RRAGA (Ras related GTP binding A)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 10670
• Gene name: Ras related GTP binding A
• Gene symbol: RRAGA
• Synonyms (NCBI Gene): FIP-1, FIP1, RAGA
• Chromosome: 9
• Chromosome location: 9p22.1

miRNA Show/Hide all (41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020749	hsa-miR-155-5p	Proteomics	18668040
MIRT047378	hsa-miR-34a-5p	CLASH	23622248
MIRT1319318	hsa-miR-15a	CLIP-seq
MIRT1319319	hsa-miR-15b	CLIP-seq
MIRT1319320	hsa-miR-16	CLIP-seq
MIRT1319321	hsa-miR-195	CLIP-seq
MIRT1319322	hsa-miR-302f	CLIP-seq
MIRT1319323	hsa-miR-3132	CLIP-seq
MIRT1319324	hsa-miR-330-3p	CLIP-seq
MIRT1319325	hsa-miR-340	CLIP-seq
MIRT1319326	hsa-miR-3669	CLIP-seq
MIRT1319327	hsa-miR-3974	CLIP-seq
MIRT1319328	hsa-miR-424	CLIP-seq
MIRT1319329	hsa-miR-433	CLIP-seq
MIRT1319330	hsa-miR-4330	CLIP-seq
MIRT1319331	hsa-miR-448	CLIP-seq
MIRT1319332	hsa-miR-4484	CLIP-seq
MIRT1319333	hsa-miR-4490	CLIP-seq
MIRT1319334	hsa-miR-450b-5p	CLIP-seq
MIRT1319335	hsa-miR-4639-5p	CLIP-seq
MIRT1319336	hsa-miR-4700-3p	CLIP-seq
MIRT1319337	hsa-miR-4786-3p	CLIP-seq
MIRT1319338	hsa-miR-487a	CLIP-seq
MIRT1319339	hsa-miR-497	CLIP-seq
MIRT1319340	hsa-miR-498	CLIP-seq
MIRT1319341	hsa-miR-548an	CLIP-seq
MIRT1319342	hsa-miR-603	CLIP-seq
MIRT1319343	hsa-miR-664	CLIP-seq
MIRT2094905	hsa-miR-3121-3p	CLIP-seq
MIRT1319323	hsa-miR-3132	CLIP-seq
MIRT1319327	hsa-miR-3974	CLIP-seq
MIRT1319340	hsa-miR-498	CLIP-seq
MIRT2094905	hsa-miR-3121-3p	CLIP-seq
MIRT1319323	hsa-miR-3132	CLIP-seq
MIRT2319273	hsa-miR-3591-5p	CLIP-seq
MIRT2319274	hsa-miR-4255	CLIP-seq
MIRT1319332	hsa-miR-4484	CLIP-seq
MIRT1319333	hsa-miR-4490	CLIP-seq
MIRT1319336	hsa-miR-4700-3p	CLIP-seq
MIRT1319340	hsa-miR-498	CLIP-seq
MIRT1319341	hsa-miR-548an	CLIP-seq

Gene ontology (GO) Show/Hide all (64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IDA	28890335
GO:0000166	Function	Nucleotide binding	IEA
GO:0002181	Process	Cytoplasmic translation	IDA	8706699, 34314702
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	31601708, 31601764
GO:0003924	Function	GTPase activity	IEA
GO:0005515	Function	Protein binding	IPI	8995684, 11073942, 14660641, 16189514, 20381137, 22424946, 22575674, 22980980, 25259925, 25561175, 25567906, 25936802, 28336668, 28514442, 32296183, 32433612, 33961781, 37398436
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IDA	7499430, 14660641, 31601708, 31601764
GO:0005525	Function	GTP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9394008, 11073942
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	8995684
GO:0005737	Component	Cytoplasm	IDA	9394008, 11073942
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IBA
GO:0005764	Component	Lysosome	IDA	20381137
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005765	Component	Lysosomal membrane	IDA	31601708, 31601764
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0008104	Process	Intracellular protein localization	IMP	20381137
GO:0009267	Process	Cellular response to starvation	IBA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0010507	Process	Negative regulation of autophagy	IBA
GO:0010507	Process	Negative regulation of autophagy	IDA	32561715
GO:0010507	Process	Negative regulation of autophagy	IEA
GO:0010507	Process	Negative regulation of autophagy	IMP	25936802
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	25936802
GO:0031669	Process	Cellular response to nutrient levels	IDA	29236692, 29750193, 31601708, 32561715
GO:0031669	Process	Cellular response to nutrient levels	IDA	31601708, 31601764
GO:0032008	Process	Positive regulation of TOR signaling	IEA
GO:0032008	Process	Positive regulation of TOR signaling	NAS	20381137
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IDA	8995684
GO:0034198	Process	Cellular response to amino acid starvation	IEA
GO:0034198	Process	Cellular response to amino acid starvation	IMP	25936802
GO:0035556	Process	Intracellular signal transduction	IDA	9394008
GO:0038202	Process	TORC1 signaling	IDA	12087098, 29750193, 38006878
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	14660641
GO:0043495	Function	Protein-membrane adaptor activity	IDA	31601708, 31601764
GO:0045947	Process	Negative regulation of translational initiation	IDA	22578813
GO:0045948	Process	Positive regulation of translational initiation	IDA	1922062, 29750193
GO:0046982	Function	Protein heterodimerization activity	IPI	11073942, 14660641
GO:0051219	Function	Phosphoprotein binding	IDA	8995684
GO:0061431	Process	Cellular response to methionine	IDA	38006878
GO:0061462	Process	Protein localization to lysosome	IDA	31601708
GO:0061462	Process	Protein localization to lysosome	IDA	31601708
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	IMP	20381137
GO:0072657	Process	Protein localization to membrane	IDA	31601708, 31601764
GO:1904263	Process	Positive regulation of TORC1 signaling	IBA
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	29236692
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	31601708, 31601764
GO:1904263	Process	Positive regulation of TORC1 signaling	IEA
GO:1904263	Process	Positive regulation of TORC1 signaling	IMP	25936802
GO:1990130	Component	GATOR1 complex	IDA	25936802
GO:1990131	Component	Gtr1-Gtr2 GTPase complex	IBA
GO:1990877	Component	FNIP-folliculin RagC/D GAP	IDA	36103527

Other IDs

• MIM: 612194
• HGNC: 16963
• e!Ensembl: ENSG00000155876

Protein

• UniProt ID: Q7L523
• Protein name: Ras-related GTP-binding protein A (Rag A) (RagA) (EC 3.6.5.-) (Adenovirus E3 14.7 kDa-interacting protein 1) (FIP-1)
• Protein function: Guanine nucleotide-binding protein that plays a crucial role in the cellular response to amino acid availability through regulation of the mTORC1 signaling cascade (PubMed:20381137, PubMed:24095279, PubMed:25936802, PubMed:31601708, PubMed:31601
• PDB: 5X6V , 6CES , 6EHR , 6NZD , 6S6A , 6S6D , 6SB0 , 6SB2 , 6U62 , 6ULG , 6WJ2 , 6WJ3 , 7T3A , 7T3B , 7T3C , 7UX2 , 7UXC , 7UXH , 8DHB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04670	Gtr1_RagA	9 → 235	Gtr1/RagA G protein conserved region	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed with highest levels of expression in skeletal muscle, heart, and brain. {ECO:0000269|PubMed:8995684}.
• Sequence:

  MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNL
  WDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDA
  KIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSIVYQL
  IPNVQQLEMNLRNFAQIIEADEVLLFERATFLVISHYQCKEQRDVHRFEKISNIIKQFKL
  SCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKL
  ERVDGPKHSLLMR

• Sequence length: 313

Pathways

KEGG Pathway	Reactome Pathway
Autophagy - animal	Macroautophagy
mTOR signaling pathway	mTOR signalling
Shigellosis	mTORC1-mediated signalling
	Energy dependent regulation of mTOR by LKB1-AMPK
	TP53 Regulates Metabolic Genes
	E3 ubiquitin ligases ubiquitinate target proteins
	Regulation of PTEN gene transcription
	Amino acids regulate mTORC1

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
CATARACT	—	Disgenet Disgenet	27294265	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (12)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Cataract Autosomal Dominant	Congenital cataract	Pubtator	27294265	Associate	★☆☆☆☆ Found in Text Mining only
Chronic eosinophilic leukemia	Eosinophilic Leukemia	BEFREE	22279048, 29029406		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32468035	Associate	★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	29061612		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	24486648		★☆☆☆☆ Found in Text Mining only
Eosinophilic leukemia	Eosinophilic Leukemia	BEFREE	22279048		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33403789	Associate	★☆☆☆☆ Found in Text Mining only
Hypereosinophilia	Hypereosinophilia	BEFREE	22523564		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic syndrome	Hypereosinophilic Syndrome	BEFREE	17549478		★☆☆☆☆ Found in Text Mining only
Idiopathic Hypereosinophilic Syndrome	Hypereosinophilic Syndrome	BEFREE	16343267, 16996710, 17549478		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22279048		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24486648		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

RRAGB 10 shared pathwaysAutophagy - animal, mTOR signaling pathway, Shigellosis, TP53 Regulates Metabolic Genes, Macroautophagy, Regulation of PTEN gene transcription, Amino acids regulate mTORC1, mTOR signalling, mTORC1-mediated signalling, Energy dependent regulation of mTOR by LKB1-AMPK Related via 10 shared pathways including Autophagy - animal, mTOR signaling pathway. RRAGD 10 shared pathwaysAutophagy - animal, mTOR signaling pathway, Shigellosis, TP53 Regulates Metabolic Genes, Macroautophagy, Regulation of PTEN gene transcription, Amino acids regulate mTORC1, mTOR signalling, mTORC1-mediated signalling, Energy dependent regulation of mTOR by LKB1-AMPK Related via 10 shared pathways including Autophagy - animal, mTOR signaling pathway. RRAGC 10 shared pathwaysAutophagy - animal, mTOR signaling pathway, Shigellosis, TP53 Regulates Metabolic Genes, Macroautophagy, Regulation of PTEN gene transcription, Amino acids regulate mTORC1, mTOR signalling, mTORC1-mediated signalling, Energy dependent regulation of mTOR by LKB1-AMPK Related via 10 shared pathways including Autophagy - animal, mTOR signaling pathway. LAMTOR5 8 shared pathwaysmTOR signaling pathway, TP53 Regulates Metabolic Genes, Macroautophagy, Regulation of PTEN gene transcription, Amino acids regulate mTORC1, mTOR signalling, mTORC1-mediated signalling, Energy dependent regulation of mTOR by LKB1-AMPK Related via 8 shared pathways including mTOR signaling pathway, TP53 Regulates Metabolic Genes. SLC38A9 8 shared pathwaysmTOR signaling pathway, TP53 Regulates Metabolic Genes, Macroautophagy, Regulation of PTEN gene transcription, Amino acids regulate mTORC1, mTOR signalling, mTORC1-mediated signalling, Energy dependent regulation of mTOR by LKB1-AMPK Related via 8 shared pathways including mTOR signaling pathway, TP53 Regulates Metabolic Genes.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
RRAGB	0	[]	10	["Autophagy - animal","mTOR signaling pathway","Shigellosis","TP53 Regulates Metabolic Genes","Macroautophagy","Regulation of PTEN gene transcription","Amino acids regulate mTORC1","mTOR signalling","mTORC1-mediated signalling","Energy dependent regulation of mTOR by LKB1-AMPK"]	0	[]
RRAGD	0	[]	10	["Autophagy - animal","mTOR signaling pathway","Shigellosis","TP53 Regulates Metabolic Genes","Macroautophagy","Regulation of PTEN gene transcription","Amino acids regulate mTORC1","mTOR signalling","mTORC1-mediated signalling","Energy dependent regulation of mTOR by LKB1-AMPK"]	0	[]
RRAGC	0	[]	10	["Autophagy - animal","mTOR signaling pathway","Shigellosis","TP53 Regulates Metabolic Genes","Macroautophagy","Regulation of PTEN gene transcription","Amino acids regulate mTORC1","mTOR signalling","mTORC1-mediated signalling","Energy dependent regulation of mTOR by LKB1-AMPK"]	0	[]
LAMTOR5	0	[]	8	["mTOR signaling pathway","TP53 Regulates Metabolic Genes","Macroautophagy","Regulation of PTEN gene transcription","Amino acids regulate mTORC1","mTOR signalling","mTORC1-mediated signalling","Energy dependent regulation of mTOR by LKB1-AMPK"]	0	[]
SLC38A9	0	[]	8	["mTOR signaling pathway","TP53 Regulates Metabolic Genes","Macroautophagy","Regulation of PTEN gene transcription","Amino acids regulate mTORC1","mTOR signalling","mTORC1-mediated signalling","Energy dependent regulation of mTOR by LKB1-AMPK"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 2 of 5 related genesRRAGC, SLC38A9 Androgenetic alopecia Linked via 1 of 5 related genesRRAGB Autism Linked via 1 of 5 related genesRRAGB Gout Linked via 1 of 5 related genesRRAGD Heart failure Linked via 1 of 5 related genesRRAGD

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	2	["RRAGC","SLC38A9"]
Androgenetic alopecia	1	["RRAGB"]
Autism	1	["RRAGB"]
Gout	1	["RRAGD"]
Heart failure	1	["RRAGD"]