UGT2A3 (UDP glucuronosyltransferase family 2 member A3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 79799
Gene name UDP glucuronosyltransferase family 2 member A3
Gene symbol UGT2A3
Synonyms (NCBI Gene)
-
Chromosome 4
Chromosome location 4q13.2
miRNA miRNA information provided by mirtarbase database.
17 Show/Hide all (17)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1473615 hsa-miR-3074-3p CLIP-seq
MIRT1473616 hsa-miR-3178 CLIP-seq
MIRT1473617 hsa-miR-365 CLIP-seq
MIRT1473618 hsa-miR-4263 CLIP-seq
MIRT1473619 hsa-miR-4659a-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0006805 Process Xenobiotic metabolic process IDA 19858781
GO:0008194 Function UDP-glycosyltransferase activity IEA
GO:0015020 Function Glucuronosyltransferase activity IBA
GO:0015020 Function Glucuronosyltransferase activity IDA 19858781
GO:0015020 Function Glucuronosyltransferase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
616382 28528 ENSG00000135220
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UWM9
Protein name UDP-glucuronosyltransferase 2A3 (UDPGT 2A3) (EC 2.4.1.17)
Protein function UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00201 UDPGT 24 → 525 UDP-glucoronosyl and UDP-glucosyl transferase Family
Sequence 
MRSDKSALVFLLLQLFCVGCGFCGKVLVWPCDMSHWLNVKVILEELIVRGHEVTVLTHSK
PSLIDYRKPSALKFEVVHMPQDRTEENEIFVDLALNVLPGLSTWQSVIKLNDFFVEIRGT
LKMMCESFIYNQTLMKKLQETNYDVMLIDPVIPCGDLMAELLAVPFVLTLRISVGGNMER
SCGKLPAPLSYVPVPMTGLTDRMTFLERVKNSMLSVLFHFWIQDYDYHFWEEFYSKALGR
PTTLCETVGKAEIWLIRTYWDFEFPQPYQPNFEFVGGLHCKPAKALPKEMENFVQSSGED
GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTRLYDWIPQNDL
LGHPKTKAFITHGGMNGIYEAIYHGVPMVGVPIFGDQLDNIAHMKAKGAAVEINFKTMTS
EDLLRALRTVITDSSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRSAAHD
LTWFQHYSIDVIGFLLACVATAIFLFTKCFLFSCQKFNKTRKIEKRE
Sequence length 527
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Pentose and glucuronate interconversions Glucuronidation
Ascorbate and aldarate metabolism  
Steroid hormone biosynthesis  
Retinol metabolism  
Porphyrin metabolism  
Metabolism of xenobiotics by cytochrome P450  
Drug metabolism - cytochrome P450  
Drug metabolism - other enzymes  
Metabolic pathways  
Biosynthesis of cofactors  
Bile secretion  
Chemical carcinogenesis - DNA adducts  
Chemical carcinogenesis - receptor activation  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
AUTISM SPECTRUM DISORDER — CTD 35663546
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS — Disgenet —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Colorectal Neoplasms Colorectal neoplasm Pubtator 28745433, 36855796 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
UGT2B11 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism. UGT2A1 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism. UGT2B28 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism. UGT1A10 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism. UGT1A8 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism.
Central nervous system cancer Linked via 2 of 5 related genesUGT2B11, UGT2B28 Glioblastoma Linked via 2 of 5 related genesUGT2B11, UGT2B28 Glioma Linked via 2 of 5 related genesUGT2B11, UGT2B28 Attention deficit hyperactivity disorder Linked via 2 of 5 related genesUGT1A10, UGT1A8 Bilirubin metabolism disease Linked via 2 of 5 related genesUGT1A10, UGT1A8