UGT2A1 (UDP glucuronosyltransferase family 2 member A1 complex locus)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 10941
• Gene name: UDP glucuronosyltransferase family 2 member A1 complex locus
• Gene symbol: UGT2A1
• Synonyms (NCBI Gene): UDPGT2A1
• Chromosome: 4
• Chromosome location: 4q13.3
• Summary: The protein encoded by this gene belongs to the UDP-glycosyltransferase family, members of which catalyze biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. Th

miRNA Show/Hide all (47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030180	hsa-miR-26b-5p	Microarray	19088304
MIRT526326	hsa-miR-548u	PAR-CLIP	22012620
MIRT526324	hsa-miR-7161-5p	PAR-CLIP	22012620
MIRT526325	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT526323	hsa-miR-141-5p	PAR-CLIP	22012620
MIRT526321	hsa-miR-4762-5p	PAR-CLIP	22012620
MIRT526322	hsa-miR-4645-3p	PAR-CLIP	22012620
MIRT526320	hsa-miR-4477a	PAR-CLIP	22012620
MIRT526319	hsa-miR-6509-3p	PAR-CLIP	22012620
MIRT526318	hsa-miR-4436b-5p	PAR-CLIP	22012620
MIRT526326	hsa-miR-548u	PAR-CLIP	22012620
MIRT526324	hsa-miR-7161-5p	PAR-CLIP	22012620
MIRT526325	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT526323	hsa-miR-141-5p	PAR-CLIP	22012620
MIRT526321	hsa-miR-4762-5p	PAR-CLIP	22012620
MIRT526322	hsa-miR-4645-3p	PAR-CLIP	22012620
MIRT526320	hsa-miR-4477a	PAR-CLIP	22012620
MIRT526319	hsa-miR-6509-3p	PAR-CLIP	22012620
MIRT526318	hsa-miR-4436b-5p	PAR-CLIP	22012620
MIRT1473581	hsa-miR-125a-5p	CLIP-seq
MIRT1473582	hsa-miR-125b	CLIP-seq
MIRT1473583	hsa-miR-185	CLIP-seq
MIRT1473584	hsa-miR-214	CLIP-seq
MIRT1473585	hsa-miR-3619-5p	CLIP-seq
MIRT1473586	hsa-miR-410	CLIP-seq
MIRT1473587	hsa-miR-421	CLIP-seq
MIRT1473588	hsa-miR-4270	CLIP-seq
MIRT1473589	hsa-miR-4291	CLIP-seq
MIRT1473590	hsa-miR-4306	CLIP-seq
MIRT1473591	hsa-miR-4319	CLIP-seq
MIRT1473592	hsa-miR-4441	CLIP-seq
MIRT1473593	hsa-miR-4644	CLIP-seq
MIRT1473594	hsa-miR-4732-3p	CLIP-seq
MIRT1473595	hsa-miR-670	CLIP-seq
MIRT1473596	hsa-miR-761	CLIP-seq
MIRT1473597	hsa-miR-922	CLIP-seq
MIRT1473589	hsa-miR-4291	CLIP-seq
MIRT2462848	hsa-miR-3121-3p	CLIP-seq
MIRT2462849	hsa-miR-3123	CLIP-seq
MIRT2462850	hsa-miR-3647-3p	CLIP-seq
MIRT2462851	hsa-miR-3925-5p	CLIP-seq
MIRT2462852	hsa-miR-3927	CLIP-seq
MIRT2462853	hsa-miR-3978	CLIP-seq
MIRT2462854	hsa-miR-4261	CLIP-seq
MIRT2462855	hsa-miR-4282	CLIP-seq
MIRT2462856	hsa-miR-4451	CLIP-seq
MIRT2462857	hsa-miR-539	CLIP-seq

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	19858781
GO:0007606	Process	Sensory perception of chemical stimulus	IDA	10359671
GO:0007608	Process	Sensory perception of smell	IEA
GO:0008194	Function	UDP-glycosyltransferase activity	IEA
GO:0008206	Process	Bile acid metabolic process	IDA	23756265
GO:0009608	Process	Response to symbiont	IDA	19858781
GO:0015020	Function	Glucuronosyltransferase activity	IBA
GO:0015020	Function	Glucuronosyltransferase activity	IDA	10359671, 19858781, 23756265
GO:0015020	Function	Glucuronosyltransferase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA

Other IDs

• MIM: 604716
• HGNC: 12542
• e!Ensembl: ENSG00000173610

Protein

• UniProt ID: P0DTE4
• Protein name: UDP-glucuronosyltransferase 2A1 (UDPGT 2A1) (UGT2A1) (EC 2.4.1.17)
• Protein function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either th
• Tissue specificity: TISSUE SPECIFICITY: Olfactory epithelium, brain and fetal lung (PubMed:10359671). Not present in liver (PubMed:10359671). {ECO:0000269|PubMed:10359671}.
• Sequence:

  MLNNLLLFSLQISLIGTTLGGNVLIWPMEGSHWLNVKIIIDELIKKEHNVTVLVASGALF
  ITPTSNPSLTFEIYRVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHM
  VSQEICDGVLKNQQLMAKLKKSKFEVLVSDPVFPCGDIVALKLGIPFMYSLRFSPASTVE
  KHCGKVPYPPSYVPAVLSELTDQMSFTDRIRNFISYHLQDYMFETLWKSWDSYYSKALGR
  PTTLCETMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFIQSSGKN
  GVVVFSLGSMVKNLTEEKANLIASALAQIPQKVLWRYKGKKPATLGNNTQLFDWIPQNDL
  LGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNLNTMTS
  VDLLSALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHD
  LTWFQYHSLDVIGFLLVCVTTAIFLVIQCCLFSCQKFGKIGKKKKRE

• Sequence length: 527

Pathways

KEGG Pathway	Reactome Pathway
Pentose and glucuronate interconversions	Glucuronidation
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Retinol metabolism
Porphyrin metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Biosynthesis of cofactors
Bile secretion
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (6)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	35663546	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	31001917	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	31001917	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	36447229	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	34594039, 37544299, 40050615	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (6)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	29635252		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35286894	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31001917	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31001917		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31001917		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21164388		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

UGT2A2 1 shared diseaseOvarian epithelial cancer 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more 1 shared evidence sourceGWAS catalog (Ovarian epithelial cancer) Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism — evidence mostly GWAS catalog. UGT2B4 1 shared diseaseOvarian epithelial cancer 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more 1 shared evidence sourceGWAS catalog (Ovarian epithelial cancer) Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism — evidence mostly GWAS catalog. UGT2B11 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism. UGT2B28 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism. UGT1A10 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
UGT2A2	1	["Ovarian epithelial cancer"]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	1	["GWAS catalog (Ovarian epithelial cancer)"]
UGT2B4	1	["Ovarian epithelial cancer"]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	1	["GWAS catalog (Ovarian epithelial cancer)"]
UGT2B11	0	[]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	0	[]
UGT2B28	0	[]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	0	[]
UGT1A10	0	[]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	0	[]

Diseases Linked via Similar Genes

Central nervous system cancer Linked via 2 of 5 related genesUGT2B11, UGT2B28 Glioblastoma Linked via 2 of 5 related genesUGT2B11, UGT2B28 Glioma Linked via 2 of 5 related genesUGT2B11, UGT2B28 Color vision deficiency Linked via 1 of 5 related genesUGT2B4 Diverticular disease Linked via 1 of 5 related genesUGT2B11

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Central nervous system cancer	2	["UGT2B11","UGT2B28"]
Glioblastoma	2	["UGT2B11","UGT2B28"]
Glioma	2	["UGT2B11","UGT2B28"]
Color vision deficiency	1	["UGT2B4"]
Diverticular disease	1	["UGT2B11"]