Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	54490
Gene name	UDP glucuronosyltransferase family 2 member B28
Gene symbol	UGT2B28
Synonyms (NCBI Gene)	-
Chromosome	4
Chromosome location	4q13.2
Summary	This gene encodes a member of the uridine diphosphoglucuronosyltransferase protein family. The encoded enzyme catalyzes the transfer of glucuronic acid from uridine diphosphoglucuronic acid to a diverse array of substrates including steroid hormones and l

45 Show/Hide all (45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT661642	hsa-miR-3129-3p	HITS-CLIP	23824327
MIRT661641	hsa-miR-5583-5p	HITS-CLIP	23824327
MIRT661640	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT661639	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT661638	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT661637	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT661636	hsa-miR-1248	HITS-CLIP	23824327
MIRT661635	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT661634	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT661633	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT661632	hsa-miR-623	HITS-CLIP	23824327
MIRT661631	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT661630	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT661629	hsa-miR-1287-3p	HITS-CLIP	23824327
MIRT661628	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT661627	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT661626	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT661625	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT661624	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT661623	hsa-miR-5584-3p	HITS-CLIP	23824327
MIRT661642	hsa-miR-3129-3p	HITS-CLIP	23824327
MIRT661641	hsa-miR-5583-5p	HITS-CLIP	23824327
MIRT661640	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT661639	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT661638	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT661637	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT661636	hsa-miR-1248	HITS-CLIP	23824327
MIRT661635	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT661634	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT661633	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT661632	hsa-miR-623	HITS-CLIP	23824327
MIRT661631	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT661630	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT661629	hsa-miR-1287-3p	HITS-CLIP	23824327
MIRT661628	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT661627	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT661626	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT661625	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT661624	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT661623	hsa-miR-5584-3p	HITS-CLIP	23824327
MIRT1473649	hsa-miR-216b	CLIP-seq
MIRT1473650	hsa-miR-3921	CLIP-seq
MIRT1473651	hsa-miR-4255	CLIP-seq
MIRT1473652	hsa-miR-4653-5p	CLIP-seq
MIRT1473653	hsa-miR-4766-5p	CLIP-seq

15 Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005640	Component	Nuclear outer membrane	IDA	11300766
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	11300766
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0008194	Function	UDP-glycosyltransferase activity	IEA
GO:0008202	Process	Steroid metabolic process	IDA	11300766
GO:0008210	Process	Estrogen metabolic process	IBA
GO:0015020	Function	Glucuronosyltransferase activity	IBA
GO:0015020	Function	Glucuronosyltransferase activity	IDA	11300766
GO:0015020	Function	Glucuronosyltransferase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA

MIM	HGNC	e!Ensembl
606497	13479	ENSG00000135226

Q9BY64

Protein name

UDP-glucuronosyltransferase 2B28 (UDPGT 2B28) (UGT2B28) (EC 2.4.1.17)

Protein function

[Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion i

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00201	UDPGT	24 → 526	UDP-glucoronosyl and UDP-glucosyl transferase	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the liver, breast and kidney. {ECO:0000269|PubMed:11300766}.

Sequence

MALKWTSVLLLIHLGCYFSSGSCGKVLVWTGEYSHWMNMKTILKELVQRGHEVTVLASSA
SILFDPNDAFTLKLEVYPTSLTKTEFENIIMQQVKRWSDIQKDSFWLYFSQEQEILWEFH
DIFRNFCKDVVSNKKVMKKLQESRFDIIFADAFFPCGELLAALLNIPFVYSLCFTPGYTI
ERHSGGLIFPPSYIPVVMSKLSDQMTFMERVKNMIYVLYFDFWFQMCDMKKWDQFYSEVL
GRPTTLFETMGKADIWLMRNSWSFQFPHPFLPNIDFVGGLHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSVISNMTAERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQN
DLLGLPKTRAFITHGGANGIYEAIYHGIPMVGIPLFWDQPDNIAHMKAKGAAVRLDFHTM
SSTDLLNALKTVINDPSYKENVMKLSIIQHDQPVKPLHRAVFWIEFVMCHKGAKHLRVAA
RDLTWFQYHSLDVIGFLLACVATVIFVVTKFCLFCFWKFARKGKKGKRD

Sequence length

529

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Pentose and glucuronate interconversions	Glucuronidation
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Retinol metabolism
Porphyrin metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Biosynthesis of cofactors
Bile secretion
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (14)
Addison Disease	Addison`s Disease	BEFREE	21851588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	36347965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31805979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23575887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30628680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	30628680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	20056642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31805979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26215610, 28882566, 31434609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	40264209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	28901451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26215610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26215610, 28882566, 31434609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28673330, 35954173, 36347965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
UGT2B11	[]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	[]
UGT2A1	[]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	[]
UGT1A10	[]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	[]
UGT1A8	[]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	[]
UGT1A7	[]	13	["Pentose and glucuronate interconversions","Ascorbate and aldarate metabolism","Steroid hormone biosynthesis","Retinol metabolism","Porphyrin metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Biosynthesis of cofactors","Bile secretion","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation"]	[]

UGT2B28 (UDP glucuronosyltransferase family 2 member B28)

Bookmark This Gene