UGT2B11 (UDP glucuronosyltransferase family 2 member B11)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 10720
Gene name UDP glucuronosyltransferase family 2 member B11
Gene symbol UGT2B11
Synonyms (NCBI Gene)
-
Chromosome 4
Chromosome location 4q13.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14 Show/Hide all (14)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IEA
GO:0006805 Process Xenobiotic metabolic process TAS 8333863
GO:0008194 Function UDP-glycosyltransferase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
603064 12545 ENSG00000213759
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75310
Protein name UDP-glucuronosyltransferase 2B11 (UDPGT 2B11) (EC 2.4.1.17)
Protein function UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00201 UDPGT 24 → 526 UDP-glucoronosyl and UDP-glucosyl transferase Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed.
Sequence 
MTLKWTSVLLLIHLSCYFSSGSCGKVLVWAAEYSHWMNMKTILKELVQRGHEVTVLASSA
SILFDPNDASTLKFEVYPTSLTKTEFENIIMQQVKRWSDIRKDSFWLYFSQEQEILWELY
DIFRNFCKDVVSNKKVMKKLQESRFDIVFADAVFPCGELLAALLNIRFVYSLRFTPGYTI
ERHSGGLIFPPSYIPIVMSKLSDQMTFMERVKNMIYVLYFDFWFQMSDMKKWDQFYSEVL
GRPTTLFETMGKADIWLMRNSWSFQFPHPFLPNVDFVGGFHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSVISNMTAERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRLDFNTM
SSTDLLNALKTVINDPLYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMPHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLACVATVIFIITKFCLFCFWKFARKGKKGKRD
Sequence length 529
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Pentose and glucuronate interconversions Glucuronidation
Ascorbate and aldarate metabolism  
Steroid hormone biosynthesis  
Retinol metabolism  
Porphyrin metabolism  
Metabolism of xenobiotics by cytochrome P450  
Drug metabolism - cytochrome P450  
Drug metabolism - other enzymes  
Metabolic pathways  
Biosynthesis of cofactors  
Bile secretion  
Chemical carcinogenesis - DNA adducts  
Chemical carcinogenesis - receptor activation  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
6
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (6)
Phenotype Name Clinical Significance Source Reference Evidence Score
AUTISM SPECTRUM DISORDER — CTD 35663546
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER — GWAS catalog 36810956
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE — GWAS catalog 30177863
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma Likely benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME — GWAS catalog 36810956
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Intrahepatic Cholangiocarcinoma Intrahepatic Cholangiocarcinoma BEFREE 17006947
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of prostate Prostate cancer BEFREE 31434609
★★★★★
★☆☆☆☆
Found in Text Mining only
Prostate carcinoma Prostate cancer BEFREE 31434609
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
UGT2A1 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism. UGT2B28 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism. UGT1A10 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism. UGT1A8 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism. UGT1A7 13 shared pathwaysPentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Steroid hormone biosynthesis, Retinol metabolism, Porphyrin metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Biosynthesis of cofactors, Bile secretion, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation +1 more Related via 13 shared pathways including Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism.
Bilirubin metabolism disease Linked via 3 of 5 related genesUGT1A10, UGT1A8, UGT1A7 Cholecystolithiasis Linked via 3 of 5 related genesUGT1A10, UGT1A8, UGT1A7 Crigler-najjar syndrome Linked via 3 of 5 related genesUGT1A10, UGT1A8, UGT1A7 Melanoma Linked via 3 of 5 related genesUGT1A10, UGT1A8, UGT1A7 Gallstones Linked via 3 of 5 related genesUGT1A10, UGT1A8, UGT1A7