UGT1A10 (UDP glucuronosyltransferase family 1 member A10)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 54575
• Gene name: UDP glucuronosyltransferase family 1 member A10
• Gene symbol: UGT1A10
• Synonyms (NCBI Gene): GNT1, UDPGT, UGT-1A, UGT-1J, UGT1, UGT1-01, UGT1-10, UGT1.1, UGT1.10, UGT1A, UGT1A1, UGT1J, hUG-BR1
• Chromosome: 2
• Chromosome location: 2q37.1
• Summary: This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a comp

miRNA Show/Hide all (34)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022953	hsa-miR-124-3p	Microarray	18668037
MIRT1473293	hsa-miR-1202	CLIP-seq
MIRT1473294	hsa-miR-136	CLIP-seq
MIRT1473295	hsa-miR-3120-5p	CLIP-seq
MIRT1473296	hsa-miR-3130-3p	CLIP-seq
MIRT1473297	hsa-miR-3194-5p	CLIP-seq
MIRT1473298	hsa-miR-346	CLIP-seq
MIRT1473299	hsa-miR-3909	CLIP-seq
MIRT1473300	hsa-miR-3940-5p	CLIP-seq
MIRT1473301	hsa-miR-3972	CLIP-seq
MIRT1473302	hsa-miR-4288	CLIP-seq
MIRT1473303	hsa-miR-4421	CLIP-seq
MIRT1473304	hsa-miR-4507	CLIP-seq
MIRT1473305	hsa-miR-4766-5p	CLIP-seq
MIRT1473306	hsa-miR-4793-3p	CLIP-seq
MIRT1473307	hsa-miR-489	CLIP-seq
MIRT1473308	hsa-miR-514	CLIP-seq
MIRT1473309	hsa-miR-514b-3p	CLIP-seq
MIRT1473310	hsa-miR-548a-5p	CLIP-seq
MIRT1473311	hsa-miR-548ab	CLIP-seq
MIRT1473312	hsa-miR-548ak	CLIP-seq
MIRT1473313	hsa-miR-548b-5p	CLIP-seq
MIRT1473314	hsa-miR-548c-5p	CLIP-seq
MIRT1473315	hsa-miR-548d-5p	CLIP-seq
MIRT1473316	hsa-miR-548h	CLIP-seq
MIRT1473317	hsa-miR-548i	CLIP-seq
MIRT1473318	hsa-miR-548j	CLIP-seq
MIRT1473319	hsa-miR-548n	CLIP-seq
MIRT1473320	hsa-miR-548w	CLIP-seq
MIRT1473321	hsa-miR-548y	CLIP-seq
MIRT1473322	hsa-miR-559	CLIP-seq
MIRT1473323	hsa-miR-629	CLIP-seq
MIRT1473324	hsa-miR-632	CLIP-seq
MIRT2142599	hsa-miR-579	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CDX2	Activation	15044625
HNF1A	Activation	15044625

Gene ontology (GO) Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001889	Process	Liver development	IBA
GO:0001972	Function	Retinoic acid binding	IDA	20308471
GO:0004857	Function	Enzyme inhibitor activity	ISS	20610558
GO:0005080	Function	Protein kinase C binding	IPI	18556656
GO:0005515	Function	Protein binding	IPI	18556656
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	17179145, 18556656
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	NAS	20610558
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IKR	20610558
GO:0005789	Component	Endoplasmic reticulum membrane	NAS	20610558
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	20056724
GO:0006805	Process	Xenobiotic metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IKR	20610558
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0008194	Function	UDP-glycosyltransferase activity	IEA
GO:0009407	Process	Toxin catabolic process	IDA	18556656
GO:0015020	Function	Glucuronosyltransferase activity	IDA	15231852, 18052087, 20056724, 21422672
GO:0015020	Function	Glucuronosyltransferase activity	IEA
GO:0015020	Function	Glucuronosyltransferase activity	IKR	20610558
GO:0015020	Function	Glucuronosyltransferase activity	ISS	20610558
GO:0015020	Function	Glucuronosyltransferase activity	TAS
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0019899	Function	Enzyme binding	IBA
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	17179145, 20610558
GO:0042178	Process	Xenobiotic catabolic process	IDA	18556656
GO:0042803	Function	Protein homodimerization activity	IDA	17179145
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0045922	Process	Negative regulation of fatty acid metabolic process	ISS	20610558
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	20610558
GO:0051552	Process	Flavone metabolic process	IDA	18052087

Other IDs

• MIM: 606435
• HGNC: 12531
• e!Ensembl: ENSG00000242515

Protein

• UniProt ID: Q9HAW8
• Protein name: UDP-glucuronosyltransferase 1A10 (UGT1A10) (EC 2.4.1.17) (UDP-glucuronosyltransferase 1-10) (UDPGT 1-10) (UGT1*10) (UGT1-10) (UGT1.10) (UDP-glucuronosyltransferase 1-J) (UGT-1J) (UGT1J)
• Protein function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion i
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00201	UDPGT	26 → 521	UDP-glucoronosyl and UDP-glucosyl transferase	Family

• Tissue specificity: TISSUE SPECIFICITY: Liver and colon (PubMed:9271343). Isoform 1 and isoform 2 are expressed in colon, esophagus and small intestine; isoform 2 but not isoform 1 is expressed in liver or kidney (PubMed:18004212). {ECO:0000269|PubMed:18004212, ECO:0000269|P
• Sequence:

  MARAGWTSPVPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMP
  EVSWQLERSLNCTVKTYSTSYTLEDQNREFMVFAHAQWKAQAQSIFSLLMSSSSGFLDLF
  FSHCRSLFNDRKLVEYLKESSFDAVFLDPFDTCGLIVAKYFSLPSVVFTRGIFCHHLEEG
  AQCPAPLSYVPNDLLGFSDAMTFKERVWNHIVHLEDHLFCQYLFRNALEIASEILQTPVT
  AYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV
  VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
  PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
  ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
  YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH

• Sequence length: 530

Pathways

KEGG Pathway	Reactome Pathway
Pentose and glucuronate interconversions	Glucuronidation
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Retinol metabolism
Porphyrin metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Biosynthesis of cofactors
Bile secretion
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (18)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	20732626	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	35663546	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIRUBIN METABOLISM DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	22558097, 30504769, 34594039, 34651315, 37965154, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRIGLER NAJJAR SYNDROME, TYPE 1	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRIGLER NAJJAR SYNDROME, TYPE 2	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRIGLER-NAJJAR SYNDROME	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	31605138	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	30504769, 34651315	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GILBERT DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	34343768	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	27770636	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUCEY-DRISCOLL SYNDROME	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	GWAS catalog	31605138	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERINATAL DISEASE	—	GWAS catalog	40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CARCINOMA	—	GWAS catalog	20972438, 24163127	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (66)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
alpha-Thalassemia	alpha Thalassemia	BEFREE	27557546		★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	27557546		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	12850481, 18392554		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	GWASCAT_DG	22558097		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	24057187		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	18081723, 19021734, 9375768		★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	18081723, 9375768		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18374377		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18374377	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34886806	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	27690298		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	GWASCAT_DG	20972438, 24163127		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10024527	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	9230212		★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	11425418, 11843828, 14555305, 21319362		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	11425418, 11843828, 14555305, 16237771, 18081723, 19021734, 21319362, 24204915		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholelithiasis	Cholelithiasis	GWASDB_DG	22558097		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholelithiasis	Cholelithiasis	GWASCAT_DG	22558097		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis	Cholestasis	BEFREE	29867509		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20965940, 21310730, 24822274, 26710796		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24822274, 31740522	Associate	★☆☆☆☆ Found in Text Mining only
Crigler Najjar syndrome, type 1	Crigler-Najjar syndrome	BEFREE	11013440, 12378576, 18180294, 19845429, 23403257, 7614251, 7906695, 7989045, 9039987, 9156798, 9435989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crigler Najjar syndrome, type 1	Crigler-Najjar syndrome	CLINVAR_DG	11182932, 15712364, 26697581		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crigler Najjar syndrome, type 2	Crigler-Najjar syndrome	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deficiency of glucose-6-phosphate dehydrogenase	Deficiency Of Glucose-6-Phosphate Dehydrogenase	BEFREE	10541948, 27557546		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	26628212		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	21317830		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	10024527	Associate	★☆☆☆☆ Found in Text Mining only
Gastroschisis	Gastroschisis	Pubtator	31075877	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	30822514		★☆☆☆☆ Found in Text Mining only
Generalized glycogen storage disease of infants	Glycogen Storage Disease	BEFREE	28363873		★☆☆☆☆ Found in Text Mining only
Gilbert Disease (disorder)	Gilbert Disease	BEFREE	10541948, 10583252, 11843828, 11915038, 12012638, 12068798, 14663278, 15858133, 17496722, 19021734, 19845429, 19932091, 20177420, 20194756, 21309756, 21319362, 22160004, 22398043, 24785582, 26781906, 31017737, 8596320, 9375768		★☆☆☆☆ Found in Text Mining only
Gilbert Disease (disorder)	Gilbert Disease	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	28363873		★☆☆☆☆ Found in Text Mining only
Hereditary spherocytosis	Hereditary Spherocytosis	BEFREE	14663278, 21319362		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	10541948, 15319464, 16609363, 18043502, 20194756, 20504240, 20890421, 21309756, 21592495, 21983082, 21993917, 23130636, 23609856, 24204915, 24785582, 26480925, 26859599, 9156798, 9748558		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia, Neonatal	Hyperbilirubinemia	BEFREE	10541948, 21983082, 24104695, 26342858, 28025333, 28340583		★☆☆☆☆ Found in Text Mining only
Kernicterus	Kernicterus	BEFREE	28167773		★☆☆☆☆ Found in Text Mining only
LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	BEFREE	27301951		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	15007088, 20653675, 25778466, 26352872, 26710796		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27301951		★☆☆☆☆ Found in Text Mining only
Lucey-Driscoll syndrome (disorder)	Lucey-Driscoll syndrome	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15517893		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20308029, 25452636		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23303296		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	GWASDB_DG	20972438, 24163127		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11170257, 24822274, 30307765, 30724669		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	18180294		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	GWASCAT_DG	30621171		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	23609856		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15318931		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	15007088, 20653675, 25778466, 26352872, 26710796		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28098838		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	GWASCAT_DG	25246029		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34660806	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20308029, 25452636		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21993917		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	20096102, 25778466, 28474802		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	27301951		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10024527		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23303296		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	25712374		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25712374	Stimulate	★☆☆☆☆ Found in Text Mining only
Thalassemia Intermedia	Thalassemia	BEFREE	12850481		★☆☆☆☆ Found in Text Mining only
Unconjugated hyperbilirubinemia	Hyperbilirubinemia	BEFREE	12439228, 15864125, 15965581, 18781851, 26781906, 9435989		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	17549067		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

UGT1A8 10 shared diseasesBilirubin metabolism disease, Cholecystolithiasis, Crigler-najjar syndrome, Gallstones, Gilbert syndrome, Liver disease, Lucey-driscoll syndrome, Urinary bladder cancer, Neuroblastoma, Perinatal disease 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more 12 shared evidence sourcesGWAS catalog (Bilirubin metabolism disease), GWAS catalog (Cholecystolithiasis), Disgenet (Crigler-najjar syndrome), GWAS catalog (Melanoma), GWAS catalog (Gallstones), Disgenet (Gilbert syndrome), GWAS catalog (Liver disease), Disgenet (Lucey-driscoll syndrome), GWAS catalog (Neuroblastoma), GWAS catalog (Nonalcoholic fatty liver disease), GWAS catalog (Perinatal disease), GWAS catalog (Urinary bladder cancer) Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism — evidence mostly GWAS catalog. UGT1A7 9 shared diseasesBilirubin metabolism disease, Cholecystolithiasis, Crigler-najjar syndrome, Gallstones, Gilbert syndrome, Liver disease, Lucey-driscoll syndrome, Neuroblastoma, Perinatal disease 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more 11 shared evidence sourcesGWAS catalog (Bilirubin metabolism disease), GWAS catalog (Cholecystolithiasis), Disgenet (Crigler-najjar syndrome), GWAS catalog (Melanoma), GWAS catalog (Gallstones), Disgenet (Gilbert syndrome), GWAS catalog (Liver disease), Disgenet (Lucey-driscoll syndrome), GWAS catalog (Neuroblastoma), GWAS catalog (Nonalcoholic fatty liver disease), GWAS catalog (Perinatal disease) Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism — evidence mostly GWAS catalog. UGT1A9 9 shared diseasesBilirubin metabolism disease, Cholecystolithiasis, Crigler-najjar syndrome, Gallstones, Gilbert syndrome, Liver disease, Lucey-driscoll syndrome, Neuroblastoma, Perinatal disease 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more 11 shared evidence sourcesGWAS catalog (Bilirubin metabolism disease), GWAS catalog (Cholecystolithiasis), Disgenet (Crigler-najjar syndrome), GWAS catalog (Melanoma), GWAS catalog (Gallstones), Disgenet (Gilbert syndrome), GWAS catalog (Liver disease), Disgenet (Lucey-driscoll syndrome), GWAS catalog (Neuroblastoma), GWAS catalog (Nonalcoholic fatty liver disease), GWAS catalog (Perinatal disease) Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism — evidence mostly GWAS catalog. UGT1A6 9 shared diseasesBilirubin metabolism disease, Cholecystolithiasis, Crigler-najjar syndrome, Gallstones, Gilbert syndrome, Liver disease, Lucey-driscoll syndrome, Neuroblastoma, Perinatal disease 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more 11 shared evidence sourcesGWAS catalog (Bilirubin metabolism disease), GWAS catalog (Cholecystolithiasis), Disgenet (Crigler-najjar syndrome), GWAS catalog (Melanoma), GWAS catalog (Gallstones), Disgenet (Gilbert syndrome), GWAS catalog (Liver disease), Disgenet (Lucey-driscoll syndrome), GWAS catalog (Neuroblastoma), GWAS catalog (Nonalcoholic fatty liver disease), GWAS catalog (Perinatal disease) Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism — evidence mostly GWAS catalog. UGT1A5 8 shared diseasesBilirubin metabolism disease, Cholecystolithiasis, Crigler-najjar syndrome, Gallstones, Gilbert syndrome, Liver disease, Lucey-driscoll syndrome, Perinatal disease 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more 9 shared evidence sourcesGWAS catalog (Bilirubin metabolism disease), GWAS catalog (Cholecystolithiasis), Disgenet (Crigler-najjar syndrome), GWAS catalog (Gallstones), Disgenet (Gilbert syndrome), GWAS catalog (Liver disease), Disgenet (Lucey-driscoll syndrome), GWAS catalog (Nonalcoholic fatty liver disease), GWAS catalog (Perinatal disease) Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
UGT1A8	10	["Bilirubin metabolism disease","Cholecystolithiasis","Crigler-najjar syndrome","Gallstones","Gilbert syndrome","Liver disease","Lucey-driscoll syndrome","Urinary bladder cancer","Neuroblastoma","Perinatal disease"]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	12	["GWAS catalog (Bilirubin metabolism disease)","GWAS catalog (Cholecystolithiasis)","Disgenet (Crigler-najjar syndrome)","GWAS catalog (Melanoma)","GWAS catalog (Gallstones)","Disgenet (Gilbert syndrome)","GWAS catalog (Liver disease)","Disgenet (Lucey-driscoll syndrome)","GWAS catalog (Neuroblastoma)","GWAS catalog (Nonalcoholic fatty liver disease)","GWAS catalog (Perinatal disease)","GWAS catalog (Urinary bladder cancer)"]
UGT1A7	9	["Bilirubin metabolism disease","Cholecystolithiasis","Crigler-najjar syndrome","Gallstones","Gilbert syndrome","Liver disease","Lucey-driscoll syndrome","Neuroblastoma","Perinatal disease"]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	11	["GWAS catalog (Bilirubin metabolism disease)","GWAS catalog (Cholecystolithiasis)","Disgenet (Crigler-najjar syndrome)","GWAS catalog (Melanoma)","GWAS catalog (Gallstones)","Disgenet (Gilbert syndrome)","GWAS catalog (Liver disease)","Disgenet (Lucey-driscoll syndrome)","GWAS catalog (Neuroblastoma)","GWAS catalog (Nonalcoholic fatty liver disease)","GWAS catalog (Perinatal disease)"]
UGT1A9	9	["Bilirubin metabolism disease","Cholecystolithiasis","Crigler-najjar syndrome","Gallstones","Gilbert syndrome","Liver disease","Lucey-driscoll syndrome","Neuroblastoma","Perinatal disease"]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	11	["GWAS catalog (Bilirubin metabolism disease)","GWAS catalog (Cholecystolithiasis)","Disgenet (Crigler-najjar syndrome)","GWAS catalog (Melanoma)","GWAS catalog (Gallstones)","Disgenet (Gilbert syndrome)","GWAS catalog (Liver disease)","Disgenet (Lucey-driscoll syndrome)","GWAS catalog (Neuroblastoma)","GWAS catalog (Nonalcoholic fatty liver disease)","GWAS catalog (Perinatal disease)"]
UGT1A6	9	["Bilirubin metabolism disease","Cholecystolithiasis","Crigler-najjar syndrome","Gallstones","Gilbert syndrome","Liver disease","Lucey-driscoll syndrome","Neuroblastoma","Perinatal disease"]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	11	["GWAS catalog (Bilirubin metabolism disease)","GWAS catalog (Cholecystolithiasis)","Disgenet (Crigler-najjar syndrome)","GWAS catalog (Melanoma)","GWAS catalog (Gallstones)","Disgenet (Gilbert syndrome)","GWAS catalog (Liver disease)","Disgenet (Lucey-driscoll syndrome)","GWAS catalog (Neuroblastoma)","GWAS catalog (Nonalcoholic fatty liver disease)","GWAS catalog (Perinatal disease)"]
UGT1A5	8	["Bilirubin metabolism disease","Cholecystolithiasis","Crigler-najjar syndrome","Gallstones","Gilbert syndrome","Liver disease","Lucey-driscoll syndrome","Perinatal disease"]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	9	["GWAS catalog (Bilirubin metabolism disease)","GWAS catalog (Cholecystolithiasis)","Disgenet (Crigler-najjar syndrome)","GWAS catalog (Gallstones)","Disgenet (Gilbert syndrome)","GWAS catalog (Liver disease)","Disgenet (Lucey-driscoll syndrome)","GWAS catalog (Nonalcoholic fatty liver disease)","GWAS catalog (Perinatal disease)"]

Diseases Linked via Similar Genes

Pancreatitis Linked via 1 of 5 related genesUGT1A7 Kidney failure Linked via 1 of 5 related genesUGT1A9 Contact dermatitis Linked via 1 of 5 related genesUGT1A6

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Pancreatitis	1	["UGT1A7"]
Kidney failure	1	["UGT1A9"]
Contact dermatitis	1	["UGT1A6"]