UGT2A2 (UDP glucuronosyltransferase family 2 member A2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 574537
• Gene name: UDP glucuronosyltransferase family 2 member A2
• Gene symbol: UGT2A2
• Synonyms (NCBI Gene): UDPGT 2A2
• Chromosome: 4
• Chromosome location: 4q13.3

miRNA Show/Hide all (46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT526567	hsa-miR-548u	PAR-CLIP	22012620
MIRT526566	hsa-miR-7161-5p	PAR-CLIP	22012620
MIRT526565	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT526564	hsa-miR-141-5p	PAR-CLIP	22012620
MIRT526563	hsa-miR-4762-5p	PAR-CLIP	22012620
MIRT526562	hsa-miR-4645-3p	PAR-CLIP	22012620
MIRT526561	hsa-miR-4477a	PAR-CLIP	22012620
MIRT526560	hsa-miR-6509-3p	PAR-CLIP	22012620
MIRT526559	hsa-miR-4436b-5p	PAR-CLIP	22012620
MIRT526567	hsa-miR-548u	PAR-CLIP	22012620
MIRT526566	hsa-miR-7161-5p	PAR-CLIP	22012620
MIRT526565	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT526564	hsa-miR-141-5p	PAR-CLIP	22012620
MIRT526563	hsa-miR-4762-5p	PAR-CLIP	22012620
MIRT526562	hsa-miR-4645-3p	PAR-CLIP	22012620
MIRT526561	hsa-miR-4477a	PAR-CLIP	22012620
MIRT526560	hsa-miR-6509-3p	PAR-CLIP	22012620
MIRT526559	hsa-miR-4436b-5p	PAR-CLIP	22012620
MIRT1473598	hsa-miR-125a-5p	CLIP-seq
MIRT1473599	hsa-miR-125b	CLIP-seq
MIRT1473600	hsa-miR-185	CLIP-seq
MIRT1473601	hsa-miR-214	CLIP-seq
MIRT1473602	hsa-miR-3619-5p	CLIP-seq
MIRT1473603	hsa-miR-410	CLIP-seq
MIRT1473604	hsa-miR-421	CLIP-seq
MIRT1473605	hsa-miR-4270	CLIP-seq
MIRT1473606	hsa-miR-4291	CLIP-seq
MIRT1473607	hsa-miR-4306	CLIP-seq
MIRT1473608	hsa-miR-4319	CLIP-seq
MIRT1473609	hsa-miR-4441	CLIP-seq
MIRT1473610	hsa-miR-4644	CLIP-seq
MIRT1473611	hsa-miR-4732-3p	CLIP-seq
MIRT1473612	hsa-miR-670	CLIP-seq
MIRT1473613	hsa-miR-761	CLIP-seq
MIRT1473614	hsa-miR-922	CLIP-seq
MIRT1473606	hsa-miR-4291	CLIP-seq
MIRT2462858	hsa-miR-3121-3p	CLIP-seq
MIRT2462859	hsa-miR-3123	CLIP-seq
MIRT2462860	hsa-miR-3647-3p	CLIP-seq
MIRT2462861	hsa-miR-3925-5p	CLIP-seq
MIRT2462862	hsa-miR-3927	CLIP-seq
MIRT2462863	hsa-miR-3978	CLIP-seq
MIRT2462864	hsa-miR-4261	CLIP-seq
MIRT2462865	hsa-miR-4282	CLIP-seq
MIRT2462866	hsa-miR-4451	CLIP-seq
MIRT2462867	hsa-miR-539	CLIP-seq

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	19858781
GO:0008194	Function	UDP-glycosyltransferase activity	IEA
GO:0008206	Process	Bile acid metabolic process	IDA	23756265
GO:0009608	Process	Response to symbiont	IDA	19858781
GO:0015020	Function	Glucuronosyltransferase activity	IBA
GO:0015020	Function	Glucuronosyltransferase activity	IDA	19858781, 23756265
GO:0015020	Function	Glucuronosyltransferase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA

Other IDs

• MIM: 619809
• HGNC: 28183
• e!Ensembl: ENSG00000271271

Protein

• UniProt ID: P0DTE5
• Protein name: UDP-glucuronosyltransferase 2A2 (UDPGT 2A2) (EC 2.4.1.17)
• Protein function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either th
• Tissue specificity: TISSUE SPECIFICITY: Mainly expressed in the nasal mucosa. {ECO:0000269|PubMed:19858781}.
• Sequence:

  MVSIRDFTMPKKFVQMLVFNLTLTEVVLSGNVLIWPTDGSHWLNIKIILEELIQRNHNVT
  VLASSATLFINSNPDSPVNFEVIPVSYKKSNIDSLIEHMIMLWIDHRPTPLTIWAFYKEL
  GKLLDTFFQINIQLCDGVLKNPKLMARLQKGGFDVLVADPVTICGDLVALKLGIPFMYTL
  RFSPASTVERHCGKIPAPVSYVPAALSELTDQMTFGERIKNTISYSLQDYIFQSYWGEWN
  SYYSKILGRPTTLCETMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEME
  EFIQSSGKNGVVVFSLGSMVKNLTEEKANLIASALAQIPQKVLWRYKGKKPATLGNNTQL
  FDWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAV
  EVNLNTMTSVDLLSALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGA
  KHLRVAAHDLTWFQYHSLDVIGFLLVCVTTAIFLVIQCCLFSCQKFGKIGKKKKRE

• Sequence length: 536

Pathways

KEGG Pathway	Reactome Pathway
Pentose and glucuronate interconversions	Glucuronidation
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Retinol metabolism
Porphyrin metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Biosynthesis of cofactors
Bile secretion
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	31001917, 31469419	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	31001917, 31469419	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31001917, 31469419	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31469419		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31469419		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

UGT2A1 1 shared diseaseOvarian epithelial cancer 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more 1 shared evidence sourceGWAS catalog (Ovarian epithelial cancer) Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism — evidence mostly GWAS catalog. UGT2B4 1 shared diseaseOvarian epithelial cancer 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more 1 shared evidence sourceGWAS catalog (Ovarian epithelial cancer) Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism — evidence mostly GWAS catalog. UGT2B11 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism. UGT2B28 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism. UGT1A10 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
UGT2A1	1	["Ovarian epithelial cancer"]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	1	["GWAS catalog (Ovarian epithelial cancer)"]
UGT2B4	1	["Ovarian epithelial cancer"]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	1	["GWAS catalog (Ovarian epithelial cancer)"]
UGT2B11	0	[]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	0	[]
UGT2B28	0	[]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	0	[]
UGT1A10	0	[]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	0	[]

Diseases Linked via Similar Genes

Autism Linked via 4 of 5 related genesUGT2A1, UGT2B4, UGT2B11, UGT1A10 Central nervous system cancer Linked via 2 of 5 related genesUGT2B11, UGT2B28 Glioblastoma Linked via 2 of 5 related genesUGT2B11, UGT2B28 Glioma Linked via 2 of 5 related genesUGT2B11, UGT2B28 Hypertension Linked via 1 of 5 related genesUGT2A1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Autism	4	["UGT2A1","UGT2B4","UGT2B11","UGT1A10"]
Central nervous system cancer	2	["UGT2B11","UGT2B28"]
Glioblastoma	2	["UGT2B11","UGT2B28"]
Glioma	2	["UGT2B11","UGT2B28"]
Hypertension	1	["UGT2A1"]