Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	79594
Gene name	Mitochondrial E3 ubiquitin protein ligase 1
Gene symbol	MUL1
Synonyms (NCBI Gene)	C1orf166GIDEMAPLMULANRNF218
Chromosome	1
Chromosome location	1p36.12

223 Show/Hide all (223)

miRTarBase ID	miRNA	Experiments	Reference
MIRT460960	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT460959	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT460958	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT460957	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT460956	hsa-miR-3153	PAR-CLIP	23592263
MIRT460955	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT460954	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT733763	hsa-miR-135b-5p	ImmunofluorescenceImmunohistochemistry (IHC)Immunoprecipitaion (IP)MicroarrayWestern blotting	34140641
MIRT460960	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT460959	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT460958	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT460957	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT460956	hsa-miR-3153	PAR-CLIP	23592263
MIRT460955	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT460954	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT1166469	hsa-miR-185	CLIP-seq
MIRT1166470	hsa-miR-193a-5p	CLIP-seq
MIRT1166471	hsa-miR-200b	CLIP-seq
MIRT1166472	hsa-miR-200c	CLIP-seq
MIRT1166473	hsa-miR-3192	CLIP-seq
MIRT1166474	hsa-miR-3622b-5p	CLIP-seq
MIRT1166475	hsa-miR-3689a-3p	CLIP-seq
MIRT1166476	hsa-miR-3689c	CLIP-seq
MIRT1166477	hsa-miR-4268	CLIP-seq
MIRT1166478	hsa-miR-429	CLIP-seq
MIRT1166479	hsa-miR-4306	CLIP-seq
MIRT1166480	hsa-miR-4448	CLIP-seq
MIRT1166481	hsa-miR-4459	CLIP-seq
MIRT1166482	hsa-miR-4469	CLIP-seq
MIRT1166483	hsa-miR-4644	CLIP-seq
MIRT1166484	hsa-miR-4691-5p	CLIP-seq
MIRT1166485	hsa-miR-4695-5p	CLIP-seq
MIRT1166486	hsa-miR-4705	CLIP-seq
MIRT1166487	hsa-miR-4728-5p	CLIP-seq
MIRT1166488	hsa-miR-4763-5p	CLIP-seq
MIRT1166489	hsa-miR-487a	CLIP-seq
MIRT1166490	hsa-miR-516b	CLIP-seq
MIRT1166491	hsa-miR-522	CLIP-seq
MIRT1166492	hsa-miR-665	CLIP-seq
MIRT2048085	hsa-miR-143	CLIP-seq
MIRT2048086	hsa-miR-181a	CLIP-seq
MIRT2048087	hsa-miR-181b	CLIP-seq
MIRT2048088	hsa-miR-181c	CLIP-seq
MIRT2048089	hsa-miR-181d	CLIP-seq
MIRT2048090	hsa-miR-1827	CLIP-seq
MIRT1166470	hsa-miR-193a-5p	CLIP-seq
MIRT1166471	hsa-miR-200b	CLIP-seq
MIRT1166472	hsa-miR-200c	CLIP-seq
MIRT1166473	hsa-miR-3192	CLIP-seq
MIRT2048091	hsa-miR-3612	CLIP-seq
MIRT1166474	hsa-miR-3622b-5p	CLIP-seq
MIRT2048092	hsa-miR-3654	CLIP-seq
MIRT1166475	hsa-miR-3689a-3p	CLIP-seq
MIRT1166476	hsa-miR-3689c	CLIP-seq
MIRT2048093	hsa-miR-377	CLIP-seq
MIRT2048094	hsa-miR-4257	CLIP-seq
MIRT2048095	hsa-miR-4262	CLIP-seq
MIRT1166478	hsa-miR-429	CLIP-seq
MIRT2048096	hsa-miR-4293	CLIP-seq
MIRT2048097	hsa-miR-4443	CLIP-seq
MIRT1166481	hsa-miR-4459	CLIP-seq
MIRT1166485	hsa-miR-4695-5p	CLIP-seq
MIRT1166487	hsa-miR-4728-5p	CLIP-seq
MIRT2048098	hsa-miR-4770	CLIP-seq
MIRT2048099	hsa-miR-4775	CLIP-seq
MIRT1166491	hsa-miR-522	CLIP-seq
MIRT2048100	hsa-miR-543	CLIP-seq
MIRT2048101	hsa-miR-544	CLIP-seq
MIRT2048102	hsa-miR-650	CLIP-seq
MIRT1166492	hsa-miR-665	CLIP-seq
MIRT2276905	hsa-miR-1207-5p	CLIP-seq
MIRT2276906	hsa-miR-1909	CLIP-seq
MIRT1166471	hsa-miR-200b	CLIP-seq
MIRT1166472	hsa-miR-200c	CLIP-seq
MIRT2276907	hsa-miR-2115	CLIP-seq
MIRT2276908	hsa-miR-3184	CLIP-seq
MIRT1166473	hsa-miR-3192	CLIP-seq
MIRT2276909	hsa-miR-342-5p	CLIP-seq
MIRT2276910	hsa-miR-3665	CLIP-seq
MIRT1166475	hsa-miR-3689a-3p	CLIP-seq
MIRT1166476	hsa-miR-3689c	CLIP-seq
MIRT2048094	hsa-miR-4257	CLIP-seq
MIRT1166478	hsa-miR-429	CLIP-seq
MIRT2276911	hsa-miR-4428	CLIP-seq
MIRT2276912	hsa-miR-4433	CLIP-seq
MIRT2276913	hsa-miR-4436b-3p	CLIP-seq
MIRT1166481	hsa-miR-4459	CLIP-seq
MIRT2276914	hsa-miR-4664-5p	CLIP-seq
MIRT2276915	hsa-miR-4668-5p	CLIP-seq
MIRT2276916	hsa-miR-4688	CLIP-seq
MIRT1166485	hsa-miR-4695-5p	CLIP-seq
MIRT2276917	hsa-miR-4710	CLIP-seq
MIRT1166487	hsa-miR-4728-5p	CLIP-seq
MIRT2276918	hsa-miR-4731-3p	CLIP-seq
MIRT2276919	hsa-miR-4736	CLIP-seq
MIRT2276920	hsa-miR-4763-3p	CLIP-seq
MIRT2276921	hsa-miR-4801	CLIP-seq
MIRT2276922	hsa-miR-510	CLIP-seq
MIRT2276923	hsa-miR-512-5p	CLIP-seq
MIRT2276924	hsa-miR-516a-3p	CLIP-seq
MIRT1166491	hsa-miR-522	CLIP-seq
MIRT2276925	hsa-miR-548aa	CLIP-seq
MIRT2276926	hsa-miR-570	CLIP-seq
MIRT2276927	hsa-miR-606	CLIP-seq
MIRT1166492	hsa-miR-665	CLIP-seq
MIRT2391189	hsa-miR-3925-3p	CLIP-seq
MIRT1166481	hsa-miR-4459	CLIP-seq
MIRT2276915	hsa-miR-4668-5p	CLIP-seq
MIRT2391190	hsa-miR-4779	CLIP-seq
MIRT2276925	hsa-miR-548aa	CLIP-seq
MIRT1166492	hsa-miR-665	CLIP-seq
MIRT2391191	hsa-miR-766	CLIP-seq
MIRT2454626	hsa-miR-3173-3p	CLIP-seq
MIRT2048091	hsa-miR-3612	CLIP-seq
MIRT2276911	hsa-miR-4428	CLIP-seq
MIRT2454627	hsa-miR-4477b	CLIP-seq
MIRT1166485	hsa-miR-4695-5p	CLIP-seq
MIRT2048102	hsa-miR-650	CLIP-seq
MIRT2276905	hsa-miR-1207-5p	CLIP-seq
MIRT2575642	hsa-miR-1236	CLIP-seq
MIRT2575643	hsa-miR-125a-5p	CLIP-seq
MIRT2575644	hsa-miR-125b	CLIP-seq
MIRT2276906	hsa-miR-1909	CLIP-seq
MIRT2276907	hsa-miR-2115	CLIP-seq
MIRT2575645	hsa-miR-2277-3p	CLIP-seq
MIRT2575646	hsa-miR-3148	CLIP-seq
MIRT2575647	hsa-miR-3185	CLIP-seq
MIRT2575648	hsa-miR-320a	CLIP-seq
MIRT2575649	hsa-miR-320b	CLIP-seq
MIRT2575650	hsa-miR-320c	CLIP-seq
MIRT2575651	hsa-miR-320d	CLIP-seq
MIRT2276909	hsa-miR-342-5p	CLIP-seq
MIRT2048091	hsa-miR-3612	CLIP-seq
MIRT2276910	hsa-miR-3665	CLIP-seq
MIRT2575652	hsa-miR-3689d	CLIP-seq
MIRT2575653	hsa-miR-3915	CLIP-seq
MIRT2575654	hsa-miR-3928	CLIP-seq
MIRT2575655	hsa-miR-4253	CLIP-seq
MIRT1166477	hsa-miR-4268	CLIP-seq
MIRT2575656	hsa-miR-4284	CLIP-seq
MIRT2575657	hsa-miR-4319	CLIP-seq
MIRT2575658	hsa-miR-4429	CLIP-seq
MIRT2276913	hsa-miR-4436b-3p	CLIP-seq
MIRT1166480	hsa-miR-4448	CLIP-seq
MIRT1166481	hsa-miR-4459	CLIP-seq
MIRT2575659	hsa-miR-452	CLIP-seq
MIRT2575660	hsa-miR-4532	CLIP-seq
MIRT2575661	hsa-miR-4640-3p	CLIP-seq
MIRT2276914	hsa-miR-4664-5p	CLIP-seq
MIRT2575662	hsa-miR-4668-3p	CLIP-seq
MIRT2575663	hsa-miR-4676-3p	CLIP-seq
MIRT1166484	hsa-miR-4691-5p	CLIP-seq
MIRT1166485	hsa-miR-4695-5p	CLIP-seq
MIRT2575664	hsa-miR-4732-3p	CLIP-seq
MIRT2276919	hsa-miR-4736	CLIP-seq
MIRT2276920	hsa-miR-4763-3p	CLIP-seq
MIRT1166488	hsa-miR-4763-5p	CLIP-seq
MIRT2575665	hsa-miR-486-3p	CLIP-seq
MIRT2276924	hsa-miR-516a-3p	CLIP-seq
MIRT2575666	hsa-miR-542-3p	CLIP-seq
MIRT2575667	hsa-miR-548c-3p	CLIP-seq
MIRT2575668	hsa-miR-548u	CLIP-seq
MIRT2575669	hsa-miR-577	CLIP-seq
MIRT2575670	hsa-miR-605	CLIP-seq
MIRT2048102	hsa-miR-650	CLIP-seq
MIRT1166492	hsa-miR-665	CLIP-seq
MIRT2575671	hsa-miR-670	CLIP-seq
MIRT2575672	hsa-miR-938	CLIP-seq
MIRT2276905	hsa-miR-1207-5p	CLIP-seq
MIRT2575642	hsa-miR-1236	CLIP-seq
MIRT2575643	hsa-miR-125a-5p	CLIP-seq
MIRT2575644	hsa-miR-125b	CLIP-seq
MIRT2048090	hsa-miR-1827	CLIP-seq
MIRT2276906	hsa-miR-1909	CLIP-seq
MIRT2276907	hsa-miR-2115	CLIP-seq
MIRT2575645	hsa-miR-2277-3p	CLIP-seq
MIRT2685540	hsa-miR-3065-3p	CLIP-seq
MIRT2575646	hsa-miR-3148	CLIP-seq
MIRT2575647	hsa-miR-3185	CLIP-seq
MIRT2575648	hsa-miR-320a	CLIP-seq
MIRT2575649	hsa-miR-320b	CLIP-seq
MIRT2575650	hsa-miR-320c	CLIP-seq
MIRT2575651	hsa-miR-320d	CLIP-seq
MIRT2276909	hsa-miR-342-5p	CLIP-seq
MIRT2048091	hsa-miR-3612	CLIP-seq
MIRT2685541	hsa-miR-3613-5p	CLIP-seq
MIRT2276910	hsa-miR-3665	CLIP-seq
MIRT2575652	hsa-miR-3689d	CLIP-seq
MIRT2685542	hsa-miR-3910	CLIP-seq
MIRT2575653	hsa-miR-3915	CLIP-seq
MIRT2575654	hsa-miR-3928	CLIP-seq
MIRT2575655	hsa-miR-4253	CLIP-seq
MIRT1166477	hsa-miR-4268	CLIP-seq
MIRT2575656	hsa-miR-4284	CLIP-seq
MIRT2575657	hsa-miR-4319	CLIP-seq
MIRT2575658	hsa-miR-4429	CLIP-seq
MIRT2276913	hsa-miR-4436b-3p	CLIP-seq
MIRT1166480	hsa-miR-4448	CLIP-seq
MIRT1166481	hsa-miR-4459	CLIP-seq
MIRT2685543	hsa-miR-4508	CLIP-seq
MIRT2575659	hsa-miR-452	CLIP-seq
MIRT2575660	hsa-miR-4532	CLIP-seq
MIRT2575661	hsa-miR-4640-3p	CLIP-seq
MIRT2276914	hsa-miR-4664-5p	CLIP-seq
MIRT2575662	hsa-miR-4668-3p	CLIP-seq
MIRT2575663	hsa-miR-4676-3p	CLIP-seq
MIRT1166484	hsa-miR-4691-5p	CLIP-seq
MIRT1166485	hsa-miR-4695-5p	CLIP-seq
MIRT2575664	hsa-miR-4732-3p	CLIP-seq
MIRT2276919	hsa-miR-4736	CLIP-seq
MIRT2276920	hsa-miR-4763-3p	CLIP-seq
MIRT1166488	hsa-miR-4763-5p	CLIP-seq
MIRT2575665	hsa-miR-486-3p	CLIP-seq
MIRT2276924	hsa-miR-516a-3p	CLIP-seq
MIRT2575666	hsa-miR-542-3p	CLIP-seq
MIRT2575667	hsa-miR-548c-3p	CLIP-seq
MIRT2575668	hsa-miR-548u	CLIP-seq
MIRT2575669	hsa-miR-577	CLIP-seq
MIRT2575670	hsa-miR-605	CLIP-seq
MIRT2048102	hsa-miR-650	CLIP-seq
MIRT1166492	hsa-miR-665	CLIP-seq
MIRT2575671	hsa-miR-670	CLIP-seq
MIRT2575672	hsa-miR-938	CLIP-seq

55 Show/Hide all (55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IDA	21597459
GO:0000266	Process	Mitochondrial fission	IMP	18207745
GO:0002039	Function	P53 binding	IPI	21597459
GO:0004842	Function	Ubiquitin-protein transferase activity	IBA
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 18591963, 19060904, 19407830, 23399697, 25416956, 32296183, 33961781
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	21597459
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	IMP	24898855
GO:0005741	Component	Mitochondrial outer membrane	IDA	18207745, 18213395
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005777	Component	Peroxisome	IDA	18207745
GO:0005777	Component	Peroxisome	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009893	Process	Positive regulation of metabolic process	IEA
GO:0010637	Process	Negative regulation of mitochondrial fusion	IDA	19407830
GO:0010821	Process	Regulation of mitochondrion organization	IMP	24898855
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IDA	18213395
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016925	Process	Protein sumoylation	IEA
GO:0019789	Function	SUMO transferase activity	IDA	19407830
GO:0022603	Process	Regulation of anatomical structure morphogenesis	IEA
GO:0030424	Component	Axon	IMP	24898855
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	19407830
GO:0031647	Process	Regulation of protein stability	IEA
GO:0031648	Process	Protein destabilization	IMP	24898855
GO:0033235	Process	Positive regulation of protein sumoylation	IDA	19407830
GO:0042802	Function	Identical protein binding	IPI	18591963
GO:0043025	Component	Neuronal cell body	IMP	24898855
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	HMP	12761501
GO:0045824	Process	Negative regulation of innate immune response	IMP	23399697
GO:0046872	Function	Metal ion binding	IEA
GO:0050689	Process	Negative regulation of defense response to virus by host	IMP	23399697
GO:0050821	Process	Protein stabilization	IMP	19407830
GO:0051094	Process	Positive regulation of developmental process	IEA
GO:0051646	Process	Mitochondrion localization	IMP	18213395
GO:0051881	Process	Regulation of mitochondrial membrane potential	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	22410793
GO:0060339	Process	Negative regulation of type I interferon-mediated signaling pathway	IMP	23399697
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	18213395, 18591963, 21597459
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0071360	Process	Cellular response to exogenous dsRNA	IDA	23399697
GO:0071650	Process	Negative regulation of chemokine (C-C motif) ligand 5 production	IMP	23399697
GO:0090141	Process	Positive regulation of mitochondrial fission	IDA	19407830
GO:1901028	Process	Regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IDA	18591963
GO:1903861	Process	Positive regulation of dendrite extension	IEA
GO:1905091	Process	Positive regulation of type 2 mitophagy	IEA

MIM	HGNC	e!Ensembl
612037	25762	ENSG00000090432

Q969V5

Protein name

Mitochondrial ubiquitin ligase activator of NFKB 1 (EC 2.3.2.27) (E3 SUMO-protein ligase MUL1) (E3 ubiquitin-protein ligase MUL1) (Growth inhibition and death E3 ligase) (Mitochondrial-anchored protein ligase) (Protein Hades) (Putative NF-kappa-B-activati

Protein function

Exhibits weak E3 ubiquitin-protein ligase activity (PubMed:18591963, PubMed:19407830, PubMed:22410793). E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiqu

PDB

6K2K , 6M2C , 6M2D

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12483	GIDE	95 → 256	E3 Ubiquitin ligase	Family
PF13920	zf-C3HC4_3	298 → 346		Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest levels in the heart, skeletal muscle, placenta, kidney and liver. Barely detectable in colon and thymus. {ECO:0000269|PubMed:18213395, ECO:0000269|PubMed:18591963}.

Sequence

MESGGRPSLCQFILLGTTSVVTAALYSVYRQKARVSQELKGAKKVHLGEDLKSILSEAPG
KCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQR
TNTVPFDLVPHEDGVDVAVRVLKPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPK
GIQETEEMLKVGATLTGVGELVLDNNSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVRLW
KVLALVFGFATCATLFFILRKQYLQRQERLRLKQMQEEFQEHEAQLLSRAKPEDRESLKS
ACVVCLSSFKSCVFLECGHVCSCTECYRALPEPKKCPICRQAITRVIPLYNS

Sequence length

352

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Mitophagy - animal	Ub-specific processing proteases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Lymphoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (191)
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	17924349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	25274033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29945960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	28414305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	30884828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	22751121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	37243816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman Syndrome	BEFREE	15263005, 23447592, 23626758, 24292889, 27232889, 30082419, 30674673, 31087000, 31160454, 31625566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	21987572, 37604355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	12975321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	31234693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30787400, 31160454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	23626758, 24292889, 26368817, 27232889, 28559284, 30082419, 31455858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	18565657, 20170897, 29109121, 30275535, 30288100, 31311822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	20170897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	20208059, 22754359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bardet-Biedl Syndrome	Bardet-Biedl Syndrome	BEFREE	16606853		★★★★★ ★☆☆☆☆ Found in Text Mining only
BARDET-BIEDL SYNDROME 11	Bardet-Biedl Syndrome	BEFREE	16606853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	29728705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27922670, 31819015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16288031, 17804730, 21272160, 23559371, 24027428, 24870930, 26148235, 26621835, 28334634, 28423498, 28423597, 28964893, 30383767, 30689267, 31392083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22629406, 35551175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Canavan Disease	Canavan disease	Pubtator	23756845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18630515, 26276352, 28714370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22935614, 33833131, 35710093, 36419136	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27922670, 31819015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21795997, 27888625, 28232384, 29271375, 29581762, 30528265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31489722	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	26437300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25114896, 29794480, 30718461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	24500646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	27693578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Gordon Holmes syndrome	BEFREE	30733708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	25169519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	15776429, 23519028, 28335037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28184929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26621835, 26717976, 30510140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chuvash erythrocytosis	Chuvash Erythrocytosis	BEFREE	16687917, 21685897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	18481984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleidocranial Dysplasia	Cleidocranial Dysplasia	BEFREE	28581440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24398687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15292388, 21108931, 21998011, 24867101, 27184401, 27399335, 27417709, 29515254, 29932918, 30806153, 31140864, 31175139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21108931, 24324066, 24867101, 37031206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital central hypoventilation	Congenital Central Hypoventilation	BEFREE	22307522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15735686, 18095884, 18481984, 21652636, 24656772, 29079709, 30026228, 31489722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Sporadic	Creutzfeldt-Jakob disease	BEFREE	21335971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27480933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	34946922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	27805921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	18583931, 28926063, 31570815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18583931, 28926063, 31570815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31570815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30877201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	25058385, 29461588, 31776466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36481790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	27742702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic ataxia type 2 (disorder)	Episodic Ataxia	BEFREE	28167673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29213217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	16474167, 16784902, 18047734, 21109493, 22653977, 23783032, 24451376, 26119737, 26883629, 30622320, 31666700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	23783032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	16474167, 16784902, 18047734, 21109493, 22653977, 23783032, 24451376, 26119737, 26883629, 30622320		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP D2	Fanconi Anemia	BEFREE	21775430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29100790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	37243816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	21098288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	25395181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26856755, 28337377, 30528352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35848447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26856755, 28337377, 28481871, 30528352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33069830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
GLOMUVENOUS MALFORMATIONS	Glomuvenous Malformation	BEFREE	22405651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	24596130, 26450902, 28279658, 29260979, 29299162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	36322817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	26343497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	26343497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	30733708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31837334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	30559180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26818663, 30232010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	18252223, 24303071, 29728705, 29742418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	29118367, 36731745, 38199845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31430457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	20008299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	29167336, 31801865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	18583931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	15930137, 19036738, 21798009, 23131811, 25680286, 30336494, 31758957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left ventricular noncompaction cardiomyopathy	Cardiomyopathy	BEFREE	23314057		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	26517351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20622007, 29209041, 29296815, 29459712, 31684170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	19074904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	20085810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liddle Syndrome	Liddle Syndrome	BEFREE	18691017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21356256, 28754688, 28862485, 31558697, 31802035, 31819032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	24636985, 29916549, 30365055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	29450633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21795997, 28232384, 36042481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	26673963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	38277122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	17509076, 24583314, 24697523, 26142735, 28798332, 29876933		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	Pubtator	26711259	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	25140833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	27888625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	24596130, 26450902, 28279658, 29260979, 29299162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	23407552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16288031, 17804730, 21272160, 23559371, 24027428, 24870930, 26148235, 26621835, 28334634, 28423498, 28423597, 28964893, 30383767, 30642351, 30689267, 31392083 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	30380024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	14757845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	19430492, 26662306, 26847831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21795997, 27888625, 28232384, 29271375, 29581762, 30528265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25114896, 29794480, 30563893, 30718461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23288781, 24722501, 25016295, 25348515, 26621835, 28423617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17016436, 20587519, 20832018, 21514447, 24508459, 25204806, 25759396, 25883222, 27070713, 28805822, 29202479, 29262542, 29463595, 30479348, 30952903, 30955223, 31472148, 31559706 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25769451, 28400336, 28521418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	24138990, 29299162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	27227488, 27709798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27922670, 31819015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12507560, 19214989, 19901108, 20103673, 20126411, 20197382, 20418918, 20619386, 21212733, 21383157, 22158988, 22745583, 23071779, 23142381, 23470638 View all (31 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24398687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16288031, 18819927, 24027428, 28964893, 30689267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	23407552		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26717892, 27791197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	23348505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	18252223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	BEFREE	22763239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	24170694, 30323259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30143610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29715200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	34946922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mulibrey Nanism	Mulibrey Nanism	BEFREE	15885686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27142104, 30975979, 31157769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophies, Limb-Girdle	Limb-Girdle Muscular Dystrophy	BEFREE	30884854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	24500717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myoclonic Epilepsies, Progressive	Myoclonic epilepsy	BEFREE	21798009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30573520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14657501, 15611064, 16407835, 16925945, 17694067, 18307535, 18481984, 18630515, 19509229, 19625121, 20103673, 20197382, 20332316, 20619386, 20628057 View all (42 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29491882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	23318455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21694720, 27975203, 30336494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	29118367, 30082419, 31087000, 31160454, 31625566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20126411, 20889565, 26482610, 26732495, 26942878, 28074012, 28232384, 28835699, 29355657, 29541383, 29786107, 30515972, 31571161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan Syndrome	BEFREE	20619386, 25952305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	BEFREE	28167673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25526310, 30365055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	21542805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Opitz-G syndrome, type 2	Opitz GBBB syndrome	BEFREE	29450633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	27837193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24686088		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25114896, 29794480, 30718461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15735017, 23288781, 24722501, 25348515, 26621835, 28423617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33793053, 38304253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	24138990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	17131388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	12000718, 15105460, 16049031, 16752048, 16840513, 18020977, 19214989, 19610108, 19800834, 20085810, 20187256, 20508036, 21209200, 21296869, 21355049 View all (41 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	21921694, 23393160, 32156628, 34946922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	BEFREE	12634850, 15503153, 20696900, 22527713, 22562816, 23770917, 24297497, 25877876, 26161729, 28254618, 29160309, 29349575, 29995846, 31753025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	20221696, 25877876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson disease	Pubtator	21921694, 26260794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonism, Juvenile	Parkinsonian disease	BEFREE	23470638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	27694961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	31160454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Popliteal pterygium syndrome	Popliteal Pterygium Syndrome	BEFREE	27936908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	29849118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	29849118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30116272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive hearing loss stapes fixation	Hearing loss with stapes fixation	Pubtator	36731745	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17016436, 20587519, 20832018, 21514447, 25204806, 25759396, 25883222, 27070713, 28805822, 29262542, 29463595, 30479348, 30952903, 30955223, 31472148, 31559706 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohypoaldosteronism, Type II	Pseudohypoaldosteronism	BEFREE	23962426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	20054338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	12032852, 14757845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12032852, 15735686, 18481984, 21652636, 31489722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	20832018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15759013, 16802346, 19116932, 29039504, 29916549, 30306455, 30365055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Saethre-Chotzen Syndrome	Saethre-Chotzen Syndrome	BEFREE	17003487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	21126200, 30465941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	28148787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24596130, 27244893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25769451, 28400336, 28521418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37147733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Syndactyly of the toes	Syndactyly Of The Toes	BEFREE	27694961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	24138990, 29299162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	24138990, 29299162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	18172692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29662198, 30517763, 31845129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35802537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	26083618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35731212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35194034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	14757845, 16261165, 16407835, 16925945, 17936701, 17967880, 18481984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams Syndrome	BEFREE	18398435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	18630515, 20332316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Young onset Parkinson disease	Parkinson disease	BEFREE	15603737, 16837855, 19946270, 24878071, 30242232, 30994895		★★★★★ ★☆☆☆☆ Found in Text Mining only

MUL1 (mitochondrial E3 ubiquitin protein ligase 1)

Bookmark This Gene