Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	10325
Gene name	Ras related GTP binding B
Gene symbol	RRAGB
Synonyms (NCBI Gene)	RAGBbA465E19.1
Chromosome	X
Chromosome location	Xp11.21
Summary	Ras-homologous GTPases constitute a large family of signal transducers that alternate between an activated, GTP-binding state and an inactivated, GDP-binding state. These proteins represent cellular switches that are operated by GTP-exchange factors and f

7 Show/Hide all (7)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019667	hsa-miR-375	Microarray	20215506
MIRT2614909	hsa-miR-155	CLIP-seq
MIRT2614910	hsa-miR-4251	CLIP-seq
MIRT2614911	hsa-miR-4663	CLIP-seq
MIRT2614912	hsa-miR-4728-3p	CLIP-seq
MIRT2614913	hsa-miR-539	CLIP-seq
MIRT2614914	hsa-miR-570	CLIP-seq

35 Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0005515	Function	Protein binding	IPI	11073942, 20381137, 22424946, 22575674, 23394946, 25259925, 25561175, 25567906, 33961781
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IDA	7499430
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	IMP	22424946, 23723238
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IDA	9394008
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IBA
GO:0005764	Component	Lysosome	IDA	20381137
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005829	Component	Cytosol	TAS
GO:0008104	Process	Intracellular protein localization	IMP	20381137
GO:0009267	Process	Cellular response to starvation	IBA
GO:0010507	Process	Negative regulation of autophagy	IBA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0032006	Process	Regulation of TOR signaling	IGI	23723238
GO:0032008	Process	Positive regulation of TOR signaling	IMP	22575674
GO:0032561	Function	Guanyl ribonucleotide binding	IDA	22575674
GO:0034198	Process	Cellular response to amino acid starvation	IEA
GO:0034198	Process	Cellular response to amino acid starvation	IGI	23723238
GO:0051020	Function	GTPase binding	IPI	22424946
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	IMP	20381137
GO:1904263	Process	Positive regulation of TORC1 signaling	IBA
GO:1904263	Process	Positive regulation of TORC1 signaling	IEA
GO:1904263	Process	Positive regulation of TORC1 signaling	IMP	22424946
GO:1990131	Component	Gtr1-Gtr2 GTPase complex	IBA
GO:1990253	Process	Cellular response to leucine starvation	IMP	22424946

MIM	HGNC	e!Ensembl
300725	19901	ENSG00000083750

Q5VZM2

Protein name

Ras-related GTP-binding protein B (Rag B) (RagB) (EC 3.6.5.-)

Protein function

Guanine nucleotide-binding protein that plays a crucial role in the cellular response to amino acid availability through regulation of the mTORC1 signaling cascade (PubMed:18497260, PubMed:20381137, PubMed:23723238, PubMed:24095279). Forms heter

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04670	Gtr1_RagA	42 → 296	Gtr1/RagA G protein conserved region	Domain

Sequence

MEESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSII
FANYIARDTRRLGATILDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHSHVRFLGNLVLN
LWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPD
AKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIVYQ
LIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQFK
LSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEK
LERVDGPKQCLLMR

Sequence length

374

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Autophagy - animal	Macroautophagy
mTOR signaling pathway	mTOR signalling
Shigellosis	mTORC1-mediated signalling
	Energy dependent regulation of mTOR by LKB1-AMPK
	TP53 Regulates Metabolic Genes
	Regulation of PTEN gene transcription
	Amino acids regulate mTORC1

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	27182965	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colonic Neoplasms	Colonic neoplasm	Pubtator	34320917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35739524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	25418117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
RRAGD	[]	10	["Autophagy - animal","mTOR signaling pathway","Shigellosis","TP53 Regulates Metabolic Genes","Macroautophagy","Regulation of PTEN gene transcription","Amino acids regulate mTORC1","mTOR signalling","mTORC1-mediated signalling","Energy dependent regulation of mTOR by LKB1-AMPK"]	[]
RRAGC	[]	10	["Autophagy - animal","mTOR signaling pathway","Shigellosis","TP53 Regulates Metabolic Genes","Macroautophagy","Regulation of PTEN gene transcription","Amino acids regulate mTORC1","mTOR signalling","mTORC1-mediated signalling","Energy dependent regulation of mTOR by LKB1-AMPK"]	[]
RRAGA	[]	10	["Autophagy - animal","mTOR signaling pathway","Shigellosis","TP53 Regulates Metabolic Genes","Macroautophagy","Regulation of PTEN gene transcription","Amino acids regulate mTORC1","mTOR signalling","mTORC1-mediated signalling","Energy dependent regulation of mTOR by LKB1-AMPK"]	[]
LAMTOR5	[]	8	["mTOR signaling pathway","TP53 Regulates Metabolic Genes","Macroautophagy","Regulation of PTEN gene transcription","Amino acids regulate mTORC1","mTOR signalling","mTORC1-mediated signalling","Energy dependent regulation of mTOR by LKB1-AMPK"]	[]
SLC38A9	[]	8	["mTOR signaling pathway","TP53 Regulates Metabolic Genes","Macroautophagy","Regulation of PTEN gene transcription","Amino acids regulate mTORC1","mTOR signalling","mTORC1-mediated signalling","Energy dependent regulation of mTOR by LKB1-AMPK"]	[]

RRAGB (Ras related GTP binding B)

Bookmark This Gene