Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	25920
Gene name	Negative elongation factor complex member B
Gene symbol	NELFB
Synonyms (NCBI Gene)	COBRA1NELF-B
Chromosome	9
Chromosome location	9q34.3
Summary	NELFB is a subunit of negative elongation factor (NELF), which also includes NELFA (WHSC2; MIM 606026), either NELFC or NELFD (TH1L; MIM 605297), and NELFE (RDBP; MIM 154040). NELF acts with DRB sensitivity-inducing factor (DSIF), a heterodimer of SPT4 (S

miRTarBase ID	miRNA	Experiments	Reference
MIRT045525	hsa-miR-149-5p	CLASH	23622248
MIRT043077	hsa-miR-324-5p	CLASH	23622248

21 Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	11739404, 12612062, 14667819, 17474147, 20195357, 20211142, 24981860, 26496610, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	12612062
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008283	Process	Cell population proliferation	ISS
GO:0032021	Component	NELF complex	IBA
GO:0032021	Component	NELF complex	IDA	12612062
GO:0032021	Component	NELF complex	IPI	12612062
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	IBA
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	IDA	12612062
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	IEA
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0048863	Process	Stem cell differentiation	IEA
GO:0048863	Process	Stem cell differentiation	ISS
GO:2000737	Process	Negative regulation of stem cell differentiation	IEA
GO:2000737	Process	Negative regulation of stem cell differentiation	ISS

MIM	HGNC	e!Ensembl
611180	24324	ENSG00000188986

Q8WX92

Protein name

Negative elongation factor B (NELF-B) (Cofactor of BRCA1)

Protein function

Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II (PubMed:12612062). The NELF complex, which acts via an association with the DSIF complex and causes transcriptional

PDB

6GML , 7PKS , 7YCX , 8JJ6 , 8RBX , 8UHA , 8UHD , 8UHG , 8UI0 , 8W8E , 9J0N , 9J0O , 9J0P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06209	COBRA1	107 → 578	Cofactor of BRCA1 (COBRA1)	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed in heart, brain, lung, placenta, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:12612062}.

Sequence

MFAGLQDLGVANGEDLKETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLE
FHQSVFDELRDKLLERVSAIASEGKAEERYKKLEDLLEKSFSLVKMPSLQPVVMCVMKHL
PKVPEKKLKLVMADKELYRACAVEVKRQIWQDNQALFGDEVSPLLKQYILEKESALFSTE
LSVLHNFFSPSPKTRRQGEVVQRLTRMVGKNVKLYDMVLQFLRTLFLRTRNVHYCTLRAE
LLMSLHDLDVGEICTVDPCHKFTWCLDACIRERFVDSKRARELQGFLDGVKKGQEQVLGD
LSMILCDPFAINTLALSTVRHLQELVGQETLPRDSPDLLLLLRLLALGQGAWDMIDSQVF
KEPKMEVELITRFLPMLMSFLVDDYTFNVDQKLPAEEKAPVSYPNTLPESFTKFLQEQRM
ACEVGLYYVLHITKQRNKNALLRLLPGLVETFGDLAFGDIFLHLLTGNLALLADEFALED
FCSSLFDGFFLTASPRKENVHRHALRLLIHLHPRVAPSKLEALQKALEPTGQSGEAVKEL
YSQLGEKLEQLDHRKPSPAQAAETPALELPLPSVPAPAPL

Sequence length

580

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Viral life cycle - HIV-1	Formation of RNA Pol II elongation complex
	Formation of the Early Elongation Complex
	Formation of HIV-1 elongation complex containing HIV-1 Tat
	RNA Polymerase II Pre-transcription Events
	TP53 Regulates Transcription of DNA Repair Genes
	RNA Polymerase II Transcription Elongation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Gastric cancer	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (14)
Adenocarcinoma	Adenocarcinoma	BEFREE	16452188		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29750782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15185750, 16452188, 29426838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12612062, 17910036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18071589	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34705606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28112367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15185750, 16452188, 29426838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30036938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15185750, 18071589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16452188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30036938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	30036938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16452188		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
NELFCD	[]	7	["Viral life cycle - HIV-1","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of the Early Elongation Complex","Formation of HIV-1 elongation complex containing HIV-1 Tat"]	[]
NELFA	[]	7	["Viral life cycle - HIV-1","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of the Early Elongation Complex","Formation of HIV-1 elongation complex containing HIV-1 Tat"]	[]
NELFE	[]	7	["Viral life cycle - HIV-1","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of the Early Elongation Complex","Formation of HIV-1 elongation complex containing HIV-1 Tat"]	[]
SUPT4H1	[]	7	["Viral life cycle - HIV-1","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of the Early Elongation Complex","Formation of HIV-1 elongation complex containing HIV-1 Tat"]	[]
CTDP1	[]	6	["Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of the Early Elongation Complex","Formation of HIV-1 elongation complex containing HIV-1 Tat"]	[]

NELFB (negative elongation factor complex member B)

Bookmark This Gene