SUPT5H (SPT5 homolog, DSIF elongation factor subunit)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6829
• Gene name: SPT5 homolog, DSIF elongation factor subunit
• Gene symbol: SUPT5H
• Synonyms (NCBI Gene): SPT5, SPT5H, Tat-CT1
• Chromosome: 19
• Chromosome location: 19q13.2

miRNA Show/Hide all (25)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020754	hsa-miR-155-5p	Proteomics	18668040
MIRT025307	hsa-miR-34a-5p	Proteomics	21566225
MIRT025307	hsa-miR-34a-5p	Proteomics	21566225
MIRT025307	hsa-miR-34a-5p	Proteomics	21566225
MIRT029450	hsa-miR-26b-5p	Microarray	19088304
MIRT051148	hsa-miR-16-5p	CLASH	23622248
MIRT049464	hsa-miR-92a-3p	CLASH	23622248
MIRT049464	hsa-miR-92a-3p	CLASH	23622248
MIRT045555	hsa-miR-149-5p	CLASH	23622248
MIRT042864	hsa-miR-324-3p	CLASH	23622248
MIRT042043	hsa-miR-484	CLASH	23622248
MIRT040704	hsa-miR-92b-3p	CLASH	23622248
MIRT038889	hsa-miR-93-3p	CLASH	23622248
MIRT036670	hsa-miR-935	CLASH	23622248
MIRT036363	hsa-miR-1229-3p	CLASH	23622248
MIRT1403603	hsa-miR-1205	CLIP-seq
MIRT1403604	hsa-miR-1286	CLIP-seq
MIRT1403605	hsa-miR-129-3p	CLIP-seq
MIRT1403606	hsa-miR-3148	CLIP-seq
MIRT1403607	hsa-miR-3173-5p	CLIP-seq
MIRT1403608	hsa-miR-3688-3p	CLIP-seq
MIRT1403609	hsa-miR-4459	CLIP-seq
MIRT1403610	hsa-miR-4687-5p	CLIP-seq
MIRT1403611	hsa-miR-4722-5p	CLIP-seq
MIRT1403606	hsa-miR-3148	CLIP-seq

Gene ontology (GO) Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	9450929
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	10075709
GO:0003682	Function	Chromatin binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003729	Function	MRNA binding	IBA
GO:0005515	Function	Protein binding	IPI	10075709, 16169070, 16327805, 17404243, 21044950, 21715506, 21988832, 23652018, 24814348, 24981860, 25416956, 25502805, 26496610, 26789250, 27107012, 31515488, 32296183, 35271311
GO:0005634	Component	Nucleus	IDA	9450929, 10075709
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006354	Process	DNA-templated transcription elongation	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006368	Process	Transcription elongation by RNA polymerase II	IBA
GO:0006368	Process	Transcription elongation by RNA polymerase II	IDA	9450929
GO:0006368	Process	Transcription elongation by RNA polymerase II	IMP	10075709
GO:0016239	Process	Positive regulation of macroautophagy	IMP	22354037
GO:0019899	Function	Enzyme binding	IPI	10075709
GO:0032044	Component	DSIF complex	IBA
GO:0032044	Component	DSIF complex	IDA	9450929
GO:0032044	Component	DSIF complex	IPI	19860741
GO:0032784	Process	Regulation of DNA-templated transcription elongation	IEA
GO:0032785	Process	Negative regulation of DNA-templated transcription, elongation	IDA	9450929
GO:0032785	Process	Negative regulation of DNA-templated transcription, elongation	IMP	10075709
GO:0032786	Process	Positive regulation of DNA-templated transcription, elongation	IDA	9450929
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	IDA	16427012
GO:0034243	Process	Regulation of transcription elongation by RNA polymerase II	IDA	9450929
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9450929
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	9450929

Other IDs

• MIM: 602102
• HGNC: 11469
• e!Ensembl: ENSG00000196235

Protein

• UniProt ID: O00267
• Protein name: Transcription elongation factor SPT5 (hSPT5) (DRB sensitivity-inducing factor 160 kDa subunit) (DSIF p160) (DRB sensitivity-inducing factor large subunit) (DSIF large subunit) (Tat-cotransactivator 1 protein) (Tat-CT1 protein)
• Protein function: Component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II (PubMed:10075709, PubMed:10199401, PubMed:10421630, PubMed:10757782, PubMed:10912001, PubM
• PDB: 2DO3 , 2E6Z , 2E70 , 3H7H , 4L1U , 5OHO , 5OHQ , 5OIK , 5U98 , 6EQY , 6ER0 , 6GMH , 6GML , 6TED , 7OKX , 7OKY , 7OL0 , 7PKS , 7UNC , 7UND , 7YCX , 8A3Y , 8P4C , 8P4D , 8P4E , 8P4F , 8RBX , 8UHA , 8UHD , 8UHG , 8UI0 , 8UIS , 8W8E , 8W8F , 9EGX , 9EGY , 9EGZ , 9EH0 , 9EH2 , 9J0N , 9J0O , 9J0P
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00467	KOW	474 → 505	KOW motif	Family
  PF03439	Spt5-NGN	178 → 264	Early transcription elongation factor of RNA pol II, NGN section	Family
  PF11942	Spt5_N	75 → 172	Spt5 transcription elongation factor, acidic N-terminal	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:10075709, ECO:0000269|PubMed:8975720}.
• Sequence:

  MSDSEDSNFSEEEDSERSSDGEEAEVDEERRSAAGSEKEEEPEDEEEEEEEEEYDEEEEE
  EDDDRPPKKPRHGGFILDEADVDDEYEDEDQWEDGAEDILEKEEIEASNIDNVVLDEDRS
  GARRLQNLWRDQREEELGEYYMKKYAKSSVGETVYGGSDELSDDITQQQLLPGVKDPNLW
  TVKCKIGEERATAISLMRKFIAYQFTDTPLQIKSVVAPEHVKGYIYVEAYKQTHVKQAIE
  GVGNLRLGYWNQQMVPIKEMTDVLKVVKEVANLKPKSWVRLKRGIYKDDIAQVDYVEPSQ
  NTISLKMIPRIDYDRIKARMSLKDWFAKRKKFKRPPQRLFDAEKIRSLGGDVASDGDFLI
  FEGNRYSRKGFLFKSFAMSAVITEGVKPTLSELEKFEDQPEGIDLEVVTESTGKEREHNF
  QPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKYFKMGDHVKV
  IAGRFEGDTGLIVRVEENFVILFSDLTMHELKVLPRDLQLCSETASGVDVGGQHEWGELV
  QLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRKKDNRFAVALDSEQNNIHVKDIV
  KVIDGPHSGREGEIRHLFRSFAFLHCKKLVENGGMFVCKTRHLVLAGGSKPRDVTNFTVG
  GFAPMSPRISSPMHPSAGGQRGGFGSPGGGSGGMSRGRGRRDNELIGQTVRISQGPYKGY
  IGVVKDATESTARVELHSTCQTISVDRQRLTTVGSRRPGGMTSTYGRTPMYGSQTPMYGS
  GSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAF
  DDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQG
  SYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSP
  GGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSE
  KVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRF
  LGKLLEA

• Sequence length: 1087

Pathways

KEGG Pathway	Reactome Pathway
Viral life cycle - HIV-1	Formation of RNA Pol II elongation complex
	Formation of the Early Elongation Complex
	Formation of HIV-1 elongation complex containing HIV-1 Tat
	RNA Polymerase II Pre-transcription Events
	TP53 Regulates Transcription of DNA Repair Genes
	RNA polymerase II transcribes snRNA genes
	mRNA Capping
	RNA Polymerase II Transcription Elongation
	RNA Pol II CTD phosphorylation and interaction with CE

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Malignant tumor of esophagus	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (8)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
beta Thalassemia	Beta thalassemia	Pubtator	40159794	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18197258	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32961044	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26418880	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26418880		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26418880		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	28009271	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31564557		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

SUPT4H1 8 shared pathwaysViral life cycle - HIV-1, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of the Early Elongation Complex, RNA polymerase II transcribes snRNA genes, Formation of HIV-1 elongation complex containing HIV-1 Tat Related via 8 shared pathways including Viral life cycle - HIV-1, Formation of RNA Pol II elongation complex . NELFB 7 shared pathwaysViral life cycle - HIV-1, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of the Early Elongation Complex, Formation of HIV-1 elongation complex containing HIV-1 Tat Related via 7 shared pathways including Viral life cycle - HIV-1, Formation of RNA Pol II elongation complex . NELFCD 7 shared pathwaysViral life cycle - HIV-1, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of the Early Elongation Complex, Formation of HIV-1 elongation complex containing HIV-1 Tat Related via 7 shared pathways including Viral life cycle - HIV-1, Formation of RNA Pol II elongation complex . NELFA 7 shared pathwaysViral life cycle - HIV-1, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of the Early Elongation Complex, Formation of HIV-1 elongation complex containing HIV-1 Tat Related via 7 shared pathways including Viral life cycle - HIV-1, Formation of RNA Pol II elongation complex . NELFE 7 shared pathwaysViral life cycle - HIV-1, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of the Early Elongation Complex, Formation of HIV-1 elongation complex containing HIV-1 Tat Related via 7 shared pathways including Viral life cycle - HIV-1, Formation of RNA Pol II elongation complex .

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SUPT4H1	0	[]	8	["Viral life cycle - HIV-1","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of the Early Elongation Complex","RNA polymerase II transcribes snRNA genes","Formation of HIV-1 elongation complex containing HIV-1 Tat"]	0	[]
NELFB	0	[]	7	["Viral life cycle - HIV-1","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of the Early Elongation Complex","Formation of HIV-1 elongation complex containing HIV-1 Tat"]	0	[]
NELFCD	0	[]	7	["Viral life cycle - HIV-1","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of the Early Elongation Complex","Formation of HIV-1 elongation complex containing HIV-1 Tat"]	0	[]
NELFA	0	[]	7	["Viral life cycle - HIV-1","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of the Early Elongation Complex","Formation of HIV-1 elongation complex containing HIV-1 Tat"]	0	[]
NELFE	0	[]	7	["Viral life cycle - HIV-1","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of the Early Elongation Complex","Formation of HIV-1 elongation complex containing HIV-1 Tat"]	0	[]

Diseases Linked via Similar Genes

Major depressive disorder Linked via 1 of 5 related genesSUPT4H1 Prostate cancer Linked via 1 of 5 related genesSUPT4H1 Uterine fibroid Linked via 1 of 5 related genesSUPT4H1 Diabetes mellitus type 2 Linked via 1 of 5 related genesNELFCD Alzheimer disease Linked via 1 of 5 related genesNELFA

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Major depressive disorder	1	["SUPT4H1"]
Prostate cancer	1	["SUPT4H1"]
Uterine fibroid	1	["SUPT4H1"]
Diabetes mellitus type 2	1	["NELFCD"]
Alzheimer disease	1	["NELFA"]