-seq
MIRT2315353	hsa-miR-4307	CLIP-seq
MIRT1306060	hsa-miR-4427	CLIP-seq
MIRT2611655	hsa-miR-4453	CLIP-seq
MIRT2393737	hsa-miR-4470	CLIP-seq
MIRT2611657	hsa-miR-4487	CLIP-seq
MIRT1306051	hsa-miR-450b-3p	CLIP-seq
MIRT2611660	hsa-miR-4538	CLIP-seq
MIRT2393738	hsa-miR-4644	CLIP-seq
MIRT2611661	hsa-miR-4682	CLIP-seq
MIRT2393739	hsa-miR-4694-3p	CLIP-seq
MIRT2315355	hsa-miR-4709-5p	CLIP-seq
MIRT2611664	hsa-miR-4777-5p	CLIP-seq
MIRT1306064	hsa-miR-4786-5p	CLIP-seq
MIRT2611665	hsa-miR-4792	CLIP-seq
MIRT2611666	hsa-miR-4796-3p	CLIP-seq
MIRT2611668	hsa-miR-4803	CLIP-seq
MIRT2315356	hsa-miR-494	CLIP-seq
MIRT2611669	hsa-miR-512-5p	CLIP-seq
MIRT2611670	hsa-miR-518d-5p	CLIP-seq
MIRT2611671	hsa-miR-519b-5p	CLIP-seq
MIRT2611672	hsa-miR-519c-5p	CLIP-seq
MIRT2611673	hsa-miR-519d	CLIP-seq
MIRT2611674	hsa-miR-520c-5p	CLIP-seq
MIRT2611677	hsa-miR-526a	CLIP-seq
MIRT2611678	hsa-miR-548ah	CLIP-seq
MIRT2315357	hsa-miR-548c-3p	CLIP-seq
MIRT2611679	hsa-miR-548m	CLIP-seq
MIRT2611680	hsa-miR-558	CLIP-seq
MIRT2315358	hsa-miR-567	CLIP-seq
MIRT1306055	hsa-miR-577	CLIP-seq
MIRT1306056	hsa-miR-614	CLIP-seq
MIRT2315359	hsa-miR-643	CLIP-seq
MIRT1306058	hsa-miR-769-3p	CLIP-seq
MIRT2611683	hsa-miR-93	CLIP-seq

Gene ontology (GO) Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	27605430, 33132189
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	30513825
GO:0003924	Function	GTPase activity	IEA
GO:0005509	Function	Calcium ion binding	IDA	27605430
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	16630562, 19135897, 19528298, 22078885, 24995978, 33961781
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IDA	33132189
GO:0005525	Function	GTP binding	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	NAS	22078885
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005741	Component	Mitochondrial outer membrane	IDA	12482879, 19528298
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0007005	Process	Mitochondrion organization	IBA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0010821	Process	Regulation of mitochondrion organization	IMP	27716788
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IDA	30513825
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0019003	Function	GDP binding	IDA	27605430
GO:0019725	Process	Cellular homeostasis	IMP	12482879
GO:0046872	Function	Metal ion binding	IEA
GO:0047497	Process	Mitochondrion transport along microtubule	IBA
GO:0047497	Process	Mitochondrion transport along microtubule	IEA
GO:0047497	Process	Mitochondrion transport along microtubule	IMP	16630562
GO:0097345	Process	Mitochondrial outer membrane permeabilization	IEA
GO:0097345	Process	Mitochondrial outer membrane permeabilization	IMP	12482879

Other IDs

• MIM: 613888
• HGNC: 21168
• e!Ensembl: ENSG00000126858

Protein

• UniProt ID: Q8IXI2
• Protein name: Mitochondrial Rho GTPase 1 (MIRO-1) (hMiro-1) (EC 3.6.5.-) (Rac-GTP-binding protein-like protein) (Ras homolog gene family member T1)
• Protein function: Atypical mitochondrial nucleoside-triphosphatase (NTPase) involved in mitochondrial trafficking (PubMed:12482879, PubMed:16630562, PubMed:22396657, PubMed:30513825). Probably involved in control of anterograde transport of mitochondria and their
• PDB: 5KSO , 5KSP , 5KSY , 5KSZ , 5KTY , 5KU1 , 6D71
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	6 → 168	Ras family	Domain
  PF08355	EF_assoc_1	341 → 413	EF hand associated	Family
  PF08356	EF_assoc_2	219 → 305	EF hand associated	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. Expressed at high level in heart and skeletal muscle. {ECO:0000269|PubMed:12482879}.
• Sequence:

  MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSE
  AEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKS
  DLVEYSSMETILPIMNQYTEIETCVECSAKNLKNISELFYYAQKAVLHPTGPLYCPEEKE
  MKPACIKALTRIFKISDQDNDGTLNDAELNFFQRICFNTPLAPQALEDVKNVVRKHISDG
  VADSGLTLKGFLFLHTLFIQRGRHETTWTVLRRFGYDDDLDLTPEYLFPLLKIPPDCTTE
  LNHHAYLFLQSTFDKHDLDRDCALSPDELKDLFKVFPYIPWGPDVNNTVCTNERGWITYQ
  GFLSQWTLTTYLDVQRCLEYLGYLGYSILTEQESQASAVTVTRDKKIDLQKKQTQRNVFR
  CNVIGVKNCGKSGVLQALLGRNLMRQKKIREDHKSYYAINTVYVYGQEKYLLLHDISESE
  FLTEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSI
  SPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYPHVTQADLKSSTFWLRASFGA
  TVFAVLGFAMYKALLKQR

• Sequence length: 618

Pathways

KEGG Pathway	Reactome Pathway
Mitophagy - animal	Rho GTPase cycle
	Ub-specific processing proteases

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
CATARACT	—	GWAS catalog	34127677	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASOPHARYNGEAL NEOPLASM	—	GWAS catalog	24376627	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	38637617	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (20)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22258555, 28973175		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33374314	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29562677		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37587156	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29207597		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29207597		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29207597		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29365285		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29207597		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	31593750	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	31593750		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22860091	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	31593750	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24671417		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	37003181, 37364399	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22860091, 32697386	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24671417, 28598236, 29372317, 31564441		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	28598233, 28598236, 31303019, 32280985, 32948353, 37003181, 37364399, 38060381	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	24671417		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29365285		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

BIN3 2 shared diseasesCataract, Post-traumatic stress disorder 2 shared evidence sourcesGWAS catalog (Cataract), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Cataract, Post-traumatic stress disorder — evidence mostly GWAS catalog. EGR3 2 shared diseasesCataract, Post-traumatic stress disorder 2 shared evidence sourcesGWAS catalog (Cataract), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Cataract, Post-traumatic stress disorder — evidence mostly GWAS catalog. EFNA5 2 shared diseasesCataract, Post-traumatic stress disorder 2 shared evidence sourcesGWAS catalog (Cataract), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Cataract, Post-traumatic stress disorder — evidence mostly GWAS catalog. TNKS 2 shared diseasesCataract, Post-traumatic stress disorder 1 shared pathwayUb-specific processing proteases 2 shared evidence sourcesGWAS catalog (Cataract), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Cataract, Post-traumatic stress disorder — evidence mostly GWAS catalog. FKBP8 2 shared pathwaysMitophagy - animal, Ub-specific processing proteases Related via 2 shared pathways including Mitophagy - animal, Ub-specific processing proteases.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
BIN3	2	["Cataract","Post-traumatic stress disorder"]	0	[]	2	["GWAS catalog (Cataract)","GWAS catalog (Post-traumatic stress disorder)"]
EGR3	2	["Cataract","Post-traumatic stress disorder"]	0	[]	2	["GWAS catalog (Cataract)","GWAS catalog (Post-traumatic stress disorder)"]
EFNA5	2	["Cataract","Post-traumatic stress disorder"]	0	[]	2	["GWAS catalog (Cataract)","GWAS catalog (Post-traumatic stress disorder)"]
TNKS	2	["Cataract","Post-traumatic stress disorder"]	1	["Ub-specific processing proteases"]	2	["GWAS catalog (Cataract)","GWAS catalog (Post-traumatic stress disorder)"]
FKBP8	0	[]	2	["Mitophagy - animal","Ub-specific processing proteases"]	0	[]

Diseases Linked via Similar Genes

Color vision deficiency Linked via 3 of 5 related genesBIN3, EGR3, EFNA5 Bipolar disorder Linked via 3 of 5 related genesEGR3, EFNA5, TNKS Schizophrenia Linked via 3 of 5 related genesEGR3, EFNA5, TNKS Breast cancer Linked via 2 of 5 related genesBIN3, FKBP8 Otosclerosis Linked via 2 of 5 related genesBIN3, EGR3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Color vision deficiency	3	["BIN3","EGR3","EFNA5"]
Bipolar disorder	3	["EGR3","EFNA5","TNKS"]
Schizophrenia	3	["EGR3","EFNA5","TNKS"]
Breast cancer	2	["BIN3","FKBP8"]
Otosclerosis	2	["BIN3","EGR3"]